HHSEARCH alignment of GI: 254780309 and SCOP domain: d1v9sa1

Alignment
>d1v9sa1 c.61.1.1 (A:1-208) Uracil PRTase, Upp {Thermus thermophilus [TaxId: 274]}
Probab=97.73  E-value=1.4e-05  Score=49.16  Aligned_cols=47  Identities=26%  Similarity=0.383  Sum_probs=41.9

Q ss_pred             HHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEEEE
Q ss_conf             02100289759999200457388999999999789978999999830
Q gi|254780309|r   10 YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS   56 (59)
Q Consensus        10 ~~~~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~lar~   56 (59)
                      .+++++.++.|+|+|.++.||.|+..+.+.|+++|++++.++++-.+
T Consensus       116 klP~~i~~~~vil~DPmlATG~s~~~ai~~L~~~gv~~I~~v~~ias  162 (208)
T d1v9sa1         116 KLPPDIAERRAFLLDPMLATGGSASLALSLLKERGATGVKLMAILAA  162 (208)
T ss_dssp             ECCSCGGGSCEEEECSEESSSHHHHHHHHHHHHTTCCSCEEEEEEEC
T ss_pred             ECCCCCCCCEEEEECCHHHCCHHHHHHHHHHHHCCCCCEEEEEEEEC
T ss_conf             55865345669996824533565999999998659984699999843


SCOP domain information

class: Alpha and beta proteins (a/b)
fold: PRTase-like
superfamily: PRTase-like
family: Phosphoribosyltransferases (PRTases)
domain: Uracil PRTase, Upp
species: Thermus thermophilus [TaxId: 274]