HHsearch alignment of GI: 254780309 and MMDB domain: 2e55_A_

>2e55_A (A:) Uracil phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.15A {Aquifex aeolicus}
Probab=98.73  E-value=2.1e-08  Score=66.45  Aligned_cols=46  Identities=17%  Similarity=0.222  Sum_probs=41.3

Q ss_pred             HHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEEE
Q ss_conf             0210028975999920045738899999999978997899999983
Q gi|254780309|r   10 YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR   55 (59)
Q Consensus        10 ~~~~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~lar   55 (59)
                      ....+++||+|+|+||+++||.|+..+++.|++.||++|++...--
T Consensus       114 ~~~~d~~g~~viivDdii~TG~T~~~a~~~L~~~Ga~~I~~~h~i~  159 (208)
T 2e55_A          114 SRLPELKGKIVVILDPMLATGGTLEVALREILKHSPLKVKSVHAIA  159 (208)
T ss_dssp             EECCCCBTSEEEEECSEESSSHHHHHHHHHHHTTCBSEEEEEEEEE
T ss_pred             HHHHHCCCCCEEEECHHHCCCHHHHHHHHHHHHCCCCCEEEEEEEE
T ss_conf             2244305770798616763773799999998625886179999986