HHSEARCH alignment of GI: 254780309 and SCOP domain: d1zn7a1

Alignment
>d1zn7a1 c.61.1.1 (A:3-180) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]}
Probab=98.46  E-value=1.4e-07  Score=59.96  Aligned_cols=39  Identities=23%  Similarity=0.431  Sum_probs=36.8

Q ss_pred             CCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEE
Q ss_conf             897599992004573889999999997899789999998
Q gi|254780309|r   16 AGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS   54 (59)
Q Consensus        16 ~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~la   54 (59)
                      +|++|+||||+++||.|+.++.+.++++|++.+.++++.
T Consensus       117 ~g~rVlIVDDviaTGgT~~a~~~ll~~~Ga~vvg~~~ii  155 (178)
T d1zn7a1         117 PGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLV  155 (178)
T ss_dssp             TTCEEEEEEEEESSSHHHHHHHHHHHHTTCEEEEEEEEE
T ss_pred             CCCEEEEEHHHHHHCHHHHHHHHHHHHCCCEEEEEEEEE
T ss_conf             797689863554516499999999998799899999999


SCOP domain information

class: Alpha and beta proteins (a/b)
fold: PRTase-like
superfamily: PRTase-like
family: Phosphoribosyltransferases (PRTases)
domain: Adenine PRTase
species: Human (Homo sapiens) [TaxId: 9606]