HHSEARCH alignment of GI: 254780309 and SCOP domain: d1dkua2

Alignment
>d1dkua2 c.61.1.2 (A:167-315) Phosphoribosylpyrophosphate synthetase {Bacillus subtilis [TaxId: 1423]}
Probab=98.95  E-value=4.3e-10  Score=73.51  Aligned_cols=47  Identities=32%  Similarity=0.328  Sum_probs=42.0

Q ss_pred             HHCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEEEECC
Q ss_conf             10028975999920045738899999999978997899999983068
Q gi|254780309|r   12 SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK   58 (59)
Q Consensus        12 ~~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~lar~~~   58 (59)
                      ..+++||+++|||||++||.|+.++++.|++.||++|++++-+..++
T Consensus        45 ~GdV~gk~viIvDDmi~TGgTl~~aa~~L~~~GA~~V~~~~THglfs   91 (149)
T d1dkua2          45 VGNIEGKTAILIDDIIDTAGTITLAANALVENGAKEVYACCTHPVLS   91 (149)
T ss_dssp             ESCCTTCEEEEECSEESSCHHHHHHHHHHHHTTCSEEEEECSEECCC
T ss_pred             EEEECCCEEEEEHHHHHCHHHHHHHHHHHHHHCCCEEEEEEEECCCC
T ss_conf             03107978998724554608699999999970995599997303348


SCOP domain information

class: Alpha and beta proteins (a/b)
fold: PRTase-like
superfamily: PRTase-like
family: Phosphoribosylpyrophosphate synthetase-like
domain: Phosphoribosylpyrophosphate synthetase
species: Bacillus subtilis [TaxId: 1423]