HHsearch results for GI: 254780309 and protein with PDBid: 3ohp_A

>3ohp_A Hypoxanthine phosphoribosyltransferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Vibrio cholerae} PDB: 1g9s_A* 1g9t_A* 1grv_A 1j7j_A
Probab=98.92  E-value=1.3e-09  Score=72.25  Aligned_cols=49  Identities=20%  Similarity=0.319  Sum_probs=43.3

Q ss_pred             ECCHHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEEE
Q ss_conf             2510210028975999920045738899999999978997899999983
Q gi|254780309|r    7 VPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR   55 (59)
Q Consensus         7 i~~~~~~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~lar   55 (59)
                      +..+...+++||+|||||||++||.|+.++.+.|++.||++|.+++|.-
T Consensus        81 ~~~~~~~~~~gk~VLiVDDI~dTG~Tl~~~~~~l~~~~p~~v~~avL~d  129 (177)
T 3ohp_A           81 ILKDLDDDIKGKDVLLVEDIIDTGNTLNKVKEILALREPKSIRICTLLD  129 (177)
T ss_dssp             EEECCSSCCTTSEEEEEEEEESSCHHHHHHHHHHHTTCCSEEEEEEEEE
T ss_pred             EECCCCCCCCCCEEEEEEEEECHHHHHHHHHHHHHHCCCCEEEEEEEEE
T ss_conf             8448875668997999940774579999999999858998899999998