HHsearch alignment of GI: 254780309 and MMDB domain: 2jbh_A_

>2jbh_A (A:) HHGP; glycosyltransferase, PRTFDC1, transferase, purine salvage; HET: 5GP; 1.7A {Homo sapiens}
Probab=99.09  E-value=3.2e-10  Score=76.33  Aligned_cols=50  Identities=20%  Similarity=0.262  Sum_probs=44.7

Q ss_pred             ECCHHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEEEE
Q ss_conf             25102100289759999200457388999999999789978999999830
Q gi|254780309|r    7 VPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS   56 (59)
Q Consensus         7 i~~~~~~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~lar~   56 (59)
                      .......+++||+|+||||+++||.|+.++++.|++.||++|++++++.-
T Consensus       124 ~~~~~~~~v~Gk~ViIVDDiidtG~Tl~~~~~~l~~~Ga~~V~~~~~~~~  173 (225)
T 2jbh_A          124 IGGDDLSTLAGKNVLIVEDVVGTGRTMKALLSNIEKYKPNMIKVASLLVK  173 (225)
T ss_dssp             ESSSCGGGGTTSEEEEEEEEESSSHHHHHHHHHHHTTCCSEEEEEEEEEE
T ss_pred             EECCCHHHHCCCCEEEEECHHHHHHHHHHHHHHHHHHCCCCEEEEEEEEE
T ss_conf             30465566346426875020417899999999997548421038999990