HHsearch results for GI: 254780309 and protein with PDBid: 1qb7_A

>1qb7_A APRT, adenine phosphoribosyltransferase; dinucleotide binding fold; HET: ADE CIT; 1.50A {Leishmania donovani} SCOP: c.61.1.1 PDB: 1qb8_A* 1qcc_A* 1qcd_A 1mzv_A*
Probab=98.47  E-value=2.1e-07  Score=60.28  Aligned_cols=40  Identities=30%  Similarity=0.456  Sum_probs=37.4

Q ss_pred             CCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEE
Q ss_conf             2897599992004573889999999997899789999998
Q gi|254780309|r   15 VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS   54 (59)
Q Consensus        15 i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~la   54 (59)
                      .+|++|+||||+++||.|+.++.+.+++.|+..+.++++.
T Consensus       136 ~~g~rVlIVDDviaTGgT~~a~~~ll~~~Ga~vvg~~~ii  175 (236)
T 1qb7_A          136 GKGSRVVLIDDVLATGGTALSGLQLVEASDAVVVEMVSIL  175 (236)
T ss_dssp             CTTCEEEEEEEEESSCHHHHHHHHHHHHTTCEEEEEEEEE
T ss_pred             CCCCEEEEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEEE
T ss_conf             5696799996016356699999999998799899999999