HHsearch alignment of GI: 254780309 and MMDB domain: 2geb_A_20-156

>2geb_A (A:20-156) Hypoxanthine-guanine phosphoribosyltransferase; HGPRT, mutant, inhibitor design, selectivity; 1.70A {Thermoanaerobacter tengcongensis}
Probab=99.04  E-value=5e-10  Score=75.28  Aligned_cols=50  Identities=16%  Similarity=0.236  Sum_probs=43.9

Q ss_pred             ECCHHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEEEE
Q ss_conf             25102100289759999200457388999999999789978999999830
Q gi|254780309|r    7 VPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS   56 (59)
Q Consensus         7 i~~~~~~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~lar~   56 (59)
                      ........++||+||||||+++||.|+.++.+.|+++|++.|+++++...
T Consensus        69 ~~~~~~~~~~gk~vliVDDii~tG~T~~~~~~~l~~~G~~~v~~~~l~~~  118 (137)
T 2geb_A           69 IIKDHDIDIEGKDVLIVEDIIDSGLTLAYLRETLLGRKPRSLKICTILDK  118 (137)
T ss_dssp             EEECCCSCCTTSEEEEEEEEESSCHHHHHHHHHHHTTCCSEEEEEEEEEC
T ss_pred             EECCCCCCCCCCEEEEEEEEHHHHHHHHHHHHHHHHHCCCCEEEEEEEEC
T ss_conf             82467527789989999503022299999999997212456289999871