HHsearch results for GI: 254780309 and protein with PDBid: 1dqn_A

>1dqn_A Guanine phosphoribosyltransferase; protein-inhibitor complex, Mg IONS, pyrophosphate, transition state analogue; HET: IMU; 1.75A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1dqp_A*
Probab=98.70  E-value=1.2e-09  Score=72.32  Aligned_cols=51  Identities=14%  Similarity=0.115  Sum_probs=42.6

Q ss_pred             CEEEECCHHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEE
Q ss_conf             608825102100289759999200457388999999999789978999999
Q gi|254780309|r    3 NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF   53 (59)
Q Consensus         3 gaf~i~~~~~~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~l   53 (59)
                      |...+..+...+++||+|||||||++||.|+.++.+.|++.|++++.++++
T Consensus       104 g~v~i~~~l~~~i~gk~VLIVDDIiDTG~TL~~l~~~L~~~~~~Sv~v~~l  154 (230)
T 1dqn_A          104 SVVFDEEDLKQLKEKREVVLIDEYVDSGHTIFSIQEQIKHAKICSCFVKDV  154 (230)
T ss_dssp             EEECCHHHHHHHHHCSSEEEEEEEESSSHHHHHHHHHSTTCEEEEEEESCH
T ss_pred             CEEEEECCCCCCCCCCEEEEEEEEECCCHHHHHHHHHHHCCCCCEEEEEEE
T ss_conf             422562276412389748997436717446999998775089868999540