HHsearch alignment of GI: 254780309 and MMDB domain: 1tc1_A_15-160

>1tc1_A (A:15-160) Protein (hypoxanthine phosphoribosyltransferase); transferase,phosphoribosyltransferase, purine salvage, nucleotide metabolism; HET: FMB MES; 1.41A {Trypanosoma cruzi}
Probab=99.12  E-value=1.3e-10  Score=78.36  Aligned_cols=49  Identities=10%  Similarity=0.142  Sum_probs=44.0

Q ss_pred             CHHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEEEEC
Q ss_conf             1021002897599992004573889999999997899789999998306
Q gi|254780309|r    9 QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL   57 (59)
Q Consensus         9 ~~~~~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~lar~~   57 (59)
                      ......++||+||||||++|||+|+.++++.|+++|+++|++++++...
T Consensus        81 ~~~~~~~~gk~VliVDDvi~TG~T~~~~~~~L~~~G~~~v~~~vl~~~~  129 (146)
T 1tc1_A           81 LDTRHSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKR  129 (146)
T ss_dssp             ECCSSCCTTSEEEEEEEEESSCHHHHHHHHHHHTTCCSEEEEEEEEECT
T ss_pred             CCCCCCCCCCEEEEEECHHHHHHHHHHHHHHHHHHCCCCEEEEEEEEEC
T ss_conf             2474224796279982413589999999999970379815899999707