HHsearch alignment of GI: 254780309 and MMDB domain: 1dqn_A_60-175

>1dqn_A (A:60-175) Guanine phosphoribosyltransferase; protein-inhibitor complex, Mg IONS, pyrophosphate, transition state analogue; HET: IMU; 1.75A {Giardia lamblia}
Probab=98.69  E-value=2.7e-09  Score=71.31  Aligned_cols=44  Identities=16%  Similarity=0.160  Sum_probs=39.5

Q ss_pred             HHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEE
Q ss_conf             02100289759999200457388999999999789978999999
Q gi|254780309|r   10 YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF   53 (59)
Q Consensus        10 ~~~~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~l   53 (59)
                      .....++||+||||||+++||.|+.++++.|+++|++.+.+++.
T Consensus        52 ~~~~~~~gk~VliVDDii~TG~Tl~~~~~~l~~~g~~~v~~~~~   95 (116)
T 1dqn_A           52 DLKQLKEKREVVLIDEYVDSGHTIFSIQEQIKHAKICSCFVKDV   95 (116)
T ss_dssp             HHHHHHHCSSEEEEEEEESSSHHHHHHHHHSTTCEEEEEEESCH
T ss_pred             CCCCCCCCCCEEEEEHHHHHHHHHHHHHHHHHHCCCCEEEEEEE
T ss_conf             23312378737997311235689999999865459966999753