HHSEARCH alignment of GI: 254780309 and SCOP domain: d2c4ka2

Alignment
>d2c4ka2 c.61.1.2 (A:167-350) PRPP synthetase-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]}
Probab=99.03  E-value=1.3e-10  Score=76.34  Aligned_cols=46  Identities=24%  Similarity=0.324  Sum_probs=42.3

Q ss_pred             HCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEEEECC
Q ss_conf             0028975999920045738899999999978997899999983068
Q gi|254780309|r   13 KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK   58 (59)
Q Consensus        13 ~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~lar~~~   58 (59)
                      .+++||+|+||||+++||.|+..+++.|++.||++|++++-+..++
T Consensus        79 GdVkGk~vIIVDD~I~TG~T~~~a~~~Lk~~GA~~v~~~~tH~~~~  124 (184)
T d2c4ka2          79 GDVGGRIAIIVDDIIDDVESFVAAAEILKERGAYKIYVMATHGILS  124 (184)
T ss_dssp             SCCTTEEEEEECSEESSTHHHHHHHHHHHTTTEEEEEEEEEEECCC
T ss_pred             EECCCCEEEEECCHHCCHHHHHHHHHHHHHCCCCCCEEEEEEECCC
T ss_conf             7416988999621331457799999999742655534788750317


SCOP domain information

class: Alpha and beta proteins (a/b)
fold: PRTase-like
superfamily: PRTase-like
family: Phosphoribosylpyrophosphate synthetase-like
domain: PRPP synthetase-associated protein 1
species: Human (Homo sapiens) [TaxId: 9606]