HHsearch results for GI: 254780309 and protein with PDBid: 1cjb_A

>1cjb_A Protein (hypoxanthine-guanine phosphoribosyltransferase); malaria, purine salvage, transition state inhibitor; HET: IRP; 2.00A {Plasmodium falciparum} SCOP: c.61.1.1
Probab=98.99  E-value=6.1e-10  Score=73.95  Aligned_cols=49  Identities=24%  Similarity=0.219  Sum_probs=43.3

Q ss_pred             ECCHHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEEE
Q ss_conf             2510210028975999920045738899999999978997899999983
Q gi|254780309|r    7 VPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR   55 (59)
Q Consensus         7 i~~~~~~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~lar   55 (59)
                      +......+++||+|||||||++||.|+.++.+.|++.||++|.+++|.-
T Consensus       127 ~~~~~~~~i~gk~VLLVDDIlDTG~TL~~l~~~L~~~gpksv~vavLld  175 (231)
T 1cjb_A          127 IVSEDLSCLKGKHVLIVEDIIDTGKTLVKFCEYLKKFEIKTVAIACLFI  175 (231)
T ss_dssp             EEESCGGGGBTCEEEEEEEEESSSHHHHHHHHHHGGGCBSEEEEEEEEE
T ss_pred             EECCCHHHHHHCCEEEEECCCCHHHHHHHHHHHHHCCCCCEEEEEEEEE
T ss_conf             7247715454070799832100326999999999716999558884441