HHsearch results for GI: 254780309 and protein with PDBid: 1bd3_D

>1bd3_D Uprtase, uracil phosphoribosyltransferase; glycosyltransferase; 1.93A {Toxoplasma gondii} SCOP: c.61.1.1 PDB: 1bd4_D 1jlr_A* 1jls_B* 1upf_D 1upu_D*
Probab=97.50  E-value=0.00011  Score=45.64  Aligned_cols=49  Identities=12%  Similarity=0.180  Sum_probs=40.4

Q ss_pred             ECCHHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCC--EEEEEEEEE
Q ss_conf             2510210028975999920045738899999999978997--899999983
Q gi|254780309|r    7 VPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAM--TVSILTFSR   55 (59)
Q Consensus         7 i~~~~~~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~--~V~~~~lar   55 (59)
                      ....+++++.++.|+|+|.++.||.|+..+.+.|++.|++  ++.++++-.
T Consensus       146 yy~klP~~i~~~~Vll~DPMLATG~S~~~ai~~L~~~Gv~~~~I~~vsvia  196 (243)
T 1bd3_D          146 IYEKLPADIRERWVMLLDPMCATAGSVCKAIEVLLRLGVKEERIIFVNILA  196 (243)
T ss_dssp             EEEECCTTGGGSEEEEECSEESSCHHHHHHHHHHHHHTCCGGGEEEEEEEE
T ss_pred             EHHHCCCCCCCCEEEEECCHHHCCHHHHHHHHHHHHCCCCCCEEEEEEEEE
T ss_conf             142284211014589868055057229999999997199854079999986