HHSEARCH alignment of GI: 254780309 and SCOP domain: d1j7ja_

Alignment
>d1j7ja_ c.61.1.1 (A:) Hypoxanthine PRTase {Salmonella typhimurium [TaxId: 90371]}
Probab=98.87  E-value=1.4e-09  Score=70.70  Aligned_cols=49  Identities=16%  Similarity=0.297  Sum_probs=43.3

Q ss_pred             ECCHHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEEE
Q ss_conf             2510210028975999920045738899999999978997899999983
Q gi|254780309|r    7 VPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR   55 (59)
Q Consensus         7 i~~~~~~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~lar   55 (59)
                      ...+...+++||+|||||||++||.|+.++.+.|++.|++++.+++|.-
T Consensus        80 ~~~~~~~~~~gk~VLlVDDVldTG~TL~~~~~~l~~~~p~~i~~avL~~  128 (172)
T d1j7ja_          80 ILKDLDEDIRGKDVLIVEDIIDSGNTLSKVREILGLREPKSLAICTLLD  128 (172)
T ss_dssp             CSBCCSSCCBTSEEEEEEEEESSCHHHHHHHHHHHTTCBSEEEEEEEEE
T ss_pred             EECCCCCCCCCCEEEEEEEEHHHHHHHHHHHHHHHHHCCCCEEEEEEEE
T ss_conf             6258875658977999840124889999999999734878249999999


SCOP domain information

class: Alpha and beta proteins (a/b)
fold: PRTase-like
superfamily: PRTase-like
family: Phosphoribosyltransferases (PRTases)
domain: Hypoxanthine PRTase
species: Salmonella typhimurium [TaxId: 90371]