HHsearch alignment of GI: 254780309 and MMDB domain: 1vch_A_

>1vch_A (A:) Phosphoribosyltransferase-related protein; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.94A {Thermus thermophilus}
Probab=99.26  E-value=1.6e-11  Score=83.40  Aligned_cols=54  Identities=19%  Similarity=0.305  Sum_probs=47.0

Q ss_pred             EEECCHHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEEEECC
Q ss_conf             882510210028975999920045738899999999978997899999983068
Q gi|254780309|r    5 FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK   58 (59)
Q Consensus         5 f~i~~~~~~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~lar~~~   58 (59)
                      ..........++||+|||||||+|||.|+.++++.|+++||+.|++++++....
T Consensus       108 ~~~~~~~~~~~~gk~VliVDDvitTG~Tl~~~~~~L~~~Ga~~v~~~~l~~~~~  161 (175)
T 1vch_A          108 LWLDRRFAEKLLNQRVVLVSDVVASGETMRAMEKMVLRAGGHVVARLAVFRQGT  161 (175)
T ss_dssp             EEECHHHHHHHTTCEEEEEEEEESSSHHHHHHHHHHHHTTCEEEEEEEEEECSC
T ss_pred             EEEECCHHHHCCCCEEEEEEEEECCCCCHHHHHHHHHHCCCEEEEEEEEEEECC
T ss_conf             465211112138988999860786795099999999987997999999997378