HHsearch alignment of GI: 254780309 and MMDB domain: 2dy0_A_

>2dy0_A (A:) APRT, adenine phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.25A {Escherichia coli K12}
Probab=98.91  E-value=3.8e-09  Score=70.48  Aligned_cols=47  Identities=21%  Similarity=0.311  Sum_probs=42.6

Q ss_pred             HHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEEEE
Q ss_conf             02100289759999200457388999999999789978999999830
Q gi|254780309|r   10 YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS   56 (59)
Q Consensus        10 ~~~~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~lar~   56 (59)
                      +....++|++|+||||+++||.|+.++++.|+++||+.|+++++.-.
T Consensus       119 ~~~~~~~G~~vliVDDvi~tG~T~~~~~~~L~~~GA~~v~v~~~~~~  165 (190)
T 2dy0_A          119 HVDAIKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFIINL  165 (190)
T ss_dssp             EGGGCCTTCEEEEEEEEESSCHHHHHHHHHHHHTTCEEEEEEEEEEE
T ss_pred             CCCCCCCCCEEEEEHHHHHCCHHHHHHHHHHHHCCCEEEEEEEEEEC
T ss_conf             15765899989998377441768999999999869989999999985