HHsearch alignment of GI: 254780309 and MMDB domain: 1v9s_A_

>1v9s_A (A:) Uracil phosphoribosyltransferase; pyrimidine salvage, oligomerization, structural genomics; 2.10A {Thermus thermophilus HB8}
Probab=98.81  E-value=3.8e-09  Score=70.51  Aligned_cols=46  Identities=26%  Similarity=0.374  Sum_probs=42.0

Q ss_pred             HHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEEEE
Q ss_conf             2100289759999200457388999999999789978999999830
Q gi|254780309|r   11 VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS   56 (59)
Q Consensus        11 ~~~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~lar~   56 (59)
                      ...+++||+|+||||+++||.|+.++++.|++.||++|++++..-+
T Consensus       117 ~~~dv~g~~viivDdii~TG~T~~~a~~~Lk~~Ga~~I~~~~~h~~  162 (208)
T 1v9s_A          117 LPPDIAERRAFLLDPXLATGGSASLALSLLKERGATGVKLXAILAA  162 (208)
T ss_dssp             CCSCGGGSCEEEECSEESSSHHHHHHHHHHHHTTCCSCEEEEEEEC
T ss_pred             CCCCCCCCEEEEECCHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEC
T ss_conf             5865345669997806642477999999998659984699999854