HHSEARCH alignment of GI: 254780309 and SCOP domain: d1g2qa_

Alignment
>d1g2qa_ c.61.1.1 (A:) Adenine PRTase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
Probab=98.54  E-value=6.4e-08  Score=61.74  Aligned_cols=40  Identities=23%  Similarity=0.326  Sum_probs=37.8

Q ss_pred             CCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEE
Q ss_conf             2897599992004573889999999997899789999998
Q gi|254780309|r   15 VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS   54 (59)
Q Consensus        15 i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~la   54 (59)
                      .+|++|+||||+++||.|+.++.+.+++.|++.+.++++.
T Consensus       120 ~~g~rVlIVDDviaTGgT~~a~~~ll~~~Ga~vvgv~vii  159 (178)
T d1g2qa_         120 PAGSNVIIVDDIIATGGSAAAAGELVEQLEANLLEYNFVM  159 (178)
T ss_dssp             CTTCEEEEEEEEESSCHHHHHHHHHHHHTTCEEEEEEEEE
T ss_pred             CCCCEEEEEEHHHHHCHHHHHHHHHHHHCCCEEEEEEEEE
T ss_conf             6897799982574517399999999998699899999999


SCOP domain information

class: Alpha and beta proteins (a/b)
fold: PRTase-like
superfamily: PRTase-like
family: Phosphoribosyltransferases (PRTases)
domain: Adenine PRTase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]