HHsearch results for GI: 254780309 and protein with PDBid: 3hvu_A

>3hvu_A Hypoxanthine phosphoribosyltransferase; hypoxantine-guanine phosphoribosyltransferase, 2-(N- morpholino)ethanesulfonic acid (MES); HET: MES; 1.95A {Bacillus anthracis str} PDB: 3h83_A* 3kb8_A*
Probab=99.02  E-value=5e-10  Score=74.41  Aligned_cols=53  Identities=23%  Similarity=0.328  Sum_probs=46.8

Q ss_pred             CEEEECCHHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEEE
Q ss_conf             60882510210028975999920045738899999999978997899999983
Q gi|254780309|r    3 NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR   55 (59)
Q Consensus         3 gaf~i~~~~~~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~lar   55 (59)
                      |...+..+...+++||+|||||||++||.|+.++.+.|.+.|++++..++|.-
T Consensus       102 ~~v~~~~~~~~~i~gk~VLlVDDIlDTG~Tl~~~~~~l~~~~p~sv~~avLl~  154 (204)
T 3hvu_A          102 GEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLD  154 (204)
T ss_dssp             CCEEEEECCSSCCTTCEEEEEEEEESSCHHHHHHHHHHHHTTCSEEEEEEEEE
T ss_pred             CCEEEECCCCCCCCCCEEEEEEEEECHHHHHHHHHHHHHHCCCCCEEEEEEEE
T ss_conf             84688147885769998999702430749999999999964998168999999