HHsearch results for GI: 254780309 and protein with PDBid: 1o57_A

>1o57_A PUR operon repressor; purine operon repressor, helix-turn-helix domain, phosphoribosyltranseferases, domain recombination, DNA binding; HET: EPE P6G 2PE PG4 1PE; 2.20A {Bacillus subtilis} SCOP: a.4.5.40 c.61.1.1 PDB: 1p4a_A*
Probab=98.42  E-value=3.6e-07  Score=58.99  Aligned_cols=42  Identities=24%  Similarity=0.275  Sum_probs=38.1

Q ss_pred             CCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEEE
Q ss_conf             028975999920045738899999999978997899999983
Q gi|254780309|r   14 HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR   55 (59)
Q Consensus        14 ~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~lar   55 (59)
                      -.+|++||||||+++||.|+.++++.++++||+.+.+.++.-
T Consensus       193 l~~g~rVLIVDDvi~tG~T~~~~i~llre~GA~vvgi~VlVd  234 (291)
T 1o57_A          193 MKTGSNVLIIDDFMKAGGTINGMINLLDEFNANVAGIGVLVE  234 (291)
T ss_dssp             SCTTCEEEEEEEEESSSHHHHHHHHHTGGGTCEEEEEEEEEE
T ss_pred             CCCCCEEEEEHHHHHCCHHHHHHHHHHHHCCCEEEEEEEEEE
T ss_conf             578856998424233277899999999987997999999998