HHsearch results for GI: 254780309 and protein with PDBid: 3dez_A

>3dez_A OPRT, oprtase, orotate phosphoribosyltransferase; glycosyltransferase, MAGN pyrimidine biosynthesis; 2.40A {Streptococcus mutans}
Probab=98.30  E-value=9.5e-07  Score=56.72  Aligned_cols=40  Identities=25%  Similarity=0.449  Sum_probs=36.8

Q ss_pred             CCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEE
Q ss_conf             2897599992004573889999999997899789999998
Q gi|254780309|r   15 VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS   54 (59)
Q Consensus        15 i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~la   54 (59)
                      -+|++|+||||++|||.++.++++.|++.|+..+.++++-
T Consensus       147 ~~g~rVlIVEDViTTGgSileai~~l~~~G~~V~~v~viv  186 (243)
T 3dez_A          147 TKGQKMVIIEDLISTGGSVLDAVAAAQREGADVLGVVAIF  186 (243)
T ss_dssp             CTTCEEEEEEEEESSSHHHHHHHHHHHHTTCEEEEEEEEE
T ss_pred             CCCCEEEEEEEEECCCCCHHHHHHHHHHCCCEEEEEEEEE
T ss_conf             9999899985114567445899999998799799999999