BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780309|ref|YP_003064722.1| comF family protein
[Candidatus Liberibacter asiaticus str. psy62]
         (59 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780309|ref|YP_003064722.1| comF family protein [Candidatus Liberibacter asiaticus str.
          psy62]
 gi|254039986|gb|ACT56782.1| comF family protein [Candidatus Liberibacter asiaticus str.
          psy62]
          Length = 59

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%)

Query: 1  MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
          MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD
Sbjct: 1  MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59


>gi|315122266|ref|YP_004062755.1| competence protein F, putative [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495668|gb|ADR52267.1| competence protein F, putative [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 214

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 45/59 (76%), Positives = 53/59 (89%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           + NAF+VPQY  K++AG KILLIDDVYTTGATA+ AAIALKKAGA ++SILTFSRSLK+
Sbjct: 156 LHNAFHVPQYAQKYIAGFKILLIDDVYTTGATAQYAAIALKKAGAKSISILTFSRSLKN 214


>gi|319406072|emb|CBI79702.1| competence protein ComF [Bartonella sp. AR 15-3]
          Length = 225

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++NAF VP+ V KH+ G  ILLIDDV TTG T   AA  LK AG   V++LTFSR LKD
Sbjct: 160 VQNAFKVPKEVKKHLKGRSILLIDDVLTTGVTVTAAAKTLKHAGTRQVNVLTFSRVLKD 218


>gi|121601823|ref|YP_988686.1| comF family protein [Bartonella bacilliformis KC583]
 gi|120614000|gb|ABM44601.1| comF family protein [Bartonella bacilliformis KC583]
          Length = 251

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/59 (55%), Positives = 42/59 (71%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++NAF+VP+ + K + G  ILL+DDV TTG T   AA  LK+AGA  V +LTFSR LKD
Sbjct: 186 VQNAFSVPRKIKKRMQGCSILLVDDVLTTGVTVTIAAATLKRAGARQVDVLTFSRVLKD 244


>gi|319408180|emb|CBI81833.1| competence protein ComF [Bartonella schoenbuchensis R1]
          Length = 247

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 33/59 (55%), Positives = 40/59 (67%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +++ F VP  + KH+ G  ILLIDDV TTG T   AA  LK+AGA  V +LTFSR LKD
Sbjct: 182 VQSTFKVPHKIKKHLKGRSILLIDDVLTTGETITAAAATLKRAGAQQVDVLTFSRVLKD 240


>gi|326539594|gb|ADZ87809.1| competence protein F [Brucella melitensis M5-90]
          Length = 251

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 40/56 (71%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 196 AFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 251


>gi|306842968|ref|ZP_07475602.1| competence protein F [Brucella sp. BO2]
 gi|306286896|gb|EFM58421.1| competence protein F [Brucella sp. BO2]
          Length = 262

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 40/56 (71%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 207 AFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 262


>gi|256158382|ref|ZP_05456280.1| putative competence protein F [Brucella ceti M490/95/1]
 gi|256253801|ref|ZP_05459337.1| putative competence protein F [Brucella ceti B1/94]
 gi|260169308|ref|ZP_05756119.1| putative competence protein F [Brucella sp. F5/99]
 gi|261220934|ref|ZP_05935215.1| phosphoribosyltransferase [Brucella ceti B1/94]
 gi|261758821|ref|ZP_06002530.1| competence protein F [Brucella sp. F5/99]
 gi|265996894|ref|ZP_06109451.1| phosphoribosyltransferase [Brucella ceti M490/95/1]
 gi|260919518|gb|EEX86171.1| phosphoribosyltransferase [Brucella ceti B1/94]
 gi|261738805|gb|EEY26801.1| competence protein F [Brucella sp. F5/99]
 gi|262551362|gb|EEZ07352.1| phosphoribosyltransferase [Brucella ceti M490/95/1]
          Length = 262

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 40/56 (71%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 207 AFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 262


>gi|256112214|ref|ZP_05453135.1| competence protein F [Brucella melitensis bv. 3 str. Ether]
 gi|265993642|ref|ZP_06106199.1| phosphoribosyltransferase [Brucella melitensis bv. 3 str. Ether]
 gi|262764623|gb|EEZ10544.1| phosphoribosyltransferase [Brucella melitensis bv. 3 str. Ether]
          Length = 262

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 40/56 (71%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 207 AFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 262


>gi|254717947|ref|ZP_05179758.1| protein gntX [Brucella sp. 83/13]
 gi|265982890|ref|ZP_06095625.1| phosphoribosyltransferase [Brucella sp. 83/13]
 gi|306838253|ref|ZP_07471103.1| competence protein F [Brucella sp. NF 2653]
 gi|264661482|gb|EEZ31743.1| phosphoribosyltransferase [Brucella sp. 83/13]
 gi|306406656|gb|EFM62885.1| competence protein F [Brucella sp. NF 2653]
          Length = 262

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 40/56 (71%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 207 AFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 262


>gi|254700524|ref|ZP_05162352.1| putative competence protein F [Brucella suis bv. 5 str. 513]
 gi|261751028|ref|ZP_05994737.1| phosphoribosyltransferase [Brucella suis bv. 5 str. 513]
 gi|261740781|gb|EEY28707.1| phosphoribosyltransferase [Brucella suis bv. 5 str. 513]
          Length = 262

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 40/56 (71%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 207 AFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 262


>gi|237816244|ref|ZP_04595237.1| competence protein F [Brucella abortus str. 2308 A]
 gi|237788311|gb|EEP62526.1| competence protein F [Brucella abortus str. 2308 A]
          Length = 290

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 40/56 (71%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 235 AFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 290


>gi|225628082|ref|ZP_03786117.1| protein gntX [Brucella ceti str. Cudo]
 gi|225616907|gb|EEH13954.1| protein gntX [Brucella ceti str. Cudo]
          Length = 290

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 40/56 (71%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 235 AFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 290


>gi|163843904|ref|YP_001628308.1| protein gntX [Brucella suis ATCC 23445]
 gi|254707589|ref|ZP_05169417.1| putative competence protein F [Brucella pinnipedialis M163/99/10]
 gi|254708873|ref|ZP_05170684.1| putative competence protein F [Brucella pinnipedialis B2/94]
 gi|254713704|ref|ZP_05175515.1| putative competence protein F [Brucella ceti M644/93/1]
 gi|254715946|ref|ZP_05177757.1| putative competence protein F [Brucella ceti M13/05/1]
 gi|256030399|ref|ZP_05444013.1| putative competence protein F [Brucella pinnipedialis M292/94/1]
 gi|256059857|ref|ZP_05450044.1| putative competence protein F [Brucella neotomae 5K33]
 gi|256370278|ref|YP_003107789.1| competence protein F, putative [Brucella microti CCM 4915]
 gi|261217709|ref|ZP_05931990.1| phosphoribosyltransferase [Brucella ceti M13/05/1]
 gi|261315076|ref|ZP_05954273.1| phosphoribosyltransferase [Brucella pinnipedialis M163/99/10]
 gi|261316366|ref|ZP_05955563.1| phosphoribosyltransferase [Brucella pinnipedialis B2/94]
 gi|261321444|ref|ZP_05960641.1| phosphoribosyltransferase [Brucella ceti M644/93/1]
 gi|261323827|ref|ZP_05963024.1| phosphoribosyltransferase [Brucella neotomae 5K33]
 gi|265987438|ref|ZP_06099995.1| phosphoribosyltransferase [Brucella pinnipedialis M292/94/1]
 gi|163674627|gb|ABY38738.1| Protein gntX [Brucella suis ATCC 23445]
 gi|256000441|gb|ACU48840.1| competence protein F, putative [Brucella microti CCM 4915]
 gi|260922798|gb|EEX89366.1| phosphoribosyltransferase [Brucella ceti M13/05/1]
 gi|261294134|gb|EEX97630.1| phosphoribosyltransferase [Brucella ceti M644/93/1]
 gi|261295589|gb|EEX99085.1| phosphoribosyltransferase [Brucella pinnipedialis B2/94]
 gi|261299807|gb|EEY03304.1| phosphoribosyltransferase [Brucella neotomae 5K33]
 gi|261304102|gb|EEY07599.1| phosphoribosyltransferase [Brucella pinnipedialis M163/99/10]
 gi|264659635|gb|EEZ29896.1| phosphoribosyltransferase [Brucella pinnipedialis M292/94/1]
          Length = 262

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 40/56 (71%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 207 AFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 262


>gi|161619796|ref|YP_001593683.1| protein gntX [Brucella canis ATCC 23365]
 gi|260567631|ref|ZP_05838101.1| competence protein F [Brucella suis bv. 4 str. 40]
 gi|161336607|gb|ABX62912.1| Protein gntX [Brucella canis ATCC 23365]
 gi|260157149|gb|EEW92229.1| competence protein F [Brucella suis bv. 4 str. 40]
          Length = 262

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 40/56 (71%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 207 AFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 262


>gi|148560259|ref|YP_001259705.1| putative competence protein F [Brucella ovis ATCC 25840]
 gi|148371516|gb|ABQ61495.1| putative competence protein F [Brucella ovis ATCC 25840]
          Length = 262

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 40/56 (71%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 207 AFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 262


>gi|17986467|ref|NP_539101.1| competence protein F [Brucella melitensis bv. 1 str. 16M]
 gi|225853317|ref|YP_002733550.1| competence protein F [Brucella melitensis ATCC 23457]
 gi|256045489|ref|ZP_05448372.1| putative competence protein F [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256263196|ref|ZP_05465728.1| competence protein F [Brucella melitensis bv. 2 str. 63/9]
 gi|260562798|ref|ZP_05833284.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|265991911|ref|ZP_06104468.1| phosphoribosyltransferase [Brucella melitensis bv. 1 str. Rev.1]
 gi|17982065|gb|AAL51365.1| competence protein f [Brucella melitensis bv. 1 str. 16M]
 gi|225641682|gb|ACO01596.1| competence protein F [Brucella melitensis ATCC 23457]
 gi|260152814|gb|EEW87906.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|263002977|gb|EEZ15270.1| phosphoribosyltransferase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093118|gb|EEZ17253.1| competence protein F [Brucella melitensis bv. 2 str. 63/9]
 gi|326409880|gb|ADZ66945.1| competence protein F [Brucella melitensis M28]
          Length = 262

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 40/56 (71%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 207 AFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 262


>gi|23502731|ref|NP_698858.1| competence protein F [Brucella suis 1330]
 gi|254704895|ref|ZP_05166723.1| putative competence protein F [Brucella suis bv. 3 str. 686]
 gi|261755589|ref|ZP_05999298.1| phosphoribosyltransferase [Brucella suis bv. 3 str. 686]
 gi|23348747|gb|AAN30773.1| competence protein F, putative [Brucella suis 1330]
 gi|261745342|gb|EEY33268.1| phosphoribosyltransferase [Brucella suis bv. 3 str. 686]
          Length = 262

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 40/56 (71%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 207 AFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 262


>gi|62290737|ref|YP_222530.1| competence protein F [Brucella abortus bv. 1 str. 9-941]
 gi|82700649|ref|YP_415223.1| competence protein F [Brucella melitensis biovar Abortus 2308]
 gi|189024949|ref|YP_001935717.1| competence protein F [Brucella abortus S19]
 gi|254690026|ref|ZP_05153280.1| putative competence protein F [Brucella abortus bv. 6 str. 870]
 gi|254694515|ref|ZP_05156343.1| putative competence protein F [Brucella abortus bv. 3 str. Tulya]
 gi|254696140|ref|ZP_05157968.1| putative competence protein F [Brucella abortus bv. 2 str. 86/8/59]
 gi|254731058|ref|ZP_05189636.1| putative competence protein F [Brucella abortus bv. 4 str. 292]
 gi|256258280|ref|ZP_05463816.1| putative competence protein F [Brucella abortus bv. 9 str. C68]
 gi|260546000|ref|ZP_05821740.1| competence protein F [Brucella abortus NCTC 8038]
 gi|260755561|ref|ZP_05867909.1| phosphoribosyltransferase [Brucella abortus bv. 6 str. 870]
 gi|260758784|ref|ZP_05871132.1| phosphoribosyltransferase [Brucella abortus bv. 4 str. 292]
 gi|260760508|ref|ZP_05872851.1| phosphoribosyltransferase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884585|ref|ZP_05896199.1| phosphoribosyltransferase [Brucella abortus bv. 9 str. C68]
 gi|261214832|ref|ZP_05929113.1| phosphoribosyltransferase [Brucella abortus bv. 3 str. Tulya]
 gi|297247124|ref|ZP_06930842.1| competence protein ComFC [Brucella abortus bv. 5 str. B3196]
 gi|62196869|gb|AAX75169.1| competence protein F, hypothetical [Brucella abortus bv. 1 str.
           9-941]
 gi|82616750|emb|CAJ11836.1| competence protein F [Brucella melitensis biovar Abortus 2308]
 gi|189020521|gb|ACD73243.1| competence protein F [Brucella abortus S19]
 gi|260096107|gb|EEW79983.1| competence protein F [Brucella abortus NCTC 8038]
 gi|260669102|gb|EEX56042.1| phosphoribosyltransferase [Brucella abortus bv. 4 str. 292]
 gi|260670940|gb|EEX57761.1| phosphoribosyltransferase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675669|gb|EEX62490.1| phosphoribosyltransferase [Brucella abortus bv. 6 str. 870]
 gi|260874113|gb|EEX81182.1| phosphoribosyltransferase [Brucella abortus bv. 9 str. C68]
 gi|260916439|gb|EEX83300.1| phosphoribosyltransferase [Brucella abortus bv. 3 str. Tulya]
 gi|297174293|gb|EFH33640.1| competence protein ComFC [Brucella abortus bv. 5 str. B3196]
          Length = 262

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 40/56 (71%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 207 AFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 262


>gi|153008363|ref|YP_001369578.1| competence protein F [Ochrobactrum anthropi ATCC 49188]
 gi|151560251|gb|ABS13749.1| competence protein F, putative [Ochrobactrum anthropi ATCC 49188]
          Length = 262

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 33/56 (58%), Positives = 38/56 (67%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           AF VPQ    HV G ++LLIDDVYTTGAT K    AL + GA +V +LTFSR L D
Sbjct: 207 AFRVPQEHEIHVRGRRVLLIDDVYTTGATVKAVTRALLRGGAKSVDVLTFSRVLPD 262


>gi|239832955|ref|ZP_04681284.1| competence protein F [Ochrobactrum intermedium LMG 3301]
 gi|239825222|gb|EEQ96790.1| competence protein F [Ochrobactrum intermedium LMG 3301]
          Length = 288

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 38/56 (67%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           AF VPQ    H+ G ++LLIDDVYTTGAT K    AL + GA +V +LTFSR L D
Sbjct: 233 AFRVPQEHEIHIRGRRVLLIDDVYTTGATVKAVTRALLRGGARSVDVLTFSRVLPD 288


>gi|261884092|ref|ZP_06008131.1| competence protein F [Campylobacter fetus subsp. venerealis str.
           Azul-94]
          Length = 127

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 39/56 (69%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           AF VP+    H++G ++LLIDD YTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 72  AFRVPKEHEIHISGRRVLLIDDGYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 127


>gi|260467149|ref|ZP_05813327.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259029073|gb|EEW30371.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 266

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 39/57 (68%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF VP      +AG ++LL+DDVYTTGAT + A  ALKK GA  V +LTF+R L
Sbjct: 198 VRAAFRVPAEAEIEIAGRRVLLVDDVYTTGATVRSATKALKKGGAAAVDVLTFARVL 254


>gi|13472985|ref|NP_104552.1| hypothetical protein mll3453 [Mesorhizobium loti MAFF303099]
 gi|14023733|dbj|BAB50338.1| mll3453 [Mesorhizobium loti MAFF303099]
          Length = 240

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 39/57 (68%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF VP      +AG ++LLIDDVYTTGAT + A  ALK+ GA  V +LTF+R L
Sbjct: 172 VRAAFRVPAEAEIEIAGRRVLLIDDVYTTGATVRAATKALKRGGASAVDVLTFARVL 228


>gi|319781332|ref|YP_004140808.1| phosphoribosyltransferase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317167220|gb|ADV10758.1| phosphoribosyltransferase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 266

 Score = 64.7 bits (156), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 39/57 (68%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF VP      +AG ++LLIDDVYTTGAT + A  ALK+ GA  V +LTF+R L
Sbjct: 198 VRAAFRVPAEAEIEIAGRRVLLIDDVYTTGATVRSATKALKRGGAAAVDVLTFARVL 254


>gi|306844850|ref|ZP_07477433.1| competence protein F [Brucella sp. BO1]
 gi|306274782|gb|EFM56563.1| competence protein F [Brucella sp. BO1]
          Length = 262

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           AF VP+    H+ G ++LLIDDVYTTGAT K A  AL + GA +V +LT SR L D
Sbjct: 207 AFRVPKEHEIHIRGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTLSRVLPD 262


>gi|218659666|ref|ZP_03515596.1| competence protein F (phosphoribosyltransferase protein) [Rhizobium
           etli IE4771]
          Length = 182

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 42/59 (71%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF + +     + G +++LIDDVYTTGAT   A+ AL+KAGA  +++LTF+R+L +
Sbjct: 122 VRGAFAIAKGRENDIFGKRVVLIDDVYTTGATVAAASRALRKAGAAEITVLTFARALSE 180


>gi|218507724|ref|ZP_03505602.1| competence protein F (phosphoribosyltransferase protein)
          [Rhizobium etli Brasil 5]
          Length = 61

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 41/59 (69%)

Query: 1  MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
          +R AF + +   K + G +I+LIDDVY TGAT   A+  L+KAGA  +++LTF+R+L +
Sbjct: 1  VRGAFAIAKGREKDIFGRRIVLIDDVYRTGATVAAASRTLRKAGAAEITVLTFARALSE 59


>gi|227823196|ref|YP_002827168.1| putative competence protein F [Sinorhizobium fredii NGR234]
 gi|227342197|gb|ACP26415.1| putative competence protein F [Sinorhizobium fredii NGR234]
          Length = 281

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 27/57 (47%), Positives = 39/57 (68%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF VP+     + G +I+L+DDVYTTGAT   A  ALK+A A  +++LTF+ +L
Sbjct: 221 VRGAFAVPESARSGIEGKRIVLVDDVYTTGATVSAATRALKRARAGDITVLTFAMAL 277


>gi|209551108|ref|YP_002283025.1| competence protein F (phosphoribosyltransferase protein) [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209536864|gb|ACI56799.1| competence protein F (phosphoribosyltransferase protein) [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 258

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF + +     + G +I+LIDDVYTTGAT   A+  L+KAGA  +++LTF+R+L +
Sbjct: 198 VRGAFAIAKGCENDIFGKRIVLIDDVYTTGATVAAASRTLRKAGAAEITVLTFARALSE 256


>gi|241206509|ref|YP_002977605.1| competence protein F (phosphoribosyltransferase protein) [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240860399|gb|ACS58066.1| competence protein F (phosphoribosyltransferase protein) [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 258

 Score = 57.8 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF + +     + G +I+LIDDVYTTGAT   A+  L+KAGA  +++LTF+R+L +
Sbjct: 198 VRGAFAIAKGCENDIFGKRIVLIDDVYTTGATVAAASRTLRKAGATDITVLTFARALSE 256


>gi|86359347|ref|YP_471239.1| competence protein F (phosphoribosyltransferase protein) [Rhizobium
           etli CFN 42]
 gi|86283449|gb|ABC92512.1| competence protein F (phosphoribosyltransferase protein) [Rhizobium
           etli CFN 42]
          Length = 258

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 42/59 (71%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF + +     ++G +I+L+DDVYTTGAT   A+  L+KAGA  +++LTF+R+L +
Sbjct: 198 VRGAFAIAKGRENDISGKRIVLVDDVYTTGATVAAASRTLRKAGAAEITVLTFARALSE 256


>gi|190893598|ref|YP_001980140.1| competence protein F (phosphoribosyltransferase) [Rhizobium etli
           CIAT 652]
 gi|190698877|gb|ACE92962.1| competence protein F (phosphoribosyltransferase protein) [Rhizobium
           etli CIAT 652]
          Length = 258

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF + +     + G +I+LIDDVYTTGAT   A+  L+KAGA  +++LTF+R+L +
Sbjct: 198 VRGAFAIAKGRENDIFGKRIVLIDDVYTTGATVAAASRTLRKAGAAEITVLTFARALSE 256


>gi|327193402|gb|EGE60302.1| competence protein F (phosphoribosyltransferase protein) [Rhizobium
           etli CNPAF512]
          Length = 258

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF + +     + G +I+LIDDVYTTGAT   A+  L+KAGA  +++LTF+R+L +
Sbjct: 198 VRGAFAIAKGRENDIFGKRIVLIDDVYTTGATVAAASRTLRKAGAAEITVLTFARALSE 256


>gi|222149922|ref|YP_002550879.1| competence protein F [Agrobacterium vitis S4]
 gi|221736904|gb|ACM37867.1| competence protein F [Agrobacterium vitis S4]
          Length = 236

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 39/57 (68%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF V +     V G  ++L+DDVYTTGAT   A  ALK+AGA+ V++LTF+ +L
Sbjct: 176 VRGAFKVAENRRDQVFGRHLVLVDDVYTTGATVSAATRALKRAGAVEVTVLTFAMAL 232


>gi|163759885|ref|ZP_02166969.1| phosphoribosyltransferase [Hoeflea phototrophica DFL-43]
 gi|162282843|gb|EDQ33130.1| phosphoribosyltransferase [Hoeflea phototrophica DFL-43]
          Length = 187

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 36/55 (65%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +R AF VP      ++G K+LL+DDV TTG+T   A  AL +AGA  V ILTF+R
Sbjct: 122 VRGAFAVPPSQMPRISGYKVLLVDDVLTTGSTVAAATRALNRAGAEQVCILTFAR 176


>gi|116254026|ref|YP_769864.1| hypothetical protein RL4290 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258674|emb|CAK09778.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 246

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF + +     + G +I+LIDDVYTTGAT   A+  L+KAGA  +++LTF+R+L +
Sbjct: 186 VRGAFAIAKGSENDIFGKRIVLIDDVYTTGATVAAASRTLRKAGATDITVLTFARALSE 244


>gi|49475199|ref|YP_033240.1| competence protein comF [Bartonella henselae str. Houston-1]
 gi|49238004|emb|CAF27209.1| Competence protein comF [Bartonella henselae str. Houston-1]
          Length = 262

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 42/57 (73%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           NAF VP+ V K++ G  ILLIDDV+TTGAT   AA  LK+AGA  V +LTFSR LK+
Sbjct: 199 NAFEVPRKVKKYLKGRSILLIDDVFTTGATVTAAAATLKRAGARQVDVLTFSRVLKE 255


>gi|90420200|ref|ZP_01228108.1| competence protein F [Aurantimonas manganoxydans SI85-9A1]
 gi|90335534|gb|EAS49284.1| competence protein F [Aurantimonas manganoxydans SI85-9A1]
          Length = 249

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 28/55 (50%), Positives = 37/55 (67%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +R AF V +     + G ++LL+DDVYTTGAT   A  ALK+AGA  V +LTF+R
Sbjct: 189 VRGAFQVVETRRDELDGKRVLLVDDVYTTGATVASATRALKRAGARDVDVLTFAR 243


>gi|225873655|ref|YP_002755114.1| ComF family protein [Acidobacterium capsulatum ATCC 51196]
 gi|225792065|gb|ACO32155.1| ComF family protein [Acidobacterium capsulatum ATCC 51196]
          Length = 310

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 1/57 (1%)

Query: 1   MRNAFNVPQ-YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF VP+      V G  +LLIDD+YTTGATA   ++AL++AGA +V + T +R+
Sbjct: 201 VRGAFFVPEGRAQAAVKGRDVLLIDDIYTTGATAHACSLALRRAGAASVRVATVARA 257


>gi|46204162|ref|ZP_00050412.2| COG1040: Predicted amidophosphoribosyltransferases
           [Magnetospirillum magnetotacticum MS-1]
          Length = 138

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 37/59 (62%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ AF VP+     + G ++LLIDDV TTGAT   AA  L +AGA  V +LTF+   +D
Sbjct: 78  LQGAFRVPEGSRARIQGRRLLLIDDVSTTGATGNAAARVLLRAGAARVDLLTFATVTRD 136


>gi|254293167|ref|YP_003059190.1| phosphoribosyltransferase [Hirschia baltica ATCC 49814]
 gi|254041698|gb|ACT58493.1| phosphoribosyltransferase [Hirschia baltica ATCC 49814]
          Length = 232

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 39/55 (70%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +  AF++ +   K +AG ++LL+DDVYTTGAT +    ALK++GA +V ++T SR
Sbjct: 169 VEGAFHIAERHRKKLAGKRVLLVDDVYTTGATVEACCRALKRSGATSVDVITLSR 223


>gi|240136967|ref|YP_002961436.1| putative phosphoribosyltransferase [Methylobacterium extorquens
           AM1]
 gi|240006933|gb|ACS38159.1| putative phosphoribosyltransferase [Methylobacterium extorquens
           AM1]
          Length = 255

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 38/59 (64%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ AF VP+     +AG ++LLIDDV TTGAT   AA  L + GA +V +LTF+   +D
Sbjct: 195 LQGAFRVPEDARSRIAGRRLLLIDDVATTGATGNAAAPVLLRGGAASVDLLTFATVTRD 253


>gi|254558820|ref|YP_003065915.1| phosphoribosyltransferase [Methylobacterium extorquens DM4]
 gi|254266098|emb|CAX21850.1| putative phosphoribosyltransferase [Methylobacterium extorquens
           DM4]
          Length = 255

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 38/59 (64%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ AF VP+     +AG ++LLIDDV TTGAT   AA  L + GA +V +LTF+   +D
Sbjct: 195 LQGAFRVPEDARSRIAGRRLLLIDDVATTGATGNAAARVLLRGGAASVDLLTFATVTRD 253


>gi|49473949|ref|YP_031991.1| competence protein comF [Bartonella quintana str. Toulouse]
 gi|49239452|emb|CAF25803.1| Competence protein comF [Bartonella quintana str. Toulouse]
          Length = 261

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 42/57 (73%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           NAF VP+ V K++ G  +LL+DDV+TTGAT   AA  LK+AGA  V +LTFSR+ K+
Sbjct: 198 NAFEVPRKVKKYLKGCSVLLVDDVFTTGATVTAAAATLKQAGARQVDVLTFSRAFKE 254


>gi|218528400|ref|YP_002419216.1| competence protein F [Methylobacterium chloromethanicum CM4]
 gi|218520703|gb|ACK81288.1| competence protein F [Methylobacterium chloromethanicum CM4]
          Length = 255

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 38/59 (64%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ AF VP+     +AG ++LLIDDV TTGAT   AA  L + GA +V +LTF+   +D
Sbjct: 195 LQGAFRVPEDARSRIAGRRLLLIDDVATTGATGNAAARVLLRGGAASVDLLTFATVTRD 253


>gi|163849759|ref|YP_001637802.1| competence protein F [Methylobacterium extorquens PA1]
 gi|163661364|gb|ABY28731.1| competence protein F [Methylobacterium extorquens PA1]
          Length = 255

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 37/59 (62%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ AF VP      +AG ++LLIDDV TTGAT   AA  L + GA +V +LTF+   +D
Sbjct: 195 LQGAFRVPDDARSRIAGRRLLLIDDVATTGATGNAAARVLLRGGAASVDLLTFATVTRD 253


>gi|116622521|ref|YP_824677.1| phosphoribosyltransferase [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116225683|gb|ABJ84392.1| phosphoribosyltransferase [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 224

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 27/46 (58%), Positives = 36/46 (78%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           + S+ VAG +ILLIDDV TTG+TA   A+ALK+AGA  V++LT +R
Sbjct: 158 FRSRGVAGRRILLIDDVMTTGSTATSCALALKRAGAKRVALLTVAR 203


>gi|114704317|ref|ZP_01437225.1| hypothetical protein FP2506_05271 [Fulvimarina pelagi HTCC2506]
 gi|114539102|gb|EAU42222.1| hypothetical protein FP2506_05271 [Fulvimarina pelagi HTCC2506]
          Length = 249

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 36/55 (65%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +R AF V       V    +LLIDDV+TTG+T   A  ALK+AGA +V++LTF+R
Sbjct: 189 VRGAFRVAPERYDRVMAKTVLLIDDVFTTGSTVASATKALKRAGAKSVNVLTFAR 243


>gi|319407556|emb|CBI81206.1| competence protein ComF [Bartonella sp. 1-1C]
          Length = 247

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 33/59 (55%), Positives = 40/59 (67%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++NAF VP  V K++ G  ILLIDDV TTG T   A   LK AGA  V++LTFSR LK+
Sbjct: 182 VQNAFKVPNEVKKYLEGRSILLIDDVLTTGVTVTAATKTLKHAGARQVNVLTFSRVLKN 240


>gi|160897117|ref|YP_001562699.1| ComF family protein [Delftia acidovorans SPH-1]
 gi|160362701|gb|ABX34314.1| ComF family protein [Delftia acidovorans SPH-1]
          Length = 244

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 34/56 (60%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R  F VP     HV G ++LLIDDV TTGA+    A  L++AGA  VS L  +R+
Sbjct: 188 LRGVFAVPPAQLPHVRGRRVLLIDDVMTTGASLHALATCLRRAGAAEVSALVLART 243


>gi|319899208|ref|YP_004159301.1| competence protein ComF [Bartonella clarridgeiae 73]
 gi|319403172|emb|CBI76731.1| competence protein ComF [Bartonella clarridgeiae 73]
          Length = 247

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 33/58 (56%), Positives = 39/58 (67%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++NAF VP  V K++ G  ILLIDDV TTG T   A   LK AGA  V++LTFSR LK
Sbjct: 182 VQNAFKVPNKVKKYLEGRSILLIDDVLTTGVTVTAATKTLKHAGARQVNVLTFSRVLK 239


>gi|159185776|ref|NP_357098.2| competence protein F [Agrobacterium tumefaciens str. C58]
 gi|159140910|gb|AAK89883.2| competence protein F [Agrobacterium tumefaciens str. C58]
          Length = 263

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 25/57 (43%), Positives = 41/57 (71%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF++       + G +++L+DDVYTTGAT   A+ AL+KAGA+ V++LTF+ ++
Sbjct: 203 VRGAFSLAPGREADIFGKRVVLVDDVYTTGATVGAASRALRKAGAVDVTVLTFAMAI 259


>gi|84500737|ref|ZP_00998986.1| competence protein F, putative [Oceanicola batsensis HTCC2597]
 gi|84391690|gb|EAQ04022.1| competence protein F, putative [Oceanicola batsensis HTCC2597]
          Length = 244

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 39/58 (67%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           + +A  V    +  VAG  +LLIDDV T+GAT   A  ALK+AGA +VS+LT +R++K
Sbjct: 185 LHDAVTVNPRRAGRVAGGSVLLIDDVMTSGATLTAATGALKRAGAASVSVLTLARAVK 242


>gi|224368951|ref|YP_002603115.1| ComF [Desulfobacterium autotrophicum HRM2]
 gi|223691668|gb|ACN14951.1| ComF [Desulfobacterium autotrophicum HRM2]
          Length = 291

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 40/56 (71%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF V    ++ + G +ILLIDDV+TTGAT+  AA+ L KAGA++V +L  +R+
Sbjct: 238 LRGAFTVRG--TEKIEGRRILLIDDVFTTGATSGEAALTLFKAGALSVDLLVLARA 291


>gi|197104234|ref|YP_002129611.1| predicted amidophosphoribosyltransferase [Phenylobacterium zucineum
           HLK1]
 gi|196477654|gb|ACG77182.1| predicted amidophosphoribosyltransferase [Phenylobacterium zucineum
           HLK1]
          Length = 259

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 27/52 (51%), Positives = 34/52 (65%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           AF VP      V GL IL++DDV TTGATA+  A ALK AGA +V++   +R
Sbjct: 199 AFAVPPRRRTQVEGLNILVVDDVLTTGATAEGCARALKAAGATSVNVAVVAR 250


>gi|332529993|ref|ZP_08405943.1| phosphoribosyltransferase [Hylemonella gracilis ATCC 19624]
 gi|332040466|gb|EGI76842.1| phosphoribosyltransferase [Hylemonella gracilis ATCC 19624]
          Length = 249

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 37/56 (66%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +++AF VP    + + G ++LLIDDV TTGAT   AA  L++AGA+ +  L  +R+
Sbjct: 189 VQDAFGVPPGKRRRIEGQRLLLIDDVMTTGATLNAAAAVLREAGAVEICALVLART 244


>gi|163867840|ref|YP_001609044.1| competence protein ComF [Bartonella tribocorum CIP 105476]
 gi|161017491|emb|CAK01049.1| competence protein ComF [Bartonella tribocorum CIP 105476]
          Length = 261

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 34/59 (57%), Positives = 42/59 (71%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++NAF V   V K++ G  +LLIDDV+TTGAT   AA ALK AGA  V +LTFSR LK+
Sbjct: 196 VKNAFKVSHKVKKYLKGCSVLLIDDVFTTGATVTAAASALKYAGARQVDVLTFSRVLKE 254


>gi|311031944|ref|ZP_07710034.1| late competence protein [Bacillus sp. m3-13]
          Length = 237

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 28/54 (51%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           N F VP    + V G  ILLIDD+YTTG T + AA  LK AGA  +S  T  RS
Sbjct: 186 NTFYVPN--PEQVKGKNILLIDDIYTTGTTVRMAAKVLKDAGAKEISSFTLVRS 237


>gi|329847920|ref|ZP_08262948.1| phosphoribosyl transferase domain protein [Asticcacaulis
           biprosthecum C19]
 gi|328842983|gb|EGF92552.1| phosphoribosyl transferase domain protein [Asticcacaulis
           biprosthecum C19]
          Length = 272

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 38/59 (64%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF V    +K VAG +++LIDDV+TTGAT K     L KAGA  V +   +R++++
Sbjct: 212 VRKAFAVSASGAKAVAGKRVVLIDDVFTTGATLKACTRELLKAGAAQVDVAVLARAVQE 270


>gi|328953683|ref|YP_004371017.1| phosphoribosyltransferase [Desulfobacca acetoxidans DSM 11109]
 gi|328454007|gb|AEB09836.1| phosphoribosyltransferase [Desulfobacca acetoxidans DSM 11109]
          Length = 239

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 32/41 (78%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           + G  +LL+DDVYTTGAT K   +AL++AGA TV++LT +R
Sbjct: 195 IIGRSVLLLDDVYTTGATVKECTLALRRAGAHTVTVLTVAR 235


>gi|15966372|ref|NP_386725.1| hypothetical protein SMc02444 [Sinorhizobium meliloti 1021]
 gi|307313041|ref|ZP_07592668.1| phosphoribosyltransferase [Sinorhizobium meliloti BL225C]
 gi|307321047|ref|ZP_07600453.1| phosphoribosyltransferase [Sinorhizobium meliloti AK83]
 gi|15075643|emb|CAC47198.1| Putative competence protein F [Sinorhizobium meliloti 1021]
 gi|306893322|gb|EFN24102.1| phosphoribosyltransferase [Sinorhizobium meliloti AK83]
 gi|306899360|gb|EFN29994.1| phosphoribosyltransferase [Sinorhizobium meliloti BL225C]
          Length = 248

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 30/57 (52%), Positives = 43/57 (75%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF VP+   + +AG +I+L+DDVYTTGAT   A  ALK+AGA  V++LTF+R++
Sbjct: 188 VRGAFAVPEGAKRELAGKRIVLVDDVYTTGATVAAATRALKRAGAGDVTVLTFARAM 244


>gi|116751311|ref|YP_847998.1| phosphoribosyltransferase [Syntrophobacter fumaroxidans MPOB]
 gi|116700375|gb|ABK19563.1| phosphoribosyltransferase [Syntrophobacter fumaroxidans MPOB]
          Length = 259

 Score = 50.8 bits (120), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++NAF V       V G  IL++DDV+TTG T    A ALKK GA +V  LT +R+L D
Sbjct: 191 VKNAFRVKD--ETRVEGKSILIVDDVFTTGTTLSECARALKKGGAASVHALTVARALPD 247


>gi|254504618|ref|ZP_05116769.1| Phosphoribosyl transferase domain protein [Labrenzia alexandrii
           DFL-11]
 gi|222440689|gb|EEE47368.1| Phosphoribosyl transferase domain protein [Labrenzia alexandrii
           DFL-11]
          Length = 200

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 35/54 (64%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +R AF V     + +AG +++L+DDVYTTG+T       LK AGA TV +LTF+
Sbjct: 133 VRRAFQVSGDQLQKLAGRRVVLVDDVYTTGSTVSACTKVLKSAGAGTVDVLTFA 186


>gi|150397708|ref|YP_001328175.1| phosphoribosyltransferase [Sinorhizobium medicae WSM419]
 gi|150029223|gb|ABR61340.1| phosphoribosyltransferase [Sinorhizobium medicae WSM419]
          Length = 258

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 45/57 (78%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF+VP+ + + VAG +I+L+DDVYTTGAT   AA ALK+AGA  V++LTF+ ++
Sbjct: 198 VRGAFSVPEGLRREVAGKRIVLVDDVYTTGATVTAAARALKRAGAGDVTVLTFAMAV 254


>gi|188579651|ref|YP_001923096.1| competence protein F [Methylobacterium populi BJ001]
 gi|179343149|gb|ACB78561.1| competence protein F [Methylobacterium populi BJ001]
          Length = 255

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 36/59 (61%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ AF V       +AG ++LLIDDV TTGAT   AA  L +AGA  V +LTF+   +D
Sbjct: 195 LQGAFRVADRARLRIAGRRLLLIDDVSTTGATGNAAARVLLRAGAAGVDLLTFATVARD 253


>gi|300313450|ref|YP_003777542.1| amidophosphoribosyltransferase [Herbaspirillum seropedicae SmR1]
 gi|300076235|gb|ADJ65634.1| amidophosphoribosyltransferase protein [Herbaspirillum seropedicae
           SmR1]
          Length = 299

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 26/57 (45%), Positives = 36/57 (63%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R+AF +P      V GL + ++DDV TTGAT    AI LK+ GA  V+ L F+R+L
Sbjct: 241 VRSAFALPFATMDQVRGLHVGIVDDVMTTGATLNEVAIVLKRHGARRVTNLVFARTL 297


>gi|317130319|ref|YP_004096601.1| phosphoribosyltransferase [Bacillus cellulosilyticus DSM 2522]
 gi|315475267|gb|ADU31870.1| phosphoribosyltransferase [Bacillus cellulosilyticus DSM 2522]
          Length = 253

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 32/43 (74%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +A  KILL+DD+YTTGAT + AA  L +AGA +V  +T +RS+
Sbjct: 206 IANKKILLVDDIYTTGATLRSAATVLYRAGAKSVGAVTVARSV 248


>gi|154247019|ref|YP_001417977.1| phosphoribosyltransferase [Xanthobacter autotrophicus Py2]
 gi|154161104|gb|ABS68320.1| phosphoribosyltransferase [Xanthobacter autotrophicus Py2]
          Length = 255

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 35/52 (67%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           AF      + H+ G ++LL+DDV+TTGAT    A AL++AGA+ V  LTF+R
Sbjct: 199 AFAACGNAASHLEGRRVLLVDDVFTTGATLDACAQALRRAGAIQVDALTFAR 250


>gi|148553483|ref|YP_001261065.1| phosphoribosyltransferase [Sphingomonas wittichii RW1]
 gi|148498673|gb|ABQ66927.1| phosphoribosyltransferase [Sphingomonas wittichii RW1]
          Length = 248

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 33/45 (73%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           V G  +LL+DDVYTTGATA   A AL++AGA  V ++ ++R ++D
Sbjct: 199 VKGRAVLLVDDVYTTGATADACARALRRAGASRVDLICWARVVRD 243


>gi|320108567|ref|YP_004184157.1| phosphoribosyltransferase [Terriglobus saanensis SP1PR4]
 gi|319927088|gb|ADV84163.1| phosphoribosyltransferase [Terriglobus saanensis SP1PR4]
          Length = 281

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF V +     +AG  ILL+DD+YTTGATA+  +  L  AGA +V +LT +R+
Sbjct: 205 LRGAFRVTR--PGKIAGRDILLVDDIYTTGATARECSKTLLAAGAHSVHVLTLARA 258


>gi|152984307|ref|YP_001345987.1| putative phosphoribosyl transferase [Pseudomonas aeruginosa PA7]
 gi|150959465|gb|ABR81490.1| probable phosphoribosyl transferase [Pseudomonas aeruginosa PA7]
          Length = 241

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 26/58 (44%), Positives = 37/58 (63%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +     K V GL + L+DDV TTGATA+C A  L++AGA  V +   +R+ K
Sbjct: 184 LRHAFALAP--GKEVRGLHLALVDDVLTTGATAECLARLLRRAGAARVDVYCLARTPK 239


>gi|316932065|ref|YP_004107047.1| phosphoribosyltransferase [Rhodopseudomonas palustris DX-1]
 gi|315599779|gb|ADU42314.1| phosphoribosyltransferase [Rhodopseudomonas palustris DX-1]
          Length = 271

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 37/55 (67%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++ AF VP++    + G +I+LIDDV T+GAT    A AL +A A++V +L F+R
Sbjct: 208 VQGAFKVPKHRKAEIHGRRIVLIDDVLTSGATVDACARALLRARAVSVEVLVFAR 262


>gi|209965933|ref|YP_002298848.1| competence protein F [Rhodospirillum centenum SW]
 gi|209959399|gb|ACJ00036.1| competence protein F [Rhodospirillum centenum SW]
          Length = 263

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 35/55 (63%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           AF V       V G +I+L+DDV+TTGAT +  A  LK+AGA  V +LT +R ++
Sbjct: 204 AFAVRAACRDRVRGARIVLLDDVFTTGATVEECARVLKRAGAARVDVLTLARVVR 258


>gi|317154568|ref|YP_004122616.1| phosphoribosyltransferase [Desulfovibrio aespoeensis Aspo-2]
 gi|316944819|gb|ADU63870.1| phosphoribosyltransferase [Desulfovibrio aespoeensis Aspo-2]
          Length = 260

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 32/46 (69%)

Query: 14  HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            VAG  ILL+DDVYTTGAT    A  L++AGA  +S+L  +R+ ++
Sbjct: 213 QVAGRSILLVDDVYTTGATLTECARTLRRAGAAGLSVLVLARARRE 258


>gi|149184493|ref|ZP_01862811.1| amidophosphoribosyltransferase [Erythrobacter sp. SD-21]
 gi|148831813|gb|EDL50246.1| amidophosphoribosyltransferase [Erythrobacter sp. SD-21]
          Length = 262

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 23/47 (48%), Positives = 33/47 (70%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           + +AG  +LL+DDV T+GAT+     ALK+AGA TV+I  F+R L +
Sbjct: 210 ERIAGRNVLLVDDVLTSGATSTACVRALKRAGARTVTISCFARVLDE 256


>gi|94496926|ref|ZP_01303500.1| amidophosphoribosyltransferase [Sphingomonas sp. SKA58]
 gi|94423602|gb|EAT08629.1| amidophosphoribosyltransferase [Sphingomonas sp. SKA58]
          Length = 256

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 31/44 (70%)

Query: 16  AGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           AG ++LLIDDV T+GATA   A  LK+ GA  V +L ++R+L D
Sbjct: 203 AGRRVLLIDDVRTSGATAAACARMLKRGGATNVRLLCWARALPD 246


>gi|226324394|ref|ZP_03799912.1| hypothetical protein COPCOM_02175 [Coprococcus comes ATCC 27758]
 gi|225206842|gb|EEG89196.1| hypothetical protein COPCOM_02175 [Coprococcus comes ATCC 27758]
          Length = 246

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 29/54 (53%), Positives = 34/54 (62%), Gaps = 4/54 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +R AF V     K+V G  I+LIDD+YTTG+T   AA  LKKAGA  V  LT S
Sbjct: 192 IRGAFAV----QKNVKGENIVLIDDIYTTGSTLDEAARVLKKAGAEKVYFLTVS 241


>gi|158425919|ref|YP_001527211.1| competence protein F [Azorhizobium caulinodans ORS 571]
 gi|158332808|dbj|BAF90293.1| competence protein F [Azorhizobium caulinodans ORS 571]
          Length = 264

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 23/52 (44%), Positives = 34/52 (65%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           AF+VP  +   V G  +LL+DDV TTGAT +  A  L+++ A  + +LTF+R
Sbjct: 208 AFDVPPPLRAAVEGRHLLLVDDVMTTGATLESCARVLRRSSAAAIDVLTFAR 259


>gi|222053719|ref|YP_002536081.1| amidophosphoribosyltransferase-like protein [Geobacter sp. FRC-32]
 gi|221563008|gb|ACM18980.1| amidophosphoribosyltransferase-like protein [Geobacter sp. FRC-32]
          Length = 239

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 40/59 (67%), Gaps = 2/59 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ AF V +   + VA  +I+LIDDV+TTG+T +  A  LKKAGA  + I+T +R+L +
Sbjct: 183 VKGAFAVAE--PERVADRRIILIDDVFTTGSTVEECAKTLKKAGAAEIFIITVARALSN 239


>gi|302036453|ref|YP_003796775.1| putative phosphoribosyltransferase [Candidatus Nitrospira defluvii]
 gi|300604517|emb|CBK40849.1| putative Phosphoribosyltransferase [Candidatus Nitrospira defluvii]
          Length = 270

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 24/43 (55%), Positives = 30/43 (69%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           V G +IL+IDDV+TTG TA   A  L  AGA  V++LT +RSL
Sbjct: 205 VTGKRILIIDDVFTTGTTANECAKVLLNAGAKDVAVLTLARSL 247


>gi|167644905|ref|YP_001682568.1| phosphoribosyltransferase [Caulobacter sp. K31]
 gi|167347335|gb|ABZ70070.1| phosphoribosyltransferase [Caulobacter sp. K31]
          Length = 215

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 27/52 (51%), Positives = 33/52 (63%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           AF VP+     V G K+LLIDDV TTGATA+  A AL  AGA  V++   +R
Sbjct: 155 AFAVPEARRHRVTGRKVLLIDDVLTTGATAEGCARALLAAGATQVTLAVVAR 206


>gi|168699233|ref|ZP_02731510.1| phosphoribosyltransferase [Gemmata obscuriglobus UQM 2246]
          Length = 244

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           MR+ F V    S  VAG  +LL+DDV TTG+TA  AA AL+ AGA  V +   +R
Sbjct: 191 MRDVFRVRS--SARVAGKAVLLVDDVMTTGSTASVAAKALRDAGAERVVVAVLAR 243


>gi|85713804|ref|ZP_01044794.1| phosphoribosyltransferase [Nitrobacter sp. Nb-311A]
 gi|85699708|gb|EAQ37575.1| phosphoribosyltransferase [Nitrobacter sp. Nb-311A]
          Length = 269

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 33/55 (60%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++ AF V    S HV G +++LIDDV T+GAT    A  L +A A  V +L F+R
Sbjct: 206 VQGAFKVAAERSSHVQGRRVILIDDVLTSGATVDACARVLLRAKAAQVDVLVFAR 260


>gi|86747153|ref|YP_483649.1| phosphoribosyltransferase [Rhodopseudomonas palustris HaA2]
 gi|86570181|gb|ABD04738.1| Phosphoribosyltransferase [Rhodopseudomonas palustris HaA2]
          Length = 254

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 34/55 (61%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++ AF VP      V G +I+L+DDV T+GAT    A AL +A A +V +L F+R
Sbjct: 191 VQGAFKVPAERKAEVQGRRIVLVDDVLTSGATVDACARALLRAKAQSVDVLVFAR 245


>gi|85859102|ref|YP_461304.1| amidophosphoribosyltransferase family protein [Syntrophus
           aciditrophicus SB]
 gi|85722193|gb|ABC77136.1| amidophosphoribosyltransferase family protein [Syntrophus
           aciditrophicus SB]
          Length = 239

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 25/56 (44%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +RNAF V +     + G +ILL+DDVYTTG+T    A  L + GA +VS+ T +R+
Sbjct: 186 VRNAFEVVR--KAEIEGSRILLVDDVYTTGSTVGECARVLLEGGARSVSVATLARA 239


>gi|302342707|ref|YP_003807236.1| phosphoribosyltransferase [Desulfarculus baarsii DSM 2075]
 gi|301639320|gb|ADK84642.1| phosphoribosyltransferase [Desulfarculus baarsii DSM 2075]
          Length = 225

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 34/54 (62%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           AF V   ++  V G ++LLIDDV TTGAT     +AL  AGA+ V  LT SR++
Sbjct: 165 AFAVNPRLAAQVDGRRVLLIDDVQTTGATLHECTMALLAAGAVQVRALTVSRAM 218


>gi|172058472|ref|YP_001814932.1| competence protein F [Exiguobacterium sibiricum 255-15]
 gi|171990993|gb|ACB61915.1| competence protein F [Exiguobacterium sibiricum 255-15]
          Length = 215

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 32/50 (64%)

Query: 8   PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           P +V + V G  ILL+DDVYTTG T   AA  L +AGA  +S +T  RS+
Sbjct: 166 PYHVMQPVTGKTILLVDDVYTTGTTLHQAASRLYEAGAKEISAVTLFRSV 215


>gi|91974589|ref|YP_567248.1| phosphoribosyltransferase [Rhodopseudomonas palustris BisB5]
 gi|91681045|gb|ABE37347.1| phosphoribosyltransferase [Rhodopseudomonas palustris BisB5]
          Length = 272

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 34/55 (61%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++ AF VP      V G +I+L+DDV T+GAT    A AL +A A +V +L F+R
Sbjct: 209 VQGAFKVPPECKAEVQGRRIVLVDDVLTSGATVDACARALLRAKARSVDVLVFAR 263


>gi|110635335|ref|YP_675543.1| phosphoribosyltransferase [Mesorhizobium sp. BNC1]
 gi|110286319|gb|ABG64378.1| phosphoribosyltransferase [Chelativorans sp. BNC1]
          Length = 270

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF VP    + + G +++LIDDV+TTGAT   A  ALK+ GA  V +LTF+R+LK+
Sbjct: 202 VRGAFVVPPAAERILTGKRVILIDDVFTTGATVAAATRALKRGGAGEVDVLTFARALKE 260


>gi|319404563|emb|CBI78169.1| competence protein ComF [Bartonella rochalimae ATCC BAA-1498]
          Length = 247

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 33/59 (55%), Positives = 40/59 (67%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++NAF VP  V K++ G  ILLIDDV TTG T   A   LK AGA  V++LTFSR LK+
Sbjct: 182 VQNAFKVPNEVKKYLEGRSILLIDDVLTTGVTVTTATKTLKHAGARQVNVLTFSRVLKN 240


>gi|312109468|ref|YP_003987784.1| phosphoribosyltransferase [Geobacillus sp. Y4.1MC1]
 gi|311214569|gb|ADP73173.1| phosphoribosyltransferase [Geobacillus sp. Y4.1MC1]
          Length = 235

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 2/53 (3%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           N F + +  S  + G  I+LIDD+YTTG T + AA  L KAGA +VS LT +R
Sbjct: 184 NVFRLSEQTS--LQGKPIVLIDDIYTTGTTLRHAAKVLLKAGAASVSSLTLAR 234


>gi|182678125|ref|YP_001832271.1| phosphoribosyltransferase [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182634008|gb|ACB94782.1| phosphoribosyltransferase [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 264

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 32/55 (58%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           M+ AF VP+     V G  I+L+DDV T+GAT   AA  L +  A  V +L F+R
Sbjct: 208 MQGAFVVPEEARSRVEGRSIVLVDDVLTSGATLNAAARVLLRHRAARVDVLVFAR 262


>gi|297618073|ref|YP_003703232.1| phosphoribosyltransferase [Syntrophothermus lipocalidus DSM 12680]
 gi|297145910|gb|ADI02667.1| phosphoribosyltransferase [Syntrophothermus lipocalidus DSM 12680]
          Length = 239

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 36/54 (66%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF+V     + + G  ILL+DDVYTTG+TAK  A  L  AGA  VS++T++
Sbjct: 183 LKGAFDVRD--CEKIRGKNILLVDDVYTTGSTAKECATVLLDAGANRVSVITWA 234


>gi|269214467|ref|ZP_06158596.1| ComF/gntX family protein [Neisseria lactamica ATCC 23970]
 gi|269209759|gb|EEZ76214.1| ComF/gntX family protein [Neisseria lactamica ATCC 23970]
          Length = 165

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (62%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF + + + K   G  ILLIDDV+TTGAT    A  LKK+GA  V   T +R+
Sbjct: 109 IKNAFEIREPLPK---GCNILLIDDVFTTGATLNELAKMLKKSGARRVCCWTLART 161


>gi|309379776|emb|CBX21552.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 165

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (62%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF + + + K   G  ILLIDDV+TTGAT    A  LKK+GA  V   T +R+
Sbjct: 109 IKNAFEIREPLPK---GCNILLIDDVFTTGATLNELAKMLKKSGARRVCCWTLART 161


>gi|302875858|ref|YP_003844491.1| phosphoribosyltransferase [Clostridium cellulovorans 743B]
 gi|307689291|ref|ZP_07631737.1| phosphoribosyltransferase [Clostridium cellulovorans 743B]
 gi|302578715|gb|ADL52727.1| phosphoribosyltransferase [Clostridium cellulovorans 743B]
          Length = 225

 Score = 47.0 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 33/56 (58%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF + +     +A   IL++DDV TTGAT+ C    LK AGA  + +LT  +S
Sbjct: 168 LQGAFEINEKYKDSIANKNILIVDDVVTTGATSYCCYQQLKSAGAKKIKLLTLCKS 223


>gi|332186893|ref|ZP_08388635.1| hypothetical protein SUS17_1939 [Sphingomonas sp. S17]
 gi|332013226|gb|EGI55289.1| hypothetical protein SUS17_1939 [Sphingomonas sp. S17]
          Length = 216

 Score = 47.0 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 30/41 (73%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           V G  I+L+DDVYTTGATA     AL +AGA +V+IL ++R
Sbjct: 166 VVGRHIVLVDDVYTTGATAGACVRALLRAGAASVAILCWAR 206


>gi|319764159|ref|YP_004128096.1| phosphoribosyltransferase [Alicycliphilus denitrificans BC]
 gi|330826484|ref|YP_004389787.1| phosphoribosyltransferase [Alicycliphilus denitrificans K601]
 gi|317118720|gb|ADV01209.1| phosphoribosyltransferase [Alicycliphilus denitrificans BC]
 gi|329311856|gb|AEB86271.1| phosphoribosyltransferase [Alicycliphilus denitrificans K601]
          Length = 245

 Score = 47.0 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 36/56 (64%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF +   ++   +G ++LL+DDV TTGAT   AA  L++AGA  V+ +  +R+
Sbjct: 189 LRGAFMLDPLLAAQASGRRVLLVDDVMTTGATLHAAAAPLREAGARHVAAIVLART 244


>gi|171910308|ref|ZP_02925778.1| Phosphoribosyltransferase [Verrucomicrobium spinosum DSM 4136]
          Length = 255

 Score = 47.0 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 3/58 (5%)

Query: 1   MRNAFNV-PQYVSK-HVAGLKILLIDDVYTTGATA-KCAAIALKKAGAMTVSILTFSR 55
           ++ AF V P  V +  + G  ILLIDDV TTG+TA +CA + L++AGA  V +LT +R
Sbjct: 197 LKRAFRVKPSLVRRGRLKGKTILLIDDVLTTGSTASECAKVLLQEAGAARVWVLTVAR 254


>gi|297531385|ref|YP_003672660.1| phosphoribosyltransferase [Geobacillus sp. C56-T3]
 gi|297254637|gb|ADI28083.1| phosphoribosyltransferase [Geobacillus sp. C56-T3]
          Length = 230

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 8   PQYVSKH--VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           P ++S H  + G +I+LIDD+YTTG T + AA+ L +AGA  V  LT  R+
Sbjct: 180 PFFLSGHPPIDGKRIVLIDDIYTTGITVRHAALVLLEAGAAEVGALTLIRA 230


>gi|331084363|ref|ZP_08333467.1| hypothetical protein HMPREF0992_02391 [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|330401627|gb|EGG81208.1| hypothetical protein HMPREF0992_02391 [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 234

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 34/54 (62%), Gaps = 4/54 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           M+NAF     V K +    ILL+DD+YTTG+T + AA  LKKAGA  +  LT +
Sbjct: 180 MKNAF----IVRKKLKEENILLVDDIYTTGSTIEEAAKELKKAGAQNIFFLTIA 229


>gi|260590047|ref|ZP_05855960.1| ComF family protein [Blautia hansenii DSM 20583]
 gi|260539559|gb|EEX20128.1| ComF family protein [Blautia hansenii DSM 20583]
          Length = 212

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 34/54 (62%), Gaps = 4/54 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           M+NAF     V K +    ILL+DD+YTTG+T + AA  LKKAGA  +  LT +
Sbjct: 158 MKNAF----IVRKKLKEENILLVDDIYTTGSTIEEAAKELKKAGAQNIFFLTIA 207


>gi|312115454|ref|YP_004013050.1| phosphoribosyltransferase [Rhodomicrobium vannielii ATCC 17100]
 gi|311220583|gb|ADP71951.1| phosphoribosyltransferase [Rhodomicrobium vannielii ATCC 17100]
          Length = 261

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 26/51 (50%), Positives = 32/51 (62%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           AFNV     + VAG ++LL+DDV TTGATA   + AL  AGA  V IL  +
Sbjct: 194 AFNVGASGRRAVAGKRVLLVDDVITTGATANACSTALLAAGARAVDILAVA 244


>gi|229541556|ref|ZP_04430616.1| phosphoribosyltransferase [Bacillus coagulans 36D1]
 gi|229325976|gb|EEN91651.1| phosphoribosyltransferase [Bacillus coagulans 36D1]
          Length = 235

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/49 (46%), Positives = 34/49 (69%), Gaps = 2/49 (4%)

Query: 10  YVSKHVA--GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           Y+ K V+  G  +LL+DD+YTTG+T + AA  L++AGA  +  LT +RS
Sbjct: 187 YMEKEVSIEGRSVLLVDDIYTTGSTVRHAAKVLREAGARKIVSLTVARS 235


>gi|116054218|ref|YP_788662.1| putative phosphoribosyl transferase [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|296386989|ref|ZP_06876488.1| putative phosphoribosyl transferase [Pseudomonas aeruginosa PAb1]
 gi|115589439|gb|ABJ15454.1| putative phosphoribosyltransferase [Pseudomonas aeruginosa
           UCBPP-PA14]
          Length = 241

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 37/58 (63%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +    +  V GL + L+DDV TTGATA+C +  L++AGA  V +   +R+ K
Sbjct: 184 LRHAFALAP--ASDVRGLHLALVDDVLTTGATAECLSRLLRRAGAARVDVYCLARTPK 239


>gi|121595833|ref|YP_987729.1| ComF family protein [Acidovorax sp. JS42]
 gi|120607913|gb|ABM43653.1| ComF family protein [Acidovorax sp. JS42]
          Length = 242

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 34/56 (60%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF      +  +AG ++LL+DDV TTGAT   AA  L+ AGA+ V  L  +R+
Sbjct: 186 LRGAFVPDPLRAAQLAGKRVLLVDDVMTTGATLHAAAAPLRDAGALQVCALVLART 241


>gi|222112033|ref|YP_002554297.1| phosphoribosyltransferase [Acidovorax ebreus TPSY]
 gi|221731477|gb|ACM34297.1| phosphoribosyltransferase [Acidovorax ebreus TPSY]
          Length = 242

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 34/56 (60%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF      +  +AG ++LL+DDV TTGAT   AA  L+ AGA+ V  L  +R+
Sbjct: 186 LRGAFVPDPLRAAQLAGKRVLLVDDVMTTGATLHAAAAPLRDAGALQVCALVLART 241


>gi|242278332|ref|YP_002990461.1| phosphoribosyltransferase [Desulfovibrio salexigens DSM 2638]
 gi|242121226|gb|ACS78922.1| phosphoribosyltransferase [Desulfovibrio salexigens DSM 2638]
          Length = 247

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/43 (55%), Positives = 30/43 (69%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           VA  +ILLIDDVYTTG+T    A  L +AGA  V ++T SR+L
Sbjct: 204 VADKRILLIDDVYTTGSTVDECARTLLEAGAARVEVMTLSRAL 246


>gi|229916664|ref|YP_002885310.1| ComF operon protein 3 [Exiguobacterium sp. AT1b]
 gi|229468093|gb|ACQ69865.1| ComF operon protein 3 [Exiguobacterium sp. AT1b]
          Length = 222

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 34/55 (61%), Gaps = 4/55 (7%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           N F VP  V     G KI+L+DDVYTTG T   AA +L++AGA  VS +   R+L
Sbjct: 164 NPFTVPTSVK---CG-KIILVDDVYTTGTTLHQAAFSLRQAGASEVSAICLFRAL 214


>gi|83592076|ref|YP_425828.1| phosphoribosyltransferase [Rhodospirillum rubrum ATCC 11170]
 gi|83574990|gb|ABC21541.1| Phosphoribosyltransferase [Rhodospirillum rubrum ATCC 11170]
          Length = 246

 Score = 46.2 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 29/41 (70%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +AG +++LIDDV TTGATA   A AL  AGA  V +LT +R
Sbjct: 200 IAGRRVVLIDDVLTTGATANACARALLAAGATGVDVLTLAR 240


>gi|114570814|ref|YP_757494.1| phosphoribosyltransferase [Maricaulis maris MCS10]
 gi|114341276|gb|ABI66556.1| phosphoribosyltransferase [Maricaulis maris MCS10]
          Length = 255

 Score = 46.2 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           AF VP      VAG  ++L+DDV TTGAT    A  LK+AGA +V ++   R +++
Sbjct: 197 AFTVPD--RNAVAGKHLVLVDDVITTGATVSACAYQLKRAGAASVRVVALCRVVRE 250


>gi|308273050|emb|CBX29654.1| hypothetical protein N47_J06350 [uncultured Desulfobacterium sp.]
          Length = 276

 Score = 46.2 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 26/57 (45%), Positives = 37/57 (64%), Gaps = 2/57 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF V ++    V   +ILLIDDVYTTGATA   A AL +AG  +V +LT + ++
Sbjct: 222 IKGAFTVNKHCK--VKKTRILLIDDVYTTGATADECAKALFEAGVQSVDVLTIAGAI 276


>gi|83859693|ref|ZP_00953213.1| phosphoribosyltransferase [Oceanicaulis alexandrii HTCC2633]
 gi|83852052|gb|EAP89906.1| phosphoribosyltransferase [Oceanicaulis alexandrii HTCC2633]
          Length = 185

 Score = 46.2 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 35/55 (63%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           AF V +     V G + +L+DDV+TTGAT +  A  LK+AGA  V+ +T +R +K
Sbjct: 125 AFMVREAAKPFVQGRRFVLVDDVHTTGATLQACARVLKRAGAEDVTAITLARVVK 179


>gi|328542087|ref|YP_004302196.1| phosphoribosyl transferase domain protein [polymorphum gilvum
           SL003B-26A1]
 gi|326411836|gb|ADZ68899.1| Phosphoribosyl transferase domain protein [Polymorphum gilvum
           SL003B-26A1]
          Length = 257

 Score = 46.2 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 32/54 (59%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +R AF +       VAG  ++L+DDV TTG+T    A  LK AGA  V +LTF+
Sbjct: 195 VRGAFRLRAGAEAQVAGRPVVLVDDVLTTGSTVTACARVLKAAGAAGVDVLTFA 248


>gi|170749082|ref|YP_001755342.1| competence protein F [Methylobacterium radiotolerans JCM 2831]
 gi|170655604|gb|ACB24659.1| competence protein F [Methylobacterium radiotolerans JCM 2831]
          Length = 253

 Score = 46.2 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 33/54 (61%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +  AF V       + G ++LL+DDV TTGAT   AA AL + GA +V +LTF+
Sbjct: 193 LSGAFRVTAAEQHRIRGRRVLLVDDVMTTGATGNAAARALLRGGATSVDLLTFA 246


>gi|58038532|ref|YP_190496.1| competence protein F [Gluconobacter oxydans 621H]
 gi|58000946|gb|AAW59840.1| Competence protein F [Gluconobacter oxydans 621H]
          Length = 228

 Score = 46.2 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 34/56 (60%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           M +A  V +     + G  +LL+DDV TTG+TA    +AL KAGA +V IL  +R+
Sbjct: 160 MEHAVRVRKGRGARIEGQAVLLVDDVLTTGSTASACTMALMKAGAASVDILVAART 215


>gi|85706922|ref|ZP_01038012.1| competence protein F, putative [Roseovarius sp. 217]
 gi|85668533|gb|EAQ23404.1| competence protein F, putative [Roseovarius sp. 217]
          Length = 232

 Score = 46.2 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 25/45 (55%), Positives = 31/45 (68%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +AG  IL++DDV T+GAT   AA A   AGA  VSILT +R+ KD
Sbjct: 187 MAGRFILIVDDVMTSGATLSVAAQACFSAGAGEVSILTLARAAKD 231


>gi|254472326|ref|ZP_05085726.1| phosphoribosyltransferase [Pseudovibrio sp. JE062]
 gi|211958609|gb|EEA93809.1| phosphoribosyltransferase [Pseudovibrio sp. JE062]
          Length = 281

 Score = 46.2 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/54 (40%), Positives = 33/54 (61%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF V ++    V+G  ++L+DDV TTGAT +     LK AGA  V +L F+
Sbjct: 216 VKGAFEVSEHFLAKVSGAHVVLVDDVLTTGATVEECTRVLKAAGAKQVDVLVFA 269


>gi|313669260|ref|YP_004049544.1| hypothetical protein NLA_19950 [Neisseria lactamica ST-640]
 gi|313006722|emb|CBN88192.1| conserved hypothetical protein [Neisseria lactamica 020-06]
          Length = 241

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 35/56 (62%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF + + + K   G  ILLIDDV+TTGAT    A  LKK+GA  V   T +R+
Sbjct: 185 IKNAFEIREPLPK---GCNILLIDDVFTTGATLNELAKMLKKSGARRVCCWTLART 237


>gi|261856677|ref|YP_003263960.1| phosphoribosyltransferase [Halothiobacillus neapolitanus c2]
 gi|261837146|gb|ACX96913.1| phosphoribosyltransferase [Halothiobacillus neapolitanus c2]
          Length = 247

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 37/56 (66%), Gaps = 5/56 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF V +++ +HVA     ++DDV TTG++A   A ALK+AG   V++   +R+
Sbjct: 189 LKNAFEVREHLPQHVA-----IVDDVMTTGSSADALAYALKRAGVGRVTVWVLART 239


>gi|331090124|ref|ZP_08339013.1| hypothetical protein HMPREF1025_02596 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|330402586|gb|EGG82155.1| hypothetical protein HMPREF1025_02596 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 191

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 29/54 (53%), Positives = 36/54 (66%), Gaps = 3/54 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +R+AF + +   K VA   +LLIDD+YTTGAT + AA  LKKAGA  V  LT S
Sbjct: 136 LRDAFALSER-WKPVA--NVLLIDDIYTTGATVEQAAKILKKAGAQNVYFLTIS 186


>gi|302381420|ref|YP_003817243.1| phosphoribosyltransferase [Brevundimonas subvibrioides ATCC 15264]
 gi|302192048|gb|ADK99619.1| phosphoribosyltransferase [Brevundimonas subvibrioides ATCC 15264]
          Length = 249

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 36/55 (65%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +++AF++ +  ++ V G +ILL+DDV TTGATA+  A AL   GA  V +   +R
Sbjct: 186 VKSAFDLTETGARRVRGRRILLVDDVLTTGATAEACATALLDGGARAVDLAVIAR 240


>gi|114797458|ref|YP_761845.1| ComF family protein [Hyphomonas neptunium ATCC 15444]
 gi|114737632|gb|ABI75757.1| ComF family protein [Hyphomonas neptunium ATCC 15444]
          Length = 252

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 33/55 (60%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           AF+V     K   G +ILL+DDV TTGAT      ALK+AGA  + +L  +R ++
Sbjct: 192 AFDVRASRRKLEEGRRILLVDDVLTTGATLNACTRALKRAGARQIDVLVLARVVR 246


>gi|257064230|ref|YP_003143902.1| predicted amidophosphoribosyltransferase [Slackia
           heliotrinireducens DSM 20476]
 gi|256791883|gb|ACV22553.1| predicted amidophosphoribosyltransferase [Slackia
           heliotrinireducens DSM 20476]
          Length = 230

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 27/37 (72%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +LLIDDV TTGAT + A  ALK AGA TV  LT +R+
Sbjct: 194 VLLIDDVMTTGATLEAATTALKDAGAQTVRCLTLARA 230


>gi|312897985|ref|ZP_07757394.1| ComF family protein [Megasphaera micronuciformis F0359]
 gi|310620910|gb|EFQ04461.1| ComF family protein [Megasphaera micronuciformis F0359]
          Length = 217

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 25/56 (44%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF V     K V   ++LL+DDVYTTGAT +  A ALK+ GA+ V+ L  + S
Sbjct: 162 LKAAFTV--VAGKTVKDCRLLLVDDVYTTGATLQACAAALKRNGAVEVTGLVIASS 215


>gi|167748296|ref|ZP_02420423.1| hypothetical protein ANACAC_03040 [Anaerostipes caccae DSM 14662]
 gi|167652288|gb|EDR96417.1| hypothetical protein ANACAC_03040 [Anaerostipes caccae DSM 14662]
          Length = 158

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 28/42 (66%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51
           + S  V G ++LL+DD+YTTGATA+    ALK AGA  V + 
Sbjct: 109 WASDEVKGKRVLLVDDIYTTGATAESCTRALKAAGAEDVWVF 150


>gi|148260495|ref|YP_001234622.1| phosphoribosyltransferase [Acidiphilium cryptum JF-5]
 gi|146402176|gb|ABQ30703.1| phosphoribosyltransferase [Acidiphilium cryptum JF-5]
          Length = 217

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 32/55 (58%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++ A  + +    H+AG  ILL+DDV TTGATA   A  L  AGA  V +L  +R
Sbjct: 156 LKGAIGIREGREAHIAGRTILLVDDVLTTGATASACADTLYAAGAAAVDVLAIAR 210


>gi|307294581|ref|ZP_07574423.1| phosphoribosyltransferase [Sphingobium chlorophenolicum L-1]
 gi|306879055|gb|EFN10273.1| phosphoribosyltransferase [Sphingobium chlorophenolicum L-1]
          Length = 246

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/45 (48%), Positives = 31/45 (68%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           + G  +LLIDDV+T+GATA   A  LK+ GA +V +L ++R L D
Sbjct: 199 LKGRAVLLIDDVHTSGATAAACARTLKRGGAASVHLLCWARVLPD 243


>gi|313111882|ref|ZP_07797672.1| putative phosphoribosyltransferase [Pseudomonas aeruginosa 39016]
 gi|310884174|gb|EFQ42768.1| putative phosphoribosyltransferase [Pseudomonas aeruginosa 39016]
          Length = 76

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 37/58 (63%), Gaps = 2/58 (3%)

Query: 1  MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
          +R+AF +    +  V GL + L+DDV TTGATA+C +  L++AGA  V +   +R+ K
Sbjct: 19 LRHAFALAP--ASDVRGLHLALVDDVLTTGATAECLSRLLRRAGAARVDVYCLARTPK 74


>gi|153814658|ref|ZP_01967326.1| hypothetical protein RUMTOR_00873 [Ruminococcus torques ATCC 27756]
 gi|317501132|ref|ZP_07959338.1| hypothetical protein HMPREF1026_01281 [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|145848152|gb|EDK25070.1| hypothetical protein RUMTOR_00873 [Ruminococcus torques ATCC 27756]
 gi|316897519|gb|EFV19584.1| hypothetical protein HMPREF1026_01281 [Lachnospiraceae bacterium
           8_1_57FAA]
          Length = 191

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 29/54 (53%), Positives = 36/54 (66%), Gaps = 3/54 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +R+AF + +   K VA   +LLIDD+YTTGAT + AA  LKKAGA  V  LT S
Sbjct: 136 LRDAFALSER-WKPVA--NVLLIDDIYTTGATVEQAAKILKKAGAQNVYFLTIS 186


>gi|187735075|ref|YP_001877187.1| competence protein F, [Akkermansia muciniphila ATCC BAA-835]
 gi|187425127|gb|ACD04406.1| competence protein F, putative [Akkermansia muciniphila ATCC
           BAA-835]
          Length = 249

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 30/42 (71%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           V G  +LL+DDV+TTGATA   A  L ++GA +V +LT +R+
Sbjct: 202 VRGRDVLLVDDVFTTGATADSCARLLLRSGAASVCVLTLART 243


>gi|325690461|gb|EGD32464.1| hypothetical protein HMPREF9382_0397 [Streptococcus sanguinis
           SK115]
          Length = 410

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/44 (54%), Positives = 29/44 (65%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           V+K + G  IL+IDDV TTGAT K  A AL +AGA  VS   F+
Sbjct: 307 VTKDLTGKNILVIDDVVTTGATLKACAEALFQAGAENVSFFVFA 350


>gi|89100614|ref|ZP_01173472.1| late competence protein [Bacillus sp. NRRL B-14911]
 gi|89084638|gb|EAR63781.1| late competence protein [Bacillus sp. NRRL B-14911]
          Length = 239

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/44 (47%), Positives = 30/44 (68%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           S  +    +LLIDD+YTTG+T + AA+ LK+AGA  +  LT +R
Sbjct: 195 SAAIEAKNLLLIDDIYTTGSTLRHAALPLKQAGAANIMSLTLAR 238


>gi|94501351|ref|ZP_01307871.1| amidophosphoribosyltransferase family protein [Oceanobacter sp.
           RED65]
 gi|94426464|gb|EAT11452.1| amidophosphoribosyltransferase family protein [Oceanobacter sp.
           RED65]
          Length = 148

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 38/56 (67%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF V    ++++ G  +LLIDDV TTGATA  A++ L K+GA +V +   +R+
Sbjct: 90  VKNAFEV--NSAQYIEGKNVLLIDDVMTTGATAHEASLTLIKSGAKSVCVACLART 143


>gi|330505323|ref|YP_004382192.1| amidophosphoribosyltransferase-like protein [Pseudomonas mendocina
           NK-01]
 gi|328919609|gb|AEB60440.1| amidophosphoribosyltransferase-like protein [Pseudomonas mendocina
           NK-01]
          Length = 192

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF++   V   +AG  + LIDDV TTGATA   A  L++AGA+ V +   +R+
Sbjct: 133 LRQAFSLQ--VQAAIAGAHLALIDDVLTTGATADMLAQLLRRAGALRVDVYCLART 186


>gi|75674583|ref|YP_317004.1| phosphoribosyltransferase [Nitrobacter winogradskyi Nb-255]
 gi|74419453|gb|ABA03652.1| phosphoribosyltransferase [Nitrobacter winogradskyi Nb-255]
          Length = 271

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 33/55 (60%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++ AF V    + HV G +++LIDDV T+GAT    A  L +A A  V +L F+R
Sbjct: 208 VQGAFKVTAERAGHVQGRRVILIDDVLTSGATVDACARVLLRAKAAQVDVLVFAR 262


>gi|187250530|ref|YP_001875012.1| phosphoribosyltransferase [Elusimicrobium minutum Pei191]
 gi|186970690|gb|ACC97675.1| Phosphoribosyltransferase [Elusimicrobium minutum Pei191]
          Length = 245

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (60%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           M+NAF      +  + G  ILLIDDV TTG+T +  A ALKKAGA  +  LT +R 
Sbjct: 190 MKNAFKA----AGKITGKTILLIDDVATTGSTLEACAEALKKAGAKNIYALTIARE 241


>gi|254483220|ref|ZP_05096453.1| hypothetical protein GPB2148_406 [marine gamma proteobacterium
           HTCC2148]
 gi|214036591|gb|EEB77265.1| hypothetical protein GPB2148_406 [marine gamma proteobacterium
           HTCC2148]
          Length = 240

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 30/46 (65%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           VS     L++ LIDDV TTGATA  AA ALK+AGA  V I   +R+
Sbjct: 186 VSSGCDNLRVALIDDVLTTGATAGEAARALKQAGAARVEIWCLART 231


>gi|117924701|ref|YP_865318.1| phosphoribosyltransferase [Magnetococcus sp. MC-1]
 gi|117608457|gb|ABK43912.1| phosphoribosyltransferase [Magnetococcus sp. MC-1]
          Length = 242

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 24/59 (40%), Positives = 38/59 (64%), Gaps = 2/59 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           MR  F   Q+  + VA   +LL+DD  TTGAT + AA ALKK+G   V+++  +++++D
Sbjct: 180 MRGVFRA-QWGERAVAE-HLLLVDDTMTTGATVREAAAALKKSGVGQVTVMVLAKAMRD 236


>gi|187777240|ref|ZP_02993713.1| hypothetical protein CLOSPO_00787 [Clostridium sporogenes ATCC
           15579]
 gi|187774168|gb|EDU37970.1| hypothetical protein CLOSPO_00787 [Clostridium sporogenes ATCC
           15579]
          Length = 225

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 38/56 (67%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++++F V  Y  ++V   +ILLIDDV TTGAT+   A  LKK+GA  + ILT ++S
Sbjct: 170 VKDSFKV--YNERYVENKRILLIDDVLTTGATSFYCANELKKSGAKEIFILTAAKS 223


>gi|295707177|ref|YP_003600252.1| ComFC transformation protein [Bacillus megaterium DSM 319]
 gi|294804836|gb|ADF41902.1| ComFC transformation protein [Bacillus megaterium DSM 319]
          Length = 165

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 30/45 (66%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           S  V   + LLIDD+YTTGAT + AA  L++AGA +V  LT  R+
Sbjct: 121 SSMVTNQEFLLIDDIYTTGATVRQAANCLQEAGARSVRSLTLIRA 165


>gi|149911005|ref|ZP_01899634.1| ComF-related protein [Moritella sp. PE36]
 gi|149805908|gb|EDM65894.1| ComF-related protein [Moritella sp. PE36]
          Length = 237

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 28/60 (46%), Positives = 33/60 (55%), Gaps = 6/60 (10%)

Query: 1   MRNAFNVPQYVS-KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           M NAF V Q  S KH+A     LIDDV TTG T K A + L  AG   + I   +R+L D
Sbjct: 183 MHNAFQVTQRFSVKHIA-----LIDDVVTTGETIKAACLTLFAAGIERIDIWCIARTLAD 237


>gi|114565757|ref|YP_752911.1| phosphoribosyltransferase [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|114336692|gb|ABI67540.1| phosphoribosyltransferase [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
          Length = 239

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           AF V Q   + V G KILL+DDVYTTG+T +     L +AGA  VS++T++
Sbjct: 186 AFKVTQ--PQKVLGKKILLVDDVYTTGSTIRECTRVLLEAGAERVSVITWA 234


>gi|313496727|gb|ADR58093.1| Competence protein ComF, putative [Pseudomonas putida BIRD-1]
          Length = 243

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 36/59 (61%), Gaps = 6/59 (10%)

Query: 1   MRNAFNVP-QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF V  +   KHVA     ++DDV TTGATA+  A AL+KAGA  V +   +R+ K
Sbjct: 186 LRQAFAVKGELEGKHVA-----IVDDVLTTGATAQAIAQALRKAGARRVDVYCLARTPK 239


>gi|294501828|ref|YP_003565528.1| ComFC transformation protein [Bacillus megaterium QM B1551]
 gi|294351765|gb|ADE72094.1| ComFC transformation protein [Bacillus megaterium QM B1551]
          Length = 165

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 30/45 (66%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           S  V   + LLIDD+YTTGAT + AA  L++AGA +V  LT  R+
Sbjct: 121 SSMVTNQEFLLIDDIYTTGATVRQAANCLQEAGAHSVRSLTLIRA 165


>gi|241894822|ref|ZP_04782118.1| late competence protein [Weissella paramesenteroides ATCC 33313]
 gi|241871943|gb|EER75694.1| late competence protein [Weissella paramesenteroides ATCC 33313]
          Length = 225

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 34/55 (61%), Gaps = 1/55 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           M+  F + Q   K +A  KI L+DDVYTTG T + AA  L  AGA+ V+ LT +R
Sbjct: 172 MKQPFTLCQ-SDKKLANQKICLVDDVYTTGRTLRHAAQCLIVAGALEVTSLTLAR 225


>gi|319650648|ref|ZP_08004788.1| hypothetical protein HMPREF1013_01393 [Bacillus sp. 2_A_57_CT2]
 gi|317397829|gb|EFV78527.1| hypothetical protein HMPREF1013_01393 [Bacillus sp. 2_A_57_CT2]
          Length = 110

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 32/50 (64%)

Query: 6   NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
            V Q ++ H+   KI+LIDD+YTTG+T   AA  LK  GA +V  LT +R
Sbjct: 60  QVFQPLNLHIENKKIILIDDIYTTGSTLYHAAKVLKAGGAASVCSLTLAR 109


>gi|260424718|ref|ZP_05733052.2| ComF family protein [Dialister invisus DSM 15470]
 gi|260402941|gb|EEW96488.1| ComF family protein [Dialister invisus DSM 15470]
          Length = 149

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 34/54 (62%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           MR  F+V +  S  V G KILL DD+YTTGAT + AA  L +AGA  V  +T +
Sbjct: 94  MRGVFHVNKGTS--VKGKKILLADDIYTTGATMESAAHELMRAGAEKVVGITIA 145


>gi|329888704|ref|ZP_08267302.1| phosphoribosyl transferase domain protein [Brevundimonas diminuta
           ATCC 11568]
 gi|328847260|gb|EGF96822.1| phosphoribosyl transferase domain protein [Brevundimonas diminuta
           ATCC 11568]
          Length = 268

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 35/55 (63%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++ AF V +   + + G ++LLIDDV TTGATA+  A AL +AGA  V +   +R
Sbjct: 205 VKAAFAVTEVGRRRIKGRRLLLIDDVLTTGATAEACARALIEAGARAVDLAVIAR 259


>gi|317472164|ref|ZP_07931496.1| comF family protein [Anaerostipes sp. 3_2_56FAA]
 gi|316900568|gb|EFV22550.1| comF family protein [Anaerostipes sp. 3_2_56FAA]
          Length = 234

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 28/42 (66%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51
           + S  V G ++LL+DD+YTTGATA+    ALK AGA  V + 
Sbjct: 185 WASDEVKGKRVLLVDDIYTTGATAESCTRALKAAGAEDVWVF 226


>gi|26987103|ref|NP_742528.1| competence protein ComF, putative [Pseudomonas putida KT2440]
 gi|24981731|gb|AAN65992.1|AE016228_5 competence protein ComF, putative [Pseudomonas putida KT2440]
          Length = 243

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 36/59 (61%), Gaps = 6/59 (10%)

Query: 1   MRNAFNVP-QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF V  +   KHVA     ++DDV TTGATA+  A AL+KAGA  V +   +R+ K
Sbjct: 186 LRQAFAVQGELEGKHVA-----IVDDVLTTGATAQAIAQALRKAGARRVDVYCLARTPK 239


>gi|56552061|ref|YP_162900.1| amidophosphoribosyltransferase [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|56543635|gb|AAV89789.1| amidophosphoribosyltransferase [Zymomonas mobilis subsp. mobilis
           ZM4]
          Length = 281

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 30/41 (73%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +AG  I+LIDDV+T+GAT +  A  LKKAG  +V +L ++R
Sbjct: 233 LAGRDIILIDDVFTSGATTESCARLLKKAGVKSVHVLCWAR 273


>gi|163792772|ref|ZP_02186749.1| Phosphoribosyltransferase [alpha proteobacterium BAL199]
 gi|159182477|gb|EDP66986.1| Phosphoribosyltransferase [alpha proteobacterium BAL199]
          Length = 248

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 34/55 (61%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++ AF V       +A  ++LL+DDV T+GATA   A  L +AGA +V +LT +R
Sbjct: 192 VQGAFRVDDRRRSEIADRRVLLVDDVLTSGATAGACARVLLRAGAASVDLLTLAR 246


>gi|260431723|ref|ZP_05785694.1| competence protein F [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415551|gb|EEX08810.1| competence protein F [Silicibacter lacuscaerulensis ITI-1157]
          Length = 254

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 34/59 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R+A  V    +  + G  +LL+DDV T+GAT      A ++AGA  +S+L  +R  KD
Sbjct: 195 LRDAITVHPRRADRLTGRHVLLVDDVMTSGATLAACTHACQEAGAADISVLVLARVAKD 253


>gi|325203384|gb|ADY98837.1| comF/gntX family protein [Neisseria meningitidis M01-240355]
          Length = 241

 Score = 45.1 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 25/56 (44%), Positives = 35/56 (62%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF + + + K   G  ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIREPLPK---GCNILLIDDVFTTGATLDELAKMLKKSGANRICCWTLART 237


>gi|295401188|ref|ZP_06811161.1| phosphoribosyltransferase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|294976781|gb|EFG52386.1| phosphoribosyltransferase [Geobacillus thermoglucosidasius
           C56-YS93]
          Length = 235

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 27/36 (75%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           I+LIDD+YTTG T + AA  L KAGA +VS LT +R
Sbjct: 199 IVLIDDIYTTGTTLRHAAKVLLKAGAASVSSLTLAR 234


>gi|115522182|ref|YP_779093.1| phosphoribosyltransferase [Rhodopseudomonas palustris BisA53]
 gi|115516129|gb|ABJ04113.1| phosphoribosyltransferase [Rhodopseudomonas palustris BisA53]
          Length = 273

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 32/55 (58%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++ AF VP      + G +ILL+DDV T+GAT    A AL +A A  V +  F+R
Sbjct: 210 VQGAFKVPAERRAELQGRRILLVDDVLTSGATVDACARALLRAKAKAVDVAVFAR 264


>gi|110835082|ref|YP_693941.1| hypothetical protein ABO_2221 [Alcanivorax borkumensis SK2]
 gi|110648193|emb|CAL17669.1| conserved hypothetical protein [Alcanivorax borkumensis SK2]
          Length = 247

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 35/57 (61%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF     V+    GL+++L+DDV TTG++A+ AA  L   GA  V + T +R+L
Sbjct: 190 LRQAFRCQHSVT----GLRLILVDDVMTTGSSARAAAQCLLDQGAKDVRVWTLARTL 242


>gi|261420591|ref|YP_003254273.1| late competence protein [Geobacillus sp. Y412MC61]
 gi|319768261|ref|YP_004133762.1| phosphoribosyltransferase [Geobacillus sp. Y412MC52]
 gi|261377048|gb|ACX79791.1| late competence protein [Geobacillus sp. Y412MC61]
 gi|317113127|gb|ADU95619.1| phosphoribosyltransferase [Geobacillus sp. Y412MC52]
          Length = 230

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 30/42 (71%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +AG +I+LIDD+YTTG T + AA+ L +AGA  V  LT  R+
Sbjct: 189 LAGKRIVLIDDIYTTGITIRHAALVLLEAGAAEVWALTLVRA 230


>gi|148545642|ref|YP_001265744.1| amidophosphoribosyltransferase-like protein [Pseudomonas putida F1]
 gi|148509700|gb|ABQ76560.1| amidophosphoribosyltransferase-like protein [Pseudomonas putida F1]
          Length = 243

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 36/59 (61%), Gaps = 6/59 (10%)

Query: 1   MRNAFNV-PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF V  +   KHVA     ++DDV TTGATA+  A AL+KAGA  V +   +R+ K
Sbjct: 186 LRQAFAVMGKLQGKHVA-----IVDDVLTTGATAQAIAQALRKAGARQVDVYCLARTPK 239


>gi|255659147|ref|ZP_05404556.1| putative competence protein F [Mitsuokella multacida DSM 20544]
 gi|260848597|gb|EEX68604.1| putative competence protein F [Mitsuokella multacida DSM 20544]
          Length = 218

 Score = 44.7 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 22/54 (40%), Positives = 35/54 (64%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +++AF++ +     V+G  ILL+DD+ TTGAT    A  L++AGA  V +L F+
Sbjct: 163 LKDAFSMAR--DADVSGKHILLLDDILTTGATLSACAAVLRRAGAARVDVLVFA 214


>gi|90022782|ref|YP_528609.1| K+-dependent Na+/Ca+ exchanger related-protein [Saccharophagus
           degradans 2-40]
 gi|89952382|gb|ABD82397.1| phosphoribosyltransferase [Saccharophagus degradans 2-40]
          Length = 296

 Score = 44.7 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 34/58 (58%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R +F V   +   V G  I ++DDV TTGATA+  A  LK+AGA  V I   +R+ K
Sbjct: 237 LRQSFAVAPKLLTEVKGKHIAVVDDVVTTGATAEVIANLLKEAGASRVDIWALARTPK 294


>gi|170742923|ref|YP_001771578.1| phosphoribosyltransferase [Methylobacterium sp. 4-46]
 gi|168197197|gb|ACA19144.1| phosphoribosyltransferase [Methylobacterium sp. 4-46]
          Length = 279

 Score = 44.7 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 39/59 (66%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ AF VP+     +AG ++LL+DDV TTG+TA  AA AL + GA  V +L F+  ++D
Sbjct: 205 LQGAFRVPEAARPRLAGRRVLLVDDVITTGSTANAAARALLRGGAAAVDVLAFACVVQD 263


>gi|327542904|gb|EGF29360.1| phosphoribosyl transferase [Rhodopirellula baltica WH47]
          Length = 302

 Score = 44.7 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 37/59 (62%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF V +   K +AG  ILL+DDV TTGATA   +  L  AGA  V +L  +R+++D
Sbjct: 241 VRGAFRVRRRWRKRLAGEHILLVDDVMTTGATADEISRVLLDAGAARVDLLVVARAIRD 299


>gi|241764400|ref|ZP_04762425.1| ComF family protein [Acidovorax delafieldii 2AN]
 gi|241366190|gb|EER60761.1| ComF family protein [Acidovorax delafieldii 2AN]
          Length = 186

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 36/56 (64%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF V    +  + GL+++LIDDV TTGAT   AA  L++AGA  ++ L  +R+
Sbjct: 128 LRVAFAVEPARAAGLRGLRLVLIDDVMTTGATLDAAARVLREAGAAHITALVVART 183


>gi|32475560|ref|NP_868554.1| phosphoribosyl transferase [Rhodopirellula baltica SH 1]
 gi|32446102|emb|CAD75931.1| probable phosphoribosyl transferase [Rhodopirellula baltica SH 1]
          Length = 302

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 37/59 (62%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF V +   K +AG  ILL+DDV TTGATA   +  L  AGA  V +L  +R+++D
Sbjct: 241 VRGAFRVRRRWRKRLAGEHILLVDDVMTTGATADEISRVLLDAGAARVDLLVVARAIRD 299


>gi|149174134|ref|ZP_01852762.1| Phosphoribosyltransferase [Planctomyces maris DSM 8797]
 gi|148847114|gb|EDL61449.1| Phosphoribosyltransferase [Planctomyces maris DSM 8797]
          Length = 252

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R+AF V +     V  L ILL+DDV TTG+TA  A  AL +AGA  +++   +R+
Sbjct: 196 LRDAFQVRR--PGRVKDLSILLVDDVMTTGSTANAATRALLQAGASEINVAVIARA 249


>gi|294085486|ref|YP_003552246.1| putative competence protein F [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292665061|gb|ADE40162.1| putative competence protein F (COMF) [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 238

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 33/55 (60%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +R AF VP +    +A   I+LIDDV TTGAT   AA  L+ AGA ++  L  +R
Sbjct: 182 VRGAFAVPAHQKPALANRPIMLIDDVMTTGATLFEAAKTLQMAGAGSICGLVIAR 236


>gi|210630450|ref|ZP_03296453.1| hypothetical protein COLSTE_00337 [Collinsella stercoris DSM 13279]
 gi|210160452|gb|EEA91423.1| hypothetical protein COLSTE_00337 [Collinsella stercoris DSM 13279]
          Length = 243

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 31/45 (68%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           V + V G +++L+DDV TTGAT   AA ALK+AGA  V  L F+R
Sbjct: 196 VVEQVRGARLVLLDDVITTGATMNAAAHALKEAGAERVDGLAFAR 240


>gi|218779784|ref|YP_002431102.1| phosphoribosyltransferase [Desulfatibacillum alkenivorans AK-01]
 gi|218761168|gb|ACL03634.1| phosphoribosyltransferase [Desulfatibacillum alkenivorans AK-01]
          Length = 252

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 34/54 (62%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +R AF V +     V G  +LL+DDV+TTGATA   A AL KAGA  V +LT +
Sbjct: 197 IRGAFAVVR--PDLVRGKNVLLVDDVFTTGATANECAKALLKAGAKKVDVLTLA 248


>gi|332703113|ref|ZP_08423201.1| phosphoribosyltransferase [Desulfovibrio africanus str. Walvis Bay]
 gi|332553262|gb|EGJ50306.1| phosphoribosyltransferase [Desulfovibrio africanus str. Walvis Bay]
          Length = 280

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 20/43 (46%), Positives = 29/43 (67%)

Query: 14  HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
            V G ++LL+DD+ TTGAT +  A+ LK AGA  V +L  +R+
Sbjct: 238 QVEGRRVLLVDDIMTTGATIEQCALVLKAAGASVVDVLVLARA 280


>gi|196249411|ref|ZP_03148109.1| phosphoribosyltransferase [Geobacillus sp. G11MC16]
 gi|196211168|gb|EDY05929.1| phosphoribosyltransferase [Geobacillus sp. G11MC16]
          Length = 230

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 29/42 (69%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + G +I+LIDD+YTTG T + AA  L++AGA  V  LT  R+
Sbjct: 189 LTGKRIVLIDDIYTTGITVRHAARVLREAGATEVGSLTLVRA 230


>gi|138896708|ref|YP_001127161.1| competence protein F [Geobacillus thermodenitrificans NG80-2]
 gi|134268221|gb|ABO68416.1| Competence protein F [Geobacillus thermodenitrificans NG80-2]
          Length = 230

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 29/42 (69%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + G +I+LIDD+YTTG T + AA  L++AGA  V  LT  R+
Sbjct: 189 LTGKRIVLIDDIYTTGITVRHAARVLREAGATEVGSLTLVRA 230


>gi|291548499|emb|CBL21607.1| Predicted amidophosphoribosyltransferases [Ruminococcus sp.
          SR1/5]
          Length = 101

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 34/52 (65%), Gaps = 4/52 (7%)

Query: 1  MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
          ++NA+ V    ++ + G  +L++DDVYTTG+TA   A+ L +AGA  V  LT
Sbjct: 48 LKNAYQV----TEKIPGFSVLVVDDVYTTGSTADAMAMCLLEAGAEKVYFLT 95


>gi|239828349|ref|YP_002950973.1| late competence protein [Geobacillus sp. WCH70]
 gi|239808642|gb|ACS25707.1| late competence protein [Geobacillus sp. WCH70]
          Length = 235

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 21/37 (56%), Positives = 27/37 (72%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           I+LIDD+YTTG T + AA  L++AGA+ VS  T  RS
Sbjct: 199 IVLIDDIYTTGTTLRHAAKVLRQAGAIDVSSFTLVRS 235


>gi|299068083|emb|CBJ39297.1| putative amidophosphoribosyltransferase, comF/gntX family
           [Ralstonia solanacearum CMR15]
          Length = 200

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 24/49 (48%), Positives = 31/49 (63%), Gaps = 2/49 (4%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVS 49
           ++ AFNVP     H+AG  I ++DDV TTGAT    A  LK+AGA  V+
Sbjct: 146 LQGAFNVPD--PAHIAGRHIGVVDDVMTTGATLSEIATQLKRAGAARVT 192


>gi|153932646|ref|YP_001382575.1| comF protein-like protein [Clostridium botulinum A str. ATCC 19397]
 gi|153937133|ref|YP_001386128.1| comF protein-like protein [Clostridium botulinum A str. Hall]
 gi|168177503|ref|ZP_02612167.1| comF protein homolog [Clostridium botulinum NCTC 2916]
 gi|226947393|ref|YP_002802484.1| comF protein, homolog [Clostridium botulinum A2 str. Kyoto]
 gi|152928690|gb|ABS34190.1| comF protein, homolog [Clostridium botulinum A str. ATCC 19397]
 gi|152933047|gb|ABS38546.1| comF protein, homolog [Clostridium botulinum A str. Hall]
 gi|182671613|gb|EDT83587.1| comF protein homolog [Clostridium botulinum NCTC 2916]
 gi|226842576|gb|ACO85242.1| comF protein, homolog [Clostridium botulinum A2 str. Kyoto]
          Length = 225

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + N+F V  Y  K +   K+LLIDDV TTGAT+   A  LKK GA  + ILT ++S
Sbjct: 170 VENSFKV--YNEKCIKNKKVLLIDDVLTTGATSFYCANELKKRGAKEIFILTAAKS 223


>gi|90416989|ref|ZP_01224918.1| probable phosphoribosyl transferase [marine gamma proteobacterium
           HTCC2207]
 gi|90331336|gb|EAS46580.1| probable phosphoribosyl transferase [marine gamma proteobacterium
           HTCC2207]
          Length = 167

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 36/56 (64%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF      +K + GL + ++DDV TTGATA  AA AL +AGA  V I + +R+
Sbjct: 108 IKNAFIAE---AKDLKGLSVAIVDDVVTTGATANSAAKALLRAGAAQVDIWSIART 160


>gi|260599715|ref|YP_003212286.1| protein gntX [Cronobacter turicensis z3032]
 gi|260218892|emb|CBA34247.1| Protein gntX [Cronobacter turicensis z3032]
          Length = 251

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 25/57 (43%), Positives = 34/57 (59%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF V       VAGL I+++DDV TTG+T    A  LK+ GA TV +    R+L
Sbjct: 199 LKNAFRV----ELPVAGLHIVIVDDVVTTGSTVARIARLLKRNGAATVQVWCLCRTL 251


>gi|149182540|ref|ZP_01861012.1| late competence protein [Bacillus sp. SG-1]
 gi|148849732|gb|EDL63910.1| late competence protein [Bacillus sp. SG-1]
          Length = 237

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 27/36 (75%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ILLIDD+YTTG T + AA  LK+AGA  ++ LT +R
Sbjct: 201 ILLIDDIYTTGTTLRQAARILKEAGAKEITSLTLAR 236


>gi|322804439|emb|CBZ01989.1| comf operon protein C [Clostridium botulinum H04402 065]
          Length = 225

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + N+F V  Y  K +   K+LLIDDV TTGAT+   A  LKK GA  + ILT ++S
Sbjct: 170 VENSFKV--YNEKCIKNKKVLLIDDVLTTGATSFYCANELKKRGAKEIFILTAAKS 223


>gi|153940823|ref|YP_001389534.1| comF protein,-like protein [Clostridium botulinum F str. Langeland]
 gi|152936719|gb|ABS42217.1| ComF protein homolog [Clostridium botulinum F str. Langeland]
 gi|295317632|gb|ADF98009.1| ComF protein-like protein [Clostridium botulinum F str. 230613]
          Length = 225

 Score = 43.9 bits (102), Expect = 0.006,   Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + N+F V  Y  K +   K+LLIDDV TTGAT+   A  LKK GA  + ILT ++S
Sbjct: 170 VENSFKV--YNEKCIKNKKVLLIDDVLTTGATSFYCANELKKRGAKEIFILTAAKS 223


>gi|46201247|ref|ZP_00208026.1| COG1040: Predicted amidophosphoribosyltransferases
           [Magnetospirillum magnetotacticum MS-1]
          Length = 344

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 34/56 (60%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           AF V   +   + G +++LIDDV T+GAT    A  L KAGA+ V +LT  R +++
Sbjct: 288 AFRVDDRLRPRLDGRRVVLIDDVMTSGATVGECARVLLKAGAVCVDVLTLGRVVRE 343


>gi|170754829|ref|YP_001779798.1| comF protein,-like protein [Clostridium botulinum B1 str. Okra]
 gi|169120041|gb|ACA43877.1| comF protein, homolog [Clostridium botulinum B1 str. Okra]
          Length = 225

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + N+F V  Y  K +   K+LLIDDV TTGAT+   A  LKK GA  + ILT ++S
Sbjct: 170 VENSFKV--YNEKCIKNKKVLLIDDVLTTGATSFYCANELKKRGAKEIFILTAAKS 223


>gi|271502335|ref|YP_003335361.1| phosphoribosyltransferase [Dickeya dadantii Ech586]
 gi|270345890|gb|ACZ78655.1| phosphoribosyltransferase [Dickeya dadantii Ech586]
          Length = 239

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 1/58 (1%)

Query: 1   MRNAFNVPQ-YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF   Q  +S+ VAG +++L+DDV TTG+TA   +  L +AGA  V +    R+L
Sbjct: 181 LRGAFRCRQDAISQRVAGKRLVLLDDVVTTGSTAAEVSRTLLRAGAQHVQVWCVCRTL 238


>gi|167031407|ref|YP_001666638.1| phosphoribosyltransferase [Pseudomonas putida GB-1]
 gi|166857895|gb|ABY96302.1| phosphoribosyltransferase [Pseudomonas putida GB-1]
          Length = 243

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 35/59 (59%), Gaps = 6/59 (10%)

Query: 1   MRNAFNVP-QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF V  +   KHVA     ++DDV TTGATA+  A  L+KAGA  V +   +R+ K
Sbjct: 186 LRQAFAVTGKLTGKHVA-----VVDDVLTTGATAQAIAQVLRKAGARQVDVYCLARTPK 239


>gi|148378175|ref|YP_001252716.1| phosphoribosyl transferase [Clostridium botulinum A str. ATCC 3502]
 gi|148287659|emb|CAL81724.1| putative phosphoribosyl transferase [Clostridium botulinum A str.
           ATCC 3502]
          Length = 207

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + N+F V  Y  K +   K+LLIDDV TTGAT+   A  LKK GA  + ILT ++S
Sbjct: 152 VENSFKV--YNEKCIKNKKVLLIDDVLTTGATSFYCANELKKRGAKEIFILTAAKS 205


>gi|87119501|ref|ZP_01075398.1| competence protein F [Marinomonas sp. MED121]
 gi|86164977|gb|EAQ66245.1| competence protein F [Marinomonas sp. MED121]
          Length = 145

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 5/54 (9%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           N+F+ P  V KH+A     L DDV TTGAT       L++AGA+ + + + +R+
Sbjct: 86  NSFSCPSTVPKHIA-----LFDDVVTTGATLDACITKLQEAGAIEIDVWSLTRT 134


>gi|118588528|ref|ZP_01545937.1| phosphoribosyltransferase [Stappia aggregata IAM 12614]
 gi|118439234|gb|EAV45866.1| phosphoribosyltransferase [Stappia aggregata IAM 12614]
          Length = 253

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 33/55 (60%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +R+AF V    +  V G  ++LIDDV TTG+T       L  +GA +V +LTF++
Sbjct: 188 VRSAFKVDSARADLVQGRHVVLIDDVLTTGSTVSACCKCLLSSGAASVDVLTFAQ 242


>gi|157693946|ref|YP_001488408.1| competence protein FC [Bacillus pumilus SAFR-032]
 gi|157682704|gb|ABV63848.1| competence protein FC [Bacillus pumilus SAFR-032]
          Length = 228

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 27/37 (72%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           I+LIDD+YTTGAT   AA  LK+AGA +VS  T  RS
Sbjct: 192 IILIDDIYTTGATIYDAARILKEAGAKSVSSFTLIRS 228


>gi|196230002|ref|ZP_03128865.1| competence protein F, putative [Chthoniobacter flavus Ellin428]
 gi|196225599|gb|EDY20106.1| competence protein F, putative [Chthoniobacter flavus Ellin428]
          Length = 243

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 39/56 (69%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGAT-AKCAAIALKKAGAMTVSILTFSR 55
           +RNAF V    +  V    ++L+DDV+TTG+T A+CA + L++AGA +V ++T +R
Sbjct: 190 LRNAFRVRH--ASRVQSRHLILVDDVFTTGSTVAECARV-LRQAGAASVRVVTVAR 242


>gi|254429751|ref|ZP_05043458.1| hypothetical protein ADG881_2981 [Alcanivorax sp. DG881]
 gi|196195920|gb|EDX90879.1| hypothetical protein ADG881_2981 [Alcanivorax sp. DG881]
          Length = 248

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 20/43 (46%), Positives = 30/43 (69%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           V GL+++L+DDV TTG++A+ AA  L   GA  V + T +R+L
Sbjct: 201 VTGLRLILVDDVMTTGSSARAAAQCLLDHGAKDVRVWTLARTL 243


>gi|307942660|ref|ZP_07658008.1| competence protein F [Roseibium sp. TrichSKD4]
 gi|307774299|gb|EFO33512.1| competence protein F [Roseibium sp. TrichSKD4]
          Length = 56

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 28/40 (70%)

Query: 15 VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
          V G +++LIDDV+TTG+T       L KAGAM V +LTF+
Sbjct: 9  VVGRQVVLIDDVFTTGSTVDACTKVLLKAGAMQVDVLTFA 48


>gi|89067454|ref|ZP_01154967.1| Competence protein F [Oceanicola granulosus HTCC2516]
 gi|89047023|gb|EAR53077.1| Competence protein F [Oceanicola granulosus HTCC2516]
          Length = 237

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 21/43 (48%), Positives = 30/43 (69%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           G  +LL+DDV T+GAT   +  AL+ AGA  V +LT +R++KD
Sbjct: 194 GGAVLLVDDVMTSGATLAASTEALRAAGAGRVCVLTLARAVKD 236


>gi|148266135|ref|YP_001232841.1| amidophosphoribosyltransferase-like protein [Geobacter
           uraniireducens Rf4]
 gi|146399635|gb|ABQ28268.1| amidophosphoribosyltransferase-like protein [Geobacter
           uraniireducens Rf4]
          Length = 238

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +R AF V       VAG +++L+DDVYTTG+T    A  LK AGA  V ++T +R
Sbjct: 184 VRGAFAVTD--KDAVAGKRVILVDDVYTTGSTVAECAKTLKCAGAEAVFVVTAAR 236


>gi|319891753|ref|YP_004148628.1| ComF operon protein C [Staphylococcus pseudintermedius HKU10-03]
 gi|317161449|gb|ADV04992.1| ComF operon protein C [Staphylococcus pseudintermedius HKU10-03]
 gi|323465078|gb|ADX77231.1| competence protein F, putative [Staphylococcus pseudintermedius
           ED99]
          Length = 222

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 2   RNAFNVPQYVSKHVA--GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           R A + P Y    ++     ILLIDD+YTTG TA CA   L +     +S+LTF+R
Sbjct: 167 RYAVDNPIYFDSDISLENKSILLIDDIYTTGHTAHCAGNVLLQQKVRKLSMLTFAR 222


>gi|331001977|ref|ZP_08325497.1| hypothetical protein HMPREF0491_00359 [Lachnospiraceae oral taxon
           107 str. F0167]
 gi|330411773|gb|EGG91178.1| hypothetical protein HMPREF0491_00359 [Lachnospiraceae oral taxon
           107 str. F0167]
          Length = 155

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 33/55 (60%), Gaps = 9/55 (16%)

Query: 1   MRNAF---NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
           + NAF   ++P Y+        +L++DDVYTTG T +  AIALKKAG   +  LT
Sbjct: 99  LDNAFVAKDIPVYIKN------VLIVDDVYTTGTTIEKCAIALKKAGVKNIYFLT 147


>gi|260655347|ref|ZP_05860835.1| ComF family protein [Jonquetella anthropi E3_33 E1]
 gi|260629795|gb|EEX47989.1| ComF family protein [Jonquetella anthropi E3_33 E1]
          Length = 217

 Score = 43.5 bits (101), Expect = 0.008,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 32/58 (55%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           R A N   + +        +LIDDV TTG T + AA  L  AGA  V+ L++SR+L D
Sbjct: 160 RLAMNPKSFAAADCEAKDFILIDDVTTTGTTLRLAAKTLYAAGARRVACLSWSRALSD 217


>gi|85374003|ref|YP_458065.1| amidophosphoribosyltransferase [Erythrobacter litoralis HTCC2594]
 gi|84787086|gb|ABC63268.1| amidophosphoribosyltransferase [Erythrobacter litoralis HTCC2594]
          Length = 263

 Score = 43.5 bits (101), Expect = 0.008,   Method: Composition-based stats.
 Identities = 21/47 (44%), Positives = 32/47 (68%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           + +AG  +LL+DDV T+GAT++     L KAGA +V I +F+R L +
Sbjct: 200 QKIAGRDVLLVDDVVTSGATSERCTRVLLKAGAKSVRIASFTRVLSE 246


>gi|325830868|ref|ZP_08164252.1| comF family protein [Eggerthella sp. HGA1]
 gi|325487275|gb|EGC89718.1| comF family protein [Eggerthella sp. HGA1]
          Length = 274

 Score = 43.5 bits (101), Expect = 0.008,   Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 27/36 (75%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++L+DDVYTTGAT   A  A++ AGA TV  LTF+R
Sbjct: 237 VILVDDVYTTGATLFAATDAVRVAGAATVRCLTFAR 272


>gi|257790964|ref|YP_003181570.1| hypothetical protein Elen_1211 [Eggerthella lenta DSM 2243]
 gi|257474861|gb|ACV55181.1| conserved hypothetical protein [Eggerthella lenta DSM 2243]
          Length = 274

 Score = 43.5 bits (101), Expect = 0.008,   Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 27/36 (75%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++L+DDVYTTGAT   A  A++ AGA TV  LTF+R
Sbjct: 237 VILVDDVYTTGATLFAATDAVRVAGAATVRCLTFAR 272


>gi|304394136|ref|ZP_07376059.1| competence protein F [Ahrensia sp. R2A130]
 gi|303293576|gb|EFL87953.1| competence protein F [Ahrensia sp. R2A130]
          Length = 273

 Score = 43.5 bits (101), Expect = 0.008,   Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 38/55 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +R AF +P+  S  + G  ++L+DDVYTTGAT K  A A+++AGA  V  LTF+R
Sbjct: 209 VRGAFRIPKGESVLLKGRHVVLVDDVYTTGATLKACARAVRRAGAAKVDCLTFAR 263


>gi|56964847|ref|YP_176578.1| late competence protein ComFC [Bacillus clausii KSM-K16]
 gi|56911090|dbj|BAD65617.1| late competence protein ComFC [Bacillus clausii KSM-K16]
          Length = 234

 Score = 43.5 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 33/55 (60%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +N F V    +  +AG   L++DD+YTTG T + AA  L   GA +VS LT +R+
Sbjct: 179 KNPFCVLSRKTSDIAGKDFLVVDDIYTTGTTVRQAAAILLAHGAKSVSSLTVARA 233


>gi|260576133|ref|ZP_05844126.1| competence protein F, putative [Rhodobacter sp. SW2]
 gi|259021613|gb|EEW24916.1| competence protein F, putative [Rhodobacter sp. SW2]
          Length = 240

 Score = 43.5 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 31/56 (55%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           AF V       +AG ++LL+DDV T+GAT      A   AGA  VS+L  +R  KD
Sbjct: 184 AFRVNPARDWQIAGRRVLLVDDVMTSGATLAACTEACLAAGATEVSVLALARVAKD 239


>gi|5921548|emb|CAB56477.1| competence protein ComF [Pseudomonas stutzeri]
          Length = 235

 Score = 43.5 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF + +    H  G  + +IDDV+TTGATA+  A  LK+AGA  V I   +R+ K
Sbjct: 177 LRQAFALAEGQVLH--GQHLAVIDDVFTTGATAEALARLLKRAGAARVDIYCLARTPK 232


>gi|186680803|ref|YP_001863999.1| hypothetical protein Npun_F0271 [Nostoc punctiforme PCC 73102]
 gi|186463255|gb|ACC79056.1| conserved hypothetical protein [Nostoc punctiforme PCC 73102]
          Length = 225

 Score = 43.5 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 34/59 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF V Q        + +LL+DD+YTTGATA+ A   L+  G + + ++  + ++KD
Sbjct: 166 LAQAFAVGQEFRDRPPNVPVLLVDDIYTTGATARSAVQTLRHYGIVVLGLVAVATAVKD 224


>gi|4768852|gb|AAD29646.1|AF124757_6 competence protein F [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 258

 Score = 43.5 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 20/41 (48%), Positives = 29/41 (70%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +AG  I+ IDDV+T+GAT +  A  LKKAG  +V +L ++R
Sbjct: 210 LAGRDIIFIDDVFTSGATTESCARLLKKAGVKSVHVLCWAR 250


>gi|296444589|ref|ZP_06886553.1| phosphoribosyltransferase [Methylosinus trichosporium OB3b]
 gi|296257857|gb|EFH04920.1| phosphoribosyltransferase [Methylosinus trichosporium OB3b]
          Length = 262

 Score = 43.5 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 32/55 (58%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           M+ AF +    +  V G  I+L+DDV TTGAT   AA  L +AGA  V +L  +R
Sbjct: 203 MQGAFRLKPERAAAVHGRNIVLVDDVLTTGATVNAAARVLLRAGAARVDVLVLAR 257


>gi|288554154|ref|YP_003426089.1| ComF operon protein 3 [Bacillus pseudofirmus OF4]
 gi|288545314|gb|ADC49197.1| comF operon protein 3 [Bacillus pseudofirmus OF4]
          Length = 235

 Score = 43.5 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 26/37 (70%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           KI+L+DDVYTTG T + AA  L+K GA  +  LT +R
Sbjct: 199 KIVLVDDVYTTGTTVRQAAYVLRKHGAEHIESLTLAR 235


>gi|194015240|ref|ZP_03053856.1| ComF operon protein 3 [Bacillus pumilus ATCC 7061]
 gi|194012644|gb|EDW22210.1| ComF operon protein 3 [Bacillus pumilus ATCC 7061]
          Length = 228

 Score = 43.5 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 22/38 (57%), Positives = 28/38 (73%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +++LIDD+YTTGAT   AA  LK+AGA +VS  T  RS
Sbjct: 191 EVILIDDIYTTGATIYDAARILKEAGAKSVSSFTLIRS 228


>gi|28377597|ref|NP_784489.1| late competence protein [Lactobacillus plantarum WCFS1]
 gi|254555776|ref|YP_003062193.1| late competence protein [Lactobacillus plantarum JDM1]
 gi|308179751|ref|YP_003923879.1| late competence protein [Lactobacillus plantarum subsp. plantarum
           ST-III]
 gi|28270430|emb|CAD63332.1| late competence protein [Lactobacillus plantarum WCFS1]
 gi|254044703|gb|ACT61496.1| late competence protein [Lactobacillus plantarum JDM1]
 gi|308045242|gb|ADN97785.1| late competence protein [Lactobacillus plantarum subsp. plantarum
           ST-III]
          Length = 224

 Score = 43.5 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 20/41 (48%), Positives = 30/41 (73%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +AG ++LL+DD+YTTG T + AA  L + GA +V+ LT +R
Sbjct: 184 LAGRRVLLVDDIYTTGRTMRHAATLLLENGAKSVTGLTLAR 224


>gi|320352701|ref|YP_004194040.1| phosphoribosyltransferase [Desulfobulbus propionicus DSM 2032]
 gi|320121203|gb|ADW16749.1| phosphoribosyltransferase [Desulfobulbus propionicus DSM 2032]
          Length = 239

 Score = 43.1 bits (100), Expect = 0.011,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 35/57 (61%), Gaps = 2/57 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +++AF +    S  V G ++LLIDDV+TTG+T    +  L+  GA  + + T +RSL
Sbjct: 183 LKDAFILSMPAS--VQGKRVLLIDDVFTTGSTVNECSKVLRAGGATRIEVFTLARSL 237


>gi|149204345|ref|ZP_01881312.1| competence protein F, putative [Roseovarius sp. TM1035]
 gi|149142230|gb|EDM30277.1| competence protein F, putative [Roseovarius sp. TM1035]
          Length = 232

 Score = 43.1 bits (100), Expect = 0.011,   Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 31/45 (68%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +AG  +L++DDV T+GAT   A  A   AG+  VS++T +R++KD
Sbjct: 187 IAGRSVLIVDDVMTSGATLSVATQACFSAGSGEVSVVTLARAVKD 231


>gi|255527900|ref|ZP_05394744.1| conserved hypothetical protein [Clostridium carboxidivorans P7]
 gi|255508400|gb|EET84796.1| conserved hypothetical protein [Clostridium carboxidivorans P7]
          Length = 226

 Score = 43.1 bits (100), Expect = 0.011,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 36/56 (64%), Gaps = 1/56 (1%)

Query: 2   RNAFNVPQYVSKH-VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           RN     Q++ K+ +    IL++DDV TTGATA   A+ LKK GA  +++LT ++S
Sbjct: 169 RNIEGSFQFLKKYCIESKNILIVDDVITTGATAISCALELKKHGAEEITVLTAAKS 224


>gi|299821877|ref|ZP_07053765.1| competence protein F [Listeria grayi DSM 20601]
 gi|299817542|gb|EFI84778.1| competence protein F [Listeria grayi DSM 20601]
          Length = 222

 Score = 43.1 bits (100), Expect = 0.011,   Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 26/41 (63%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           + G  ILL+DDVYTTGAT  CAA  L + GA  +  +T  R
Sbjct: 182 IDGKTILLVDDVYTTGATLHCAAELLHEHGAKQIEAITIFR 222


>gi|94971228|ref|YP_593276.1| phosphoribosyltransferase [Candidatus Koribacter versatilis
           Ellin345]
 gi|94553278|gb|ABF43202.1| phosphoribosyltransferase [Candidatus Koribacter versatilis
           Ellin345]
          Length = 213

 Score = 43.1 bits (100), Expect = 0.011,   Method: Composition-based stats.
 Identities = 25/57 (43%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +  AF VP      V G  ++L+DDV TTGATA   A  LK+AGA  V + T +R++
Sbjct: 136 LHGAFKVPD--KALVKGRNVILVDDVLTTGATADECARILKRAGAEQVLVATVARAV 190


>gi|290969085|ref|ZP_06560618.1| ComF family protein [Megasphaera genomosp. type_1 str. 28L]
 gi|290780882|gb|EFD93477.1| ComF family protein [Megasphaera genomosp. type_1 str. 28L]
          Length = 220

 Score = 43.1 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 32/54 (59%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++NAF +    +  V G  I+++DD+YTTGAT    A  LKK GA  ++ L  +
Sbjct: 163 IKNAFAIKGNCASMVKGRHIIVVDDIYTTGATLDGCARVLKKHGAAMITGLVMA 216


>gi|89900468|ref|YP_522939.1| ComF family protein [Rhodoferax ferrireducens T118]
 gi|89345205|gb|ABD69408.1| ComF family protein [Rhodoferax ferrireducens T118]
          Length = 230

 Score = 43.1 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 36/56 (64%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +++AF V   +   + G +++L+DDV T+GA+  CAA  L+ AGA  ++ L  +R+
Sbjct: 174 LKDAFAVDPLLVAQLKGARVVLVDDVMTSGASLFCAARTLRAAGAAHITGLVIART 229


>gi|121603784|ref|YP_981113.1| hypothetical protein Pnap_0875 [Polaromonas naphthalenivorans CJ2]
 gi|120592753|gb|ABM36192.1| conserved hypothetical protein [Polaromonas naphthalenivorans CJ2]
          Length = 255

 Score = 43.1 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF V    +  + G +++L+DDV T+GA+   AA AL+ AGA  ++ +  +R+
Sbjct: 197 VRGAFQVDPLRAPQLQGRRVVLVDDVMTSGASLFAAAQALRDAGAARITAVVLART 252


>gi|212640411|ref|YP_002316931.1| competence protein FC [Anoxybacillus flavithermus WK1]
 gi|212561891|gb|ACJ34946.1| Competence protein FC [Anoxybacillus flavithermus WK1]
          Length = 222

 Score = 43.1 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 27/42 (64%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           VAG +I+++DD+YTTGAT   AA  L  AGA  +   T  RS
Sbjct: 181 VAGKRIVIVDDIYTTGATVHEAAKLLHDAGAQEICSFTLVRS 222


>gi|331090560|ref|ZP_08339412.1| hypothetical protein HMPREF9477_00055 [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330403124|gb|EGG82686.1| hypothetical protein HMPREF9477_00055 [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 231

 Score = 43.1 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 33/54 (61%), Gaps = 4/54 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++NAF V + + +      +L+IDD+YTTG+T    ++ LKK+GA     LT S
Sbjct: 177 LKNAFEVTRKIKEK----NVLIIDDIYTTGSTIHSISVLLKKSGAEKTYFLTIS 226


>gi|239905752|ref|YP_002952491.1| competence protein F [Desulfovibrio magneticus RS-1]
 gi|239795616|dbj|BAH74605.1| competence protein F [Desulfovibrio magneticus RS-1]
          Length = 249

 Score = 43.1 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 20/31 (64%), Positives = 25/31 (80%)

Query: 14  HVAGLKILLIDDVYTTGATAKCAAIALKKAG 44
            VAG ++LLIDDV TTGAT + AA AL++AG
Sbjct: 208 QVAGRRVLLIDDVMTTGATVETAAQALRRAG 238


>gi|221065311|ref|ZP_03541416.1| ComF family protein [Comamonas testosteroni KF-1]
 gi|220710334|gb|EED65702.1| ComF family protein [Comamonas testosteroni KF-1]
          Length = 254

 Score = 43.1 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +RN F++       + G  ILL+DDV TTGAT    A  L  AGA +VS +  +R+
Sbjct: 198 LRNVFSLDPARKALIEGQAILLLDDVMTTGATLDALARCLLSAGAASVSAVVLART 253


>gi|315923979|ref|ZP_07920207.1| competence protein F [Pseudoramibacter alactolyticus ATCC 23263]
 gi|315622819|gb|EFV02772.1| competence protein F [Pseudoramibacter alactolyticus ATCC 23263]
          Length = 248

 Score = 43.1 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 29/40 (72%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
           + +AG +++L+DDV TTGAT +  A ALK +GA  V +LT
Sbjct: 204 QRIAGKRLVLVDDVMTTGATLRACASALKASGAAAVYVLT 243


>gi|220904997|ref|YP_002480309.1| ComF family protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|219869296|gb|ACL49631.1| ComF family protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 299

 Score = 43.1 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 23/48 (47%), Positives = 30/48 (62%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           S  V G  + L+DDV TTG+T + A  AL+ AGA  V IL  +R+ KD
Sbjct: 240 SPEVKGRCLWLVDDVMTTGSTLRAACRALRHAGAARVYILVAARTPKD 287


>gi|296111496|ref|YP_003621878.1| late competence protein [Leuconostoc kimchii IMSNU 11154]
 gi|295833028|gb|ADG40909.1| late competence protein [Leuconostoc kimchii IMSNU 11154]
          Length = 223

 Score = 43.1 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 26/51 (50%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           F V ++VS H  G +ILLIDDVYTTG T   AA  L + GA  V  L+ +R
Sbjct: 175 FTVKEHVSLH--GKQILLIDDVYTTGNTLFHAADLLYELGAKNVKSLSLAR 223


>gi|325271487|ref|ZP_08138005.1| competence protein ComF, putative [Pseudomonas sp. TJI-51]
 gi|324103377|gb|EGC00706.1| competence protein ComF, putative [Pseudomonas sp. TJI-51]
          Length = 243

 Score = 43.1 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 34/59 (57%), Gaps = 6/59 (10%)

Query: 1   MRNAFNVP-QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF V      KHVA     ++DDV TTGATA+  A  L+KAGA  V +   +R+ K
Sbjct: 186 LRQAFAVAGDLPGKHVA-----IVDDVLTTGATAQAIAQVLRKAGAQRVDVYCLARTPK 239


>gi|297569953|ref|YP_003691297.1| phosphoribosyltransferase [Desulfurivibrio alkaliphilus AHT2]
 gi|296925868|gb|ADH86678.1| phosphoribosyltransferase [Desulfurivibrio alkaliphilus AHT2]
          Length = 255

 Score = 43.1 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++ AF  PQ     V    +LL+DDV+TTGAT    A  L++AGA  V + T +R
Sbjct: 200 LKGAFVAPQ--PAMVRKRSLLLVDDVFTTGATVNECAKVLRQAGAARVDVFTLAR 252


>gi|255065466|ref|ZP_05317321.1| ComF/gntX family protein [Neisseria sicca ATCC 29256]
 gi|255050291|gb|EET45755.1| ComF/gntX family protein [Neisseria sicca ATCC 29256]
          Length = 268

 Score = 43.1 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 35/55 (63%), Gaps = 3/55 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++NAF +  ++SK+     ILLIDDV+TTG+T    A  LKK+GA  +   + +R
Sbjct: 194 IKNAFEINGHISKNC---NILLIDDVFTTGSTLNELAQTLKKSGAGKIFCWSLAR 245


>gi|258406303|ref|YP_003199045.1| competence protein F [Desulfohalobium retbaense DSM 5692]
 gi|257798530|gb|ACV69467.1| competence protein F [Desulfohalobium retbaense DSM 5692]
          Length = 256

 Score = 43.1 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           MR+AF V   +S H     +LL+DDV+TTGAT    A  L +AG   + +LT +R+
Sbjct: 202 MRDAFAVFGEISWHER--NVLLVDDVFTTGATLSACARRLCEAGVARLGVLTMARA 255


>gi|254422125|ref|ZP_05035843.1| hypothetical protein S7335_2275 [Synechococcus sp. PCC 7335]
 gi|196189614|gb|EDX84578.1| hypothetical protein S7335_2275 [Synechococcus sp. PCC 7335]
          Length = 239

 Score = 42.7 bits (99), Expect = 0.014,   Method: Composition-based stats.
 Identities = 23/63 (36%), Positives = 39/63 (61%), Gaps = 4/63 (6%)

Query: 1   MRNAFNVPQYVSKHVAGL----KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +++AF V Q + +    L     ILL+DD+YTTG TAK AA +L+++    V ++  +R+
Sbjct: 177 LKDAFQVGQPLRRLGQRLGAMPNILLVDDIYTTGTTAKSAADSLRRSHVPVVGMIAVARA 236

Query: 57  LKD 59
           + D
Sbjct: 237 VGD 239


>gi|77920166|ref|YP_357981.1| amidophosphoribosyltransferase [Pelobacter carbinolicus DSM 2380]
 gi|77546249|gb|ABA89811.1| predicted amidophosphoribosyltransferase [Pelobacter carbinolicus
           DSM 2380]
          Length = 247

 Score = 42.7 bits (99), Expect = 0.015,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 32/46 (69%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +++ +AG ++LL+DDV TTGATA+  A  L   GA +V++   +R+
Sbjct: 196 LTQKLAGQRVLLVDDVLTTGATARECAATLLAGGASSVAVAVLARA 241


>gi|255994736|ref|ZP_05427871.1| putative competence protein F [Eubacterium saphenum ATCC 49989]
 gi|255993449|gb|EEU03538.1| putative competence protein F [Eubacterium saphenum ATCC 49989]
          Length = 254

 Score = 42.7 bits (99), Expect = 0.015,   Method: Composition-based stats.
 Identities = 23/40 (57%), Positives = 26/40 (65%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           V G  +LLIDDVYTTGATA   A  LK AGA+ V    F+
Sbjct: 212 VRGKTVLLIDDVYTTGATADECAKVLKSAGAIKVCFAGFA 251


>gi|156936424|ref|YP_001440340.1| hypothetical protein ESA_04325 [Cronobacter sakazakii ATCC BAA-894]
 gi|156534678|gb|ABU79504.1| hypothetical protein ESA_04325 [Cronobacter sakazakii ATCC BAA-894]
          Length = 186

 Score = 42.7 bits (99), Expect = 0.015,   Method: Composition-based stats.
 Identities = 25/57 (43%), Positives = 34/57 (59%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF V       VAGL I+++DDV TTG+T    A  LK+ GA TV +    R+L
Sbjct: 134 LKNAFRV----ELPVAGLHIVIVDDVVTTGSTVAQIARLLKRNGAATVQVWCLCRTL 186


>gi|260752407|ref|YP_003225300.1| phosphoribosyltransferase [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|258551770|gb|ACV74716.1| phosphoribosyltransferase [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 281

 Score = 42.7 bits (99), Expect = 0.015,   Method: Composition-based stats.
 Identities = 20/41 (48%), Positives = 29/41 (70%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +AG  I+LIDDV+T+GAT +  A  LK AG  +V +L ++R
Sbjct: 233 LAGRDIILIDDVFTSGATTESCARLLKTAGVKSVHVLCWAR 273


>gi|241762015|ref|ZP_04760099.1| amidophosphoribosyltransferase [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|241373481|gb|EER63068.1| amidophosphoribosyltransferase [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
          Length = 281

 Score = 42.7 bits (99), Expect = 0.015,   Method: Composition-based stats.
 Identities = 20/41 (48%), Positives = 29/41 (70%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +AG  I+LIDDV+T+GAT +  A  LK AG  +V +L ++R
Sbjct: 233 LAGRDIILIDDVFTSGATTESCARLLKTAGVKSVHVLCWAR 273


>gi|300767559|ref|ZP_07077469.1| late competence protein [Lactobacillus plantarum subsp. plantarum
           ATCC 14917]
 gi|300494544|gb|EFK29702.1| late competence protein [Lactobacillus plantarum subsp. plantarum
           ATCC 14917]
          Length = 147

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 30/41 (73%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +AG ++LL+DD+YTTG T + AA  L + GA +V+ LT +R
Sbjct: 107 LAGRRVLLVDDIYTTGRTMRHAATLLLENGAKSVTGLTLAR 147


>gi|329944319|ref|ZP_08292578.1| phosphoribosyl transferase domain protein [Actinomyces sp. oral
           taxon 170 str. F0386]
 gi|328531049|gb|EGF57905.1| phosphoribosyl transferase domain protein [Actinomyces sp. oral
           taxon 170 str. F0386]
          Length = 285

 Score = 42.7 bits (99), Expect = 0.016,   Method: Composition-based stats.
 Identities = 23/40 (57%), Positives = 26/40 (65%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           VAGL +LLIDDV TTGAT    A AL+ AG   +  LT S
Sbjct: 212 VAGLPVLLIDDVVTTGATLGACARALETAGGRVLGALTLS 251


>gi|134096080|ref|YP_001101155.1| amidophosphoribosyltransferase [Herminiimonas arsenicoxydans]
 gi|133739983|emb|CAL63034.1| Putative amidophosphoribosyltransferase [Herminiimonas
           arsenicoxydans]
          Length = 247

 Score = 42.7 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 33/56 (58%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           MR+AF +P      V G  + ++DDV TTG T    A  LK+ GA+ V+ L F+R+
Sbjct: 189 MRHAFVLPANADVLVRGRHVGVVDDVMTTGVTLNEIAATLKRHGAVRVTNLVFART 244


>gi|154252188|ref|YP_001413012.1| phosphoribosyltransferase [Parvibaculum lavamentivorans DS-1]
 gi|154156138|gb|ABS63355.1| phosphoribosyltransferase [Parvibaculum lavamentivorans DS-1]
          Length = 258

 Score = 42.7 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 32/52 (61%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           AF +   V+  V   +I+LIDDV TTGATA+  A  L  AGA  VS+L  +R
Sbjct: 198 AFRLAPGVAPLVKDRRIVLIDDVMTTGATAEACARVLTGAGAREVSVLCLAR 249


>gi|153813177|ref|ZP_01965845.1| hypothetical protein RUMOBE_03593 [Ruminococcus obeum ATCC 29174]
 gi|149830708|gb|EDM85799.1| hypothetical protein RUMOBE_03593 [Ruminococcus obeum ATCC 29174]
          Length = 188

 Score = 42.7 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 4/53 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           +RNAF      +  V GL+IL++DDVYTTG+T +  A  L + GA  V  +T 
Sbjct: 135 LRNAFQA----AGPVTGLRILVVDDVYTTGSTVEAMAECLLENGAKAVFFVTL 183


>gi|288575565|ref|ZP_05977205.2| ComF/gntX family protein [Neisseria mucosa ATCC 25996]
 gi|288567578|gb|EFC89138.1| ComF/gntX family protein [Neisseria mucosa ATCC 25996]
          Length = 250

 Score = 42.7 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 35/55 (63%), Gaps = 3/55 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++NAF +  ++SK+     ILLIDDV+TTG+T    A  LKK+GA  +   + +R
Sbjct: 194 IKNAFEINGHISKNC---NILLIDDVFTTGSTLDELARTLKKSGAGKIFCWSLAR 245


>gi|296284059|ref|ZP_06862057.1| amidophosphoribosyltransferase [Citromicrobium bathyomarinum JL354]
          Length = 161

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +R A  V     + + G  ++L+DDV T+GAT+     AL +AGA +V I  F+R
Sbjct: 91  LRGAIRVRPRCREDIEGRHVILVDDVLTSGATSTACTAALLEAGAKSVRIACFAR 145


>gi|168185945|ref|ZP_02620580.1| competence protein F [Clostridium botulinum C str. Eklund]
 gi|169296003|gb|EDS78136.1| competence protein F [Clostridium botulinum C str. Eklund]
          Length = 226

 Score = 42.7 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 23/38 (60%), Positives = 28/38 (73%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           K+LL+DDV TTGATA   A  LKK+GA  V ILT ++S
Sbjct: 187 KVLLVDDVLTTGATAFYCAKKLKKSGANDVVILTVAKS 224


>gi|327482505|gb|AEA85815.1| phosphoribosyl transferase [Pseudomonas stutzeri DSM 4166]
          Length = 234

 Score = 42.7 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +       V G  + L+DDV TTGATA+  A  LK+AGA  V +   +R+ K
Sbjct: 176 LRQAFAIA--TGADVKGRHLALVDDVLTTGATAEALARLLKRAGAERVDVYCLARTPK 231


>gi|325111311|ref|YP_004272379.1| phosphoribosyltransferase [Planctomyces brasiliensis DSM 5305]
 gi|324971579|gb|ADY62357.1| phosphoribosyltransferase [Planctomyces brasiliensis DSM 5305]
          Length = 254

 Score = 42.7 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 37/58 (63%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R A++V  + +  + G ++LL+DD+ TTG+TA+    AL +AGA  V +   +R LK
Sbjct: 197 VRGAYSV--HRATGLQGARVLLVDDILTTGSTAQVCTRALLEAGAAEVFVAVLARGLK 252


>gi|307243841|ref|ZP_07525970.1| ComF family protein [Peptostreptococcus stomatis DSM 17678]
 gi|306492779|gb|EFM64803.1| ComF family protein [Peptostreptococcus stomatis DSM 17678]
          Length = 256

 Score = 42.7 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 22/53 (41%), Positives = 32/53 (60%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           ++N+F + + +   +    ILL+DDV+TTG+T    A  LK AGA  V  LTF
Sbjct: 193 LKNSFLIKEEMKDLIVNKNILLVDDVFTTGSTVDEMAKVLKLAGAQEVVSLTF 245


>gi|146284179|ref|YP_001174332.1| phosphoribosyl transferase [Pseudomonas stutzeri A1501]
 gi|145572384|gb|ABP81490.1| probable phosphoribosyl transferase [Pseudomonas stutzeri A1501]
          Length = 234

 Score = 42.7 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +       V G  + L+DDV TTGATA+  A  LK+AGA  V +   +R+ K
Sbjct: 176 LRQAFAIA--TGADVKGRHLALVDDVLTTGATAEALARLLKRAGAERVDVYCLARTPK 231


>gi|291549967|emb|CBL26229.1| Predicted amidophosphoribosyltransferases [Ruminococcus torques
           L2-14]
          Length = 224

 Score = 42.7 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 22/35 (62%), Positives = 25/35 (71%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ILLIDD+YTTG+T + AA  LKKAG   V  LT S
Sbjct: 185 ILLIDDIYTTGSTIERAAGILKKAGVENVYFLTLS 219


>gi|110639861|ref|YP_680071.1| amidophosphoribosyltransferase [Cytophaga hutchinsonii ATCC 33406]
 gi|110282542|gb|ABG60728.1| amidophosphoribosyltransferase [Cytophaga hutchinsonii ATCC 33406]
          Length = 236

 Score = 42.4 bits (98), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 23/42 (54%), Positives = 29/42 (69%), Gaps = 1/42 (2%)

Query: 9   QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
           Q++ K VAG  ILL+DDV TTGAT +   + LK AGA  VS+
Sbjct: 188 QHIEK-VAGKHILLVDDVLTTGATLEACGLLLKNAGAAKVSV 228


>gi|225568551|ref|ZP_03777576.1| hypothetical protein CLOHYLEM_04628 [Clostridium hylemonae DSM
           15053]
 gi|225162779|gb|EEG75398.1| hypothetical protein CLOHYLEM_04628 [Clostridium hylemonae DSM
           15053]
          Length = 235

 Score = 42.4 bits (98), Expect = 0.019,   Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 31/54 (57%), Gaps = 3/54 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +R AF V ++     +   +LLIDD+YTTG T   AA  LKKAG   V  LT S
Sbjct: 180 VRGAFAVTEHFRPVPS---VLLIDDIYTTGNTVDAAAEILKKAGVENVCFLTIS 230


>gi|22298879|ref|NP_682126.1| hypothetical protein tlr1336 [Thermosynechococcus elongatus BP-1]
 gi|22295060|dbj|BAC08888.1| tlr1336 [Thermosynechococcus elongatus BP-1]
          Length = 237

 Score = 42.4 bits (98), Expect = 0.019,   Method: Composition-based stats.
 Identities = 19/40 (47%), Positives = 27/40 (67%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +LL DD+YTTG TA+ AA  L+ AG   + I+T + +L D
Sbjct: 176 LLLCDDIYTTGTTARSAATVLRNAGYKVLGIITVAVALPD 215


>gi|299140246|ref|ZP_07033412.1| phosphoribosyltransferase [Acidobacterium sp. MP5ACTX8]
 gi|298597785|gb|EFI53957.1| phosphoribosyltransferase [Acidobacterium sp. MP5ACTX8]
          Length = 359

 Score = 42.4 bits (98), Expect = 0.020,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF V +  +  + G ++LL+DD+ TTGATA+  A  L +AGA  V + T +R+
Sbjct: 276 LRGAFRVER--ADEIRGREVLLVDDILTTGATARECARVLMRAGASKVWVATVARA 329


>gi|260220118|emb|CBA27337.1| hypothetical protein Csp_A01770 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 253

 Score = 42.4 bits (98), Expect = 0.020,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 35/56 (62%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R+AF +       V+  +I+L+DDV T+GA+   AA  L+ AGA  ++ L F+R+
Sbjct: 191 VRHAFAMEPLRQGAVSDKRIVLLDDVMTSGASMSAAATTLRHAGAAHITALVFART 246


>gi|170760534|ref|YP_001785499.1| comF protein,-like protein [Clostridium botulinum A3 str. Loch
           Maree]
 gi|169407523|gb|ACA55934.1| comF protein, homolog [Clostridium botulinum A3 str. Loch Maree]
          Length = 225

 Score = 42.4 bits (98), Expect = 0.021,   Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + ++F V  Y  K +   K+LLIDDV TTGAT+   A  LKK GA  + ILT ++S
Sbjct: 170 VEDSFKV--YNEKCIKNKKVLLIDDVLTTGATSFYCANELKKRGAKEIFILTAAKS 223


>gi|94264829|ref|ZP_01288605.1| competence protein F-like protein [delta proteobacterium MLMS-1]
 gi|93454710|gb|EAT04971.1| competence protein F-like protein [delta proteobacterium MLMS-1]
          Length = 251

 Score = 42.4 bits (98), Expect = 0.021,   Method: Composition-based stats.
 Identities = 22/52 (42%), Positives = 31/52 (59%), Gaps = 4/52 (7%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           A + P  V +     ++LL+DDV+TTG+T    A  LK AGA  V +LT +R
Sbjct: 201 ALSQPHLVKRR----RVLLVDDVFTTGSTVNECAGVLKAAGAAEVQVLTLAR 248


>gi|168182220|ref|ZP_02616884.1| protein ComF homolog [Clostridium botulinum Bf]
 gi|237793489|ref|YP_002861041.1| putative ComF protein [Clostridium botulinum Ba4 str. 657]
 gi|182674670|gb|EDT86631.1| protein ComF homolog [Clostridium botulinum Bf]
 gi|229262460|gb|ACQ53493.1| putative ComF protein [Clostridium botulinum Ba4 str. 657]
          Length = 225

 Score = 42.4 bits (98), Expect = 0.021,   Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + ++F V  Y  K +   K+LLIDDV TTGAT+   A  LKK GA  + ILT ++S
Sbjct: 170 VEDSFKV--YNEKCIKNKKVLLIDDVLTTGATSFYCANELKKRGAKEIFILTAAKS 223


>gi|294667204|ref|ZP_06732425.1| competence protein [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
 gi|292602985|gb|EFF46415.1| competence protein [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
          Length = 241

 Score = 42.4 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 31/55 (56%), Gaps = 5/55 (9%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +R+AF V   +  HVA     L+DDV TTGAT   AA AL+KAG   V     +R
Sbjct: 190 LRDAFEVRGALPAHVA-----LVDDVMTTGATLHAAAKALRKAGVQRVDAWVCAR 239


>gi|294627596|ref|ZP_06706179.1| competence protein [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 11122]
 gi|292598227|gb|EFF42381.1| competence protein [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 11122]
          Length = 241

 Score = 42.4 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 31/55 (56%), Gaps = 5/55 (9%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +R+AF V   +  HVA     L+DDV TTGAT   AA AL+KAG   V     +R
Sbjct: 190 LRDAFEVRGALPAHVA-----LVDDVMTTGATLHAAAKALRKAGVQRVDAWVCAR 239


>gi|21241163|ref|NP_640745.1| competence protein F [Xanthomonas axonopodis pv. citri str. 306]
 gi|21106468|gb|AAM35281.1| competence protein F [Xanthomonas axonopodis pv. citri str. 306]
          Length = 243

 Score = 42.4 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 31/55 (56%), Gaps = 5/55 (9%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +R+AF V   +  HVA     L+DDV TTGAT   AA AL+KAG   V     +R
Sbjct: 192 LRDAFEVRGALPAHVA-----LVDDVMTTGATLHAAAKALRKAGVQRVDAWVCAR 241


>gi|150388558|ref|YP_001318607.1| phosphoribosyltransferase [Alkaliphilus metalliredigens QYMF]
 gi|149948420|gb|ABR46948.1| phosphoribosyltransferase [Alkaliphilus metalliredigens QYMF]
          Length = 242

 Score = 42.4 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 27/37 (72%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           K+LLIDD+ TTGAT K  +  L +AGA +V+ LT +R
Sbjct: 201 KLLLIDDIVTTGATLKACSRVLLEAGAQSVTALTLAR 237


>gi|85708603|ref|ZP_01039669.1| amidophosphoribosyltransferase [Erythrobacter sp. NAP1]
 gi|85690137|gb|EAQ30140.1| amidophosphoribosyltransferase [Erythrobacter sp. NAP1]
          Length = 287

 Score = 42.4 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 31/55 (56%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +R A  V       + G  ++L+DDV T+GAT+     AL  AGA++V I  F+R
Sbjct: 202 LRGAIEVRANAKGSITGRNVILVDDVLTSGATSDACTKALLDAGAVSVRIACFAR 256


>gi|317488331|ref|ZP_07946892.1| comF protein [Eggerthella sp. 1_3_56FAA]
 gi|316912562|gb|EFV34110.1| comF protein [Eggerthella sp. 1_3_56FAA]
          Length = 54

 Score = 42.4 bits (98), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/37 (56%), Positives = 27/37 (72%)

Query: 19 KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++L+DDVYTTGAT   A  A++ AGA TV  LTF+R
Sbjct: 16 SVILVDDVYTTGATLFAATDAVRVAGAATVRCLTFAR 52


>gi|302391038|ref|YP_003826858.1| phosphoribosyltransferase [Acetohalobium arabaticum DSM 5501]
 gi|302203115|gb|ADL11793.1| phosphoribosyltransferase [Acetohalobium arabaticum DSM 5501]
          Length = 238

 Score = 42.4 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 26/36 (72%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +ILLIDD+YTTGAT    A  L +AGA +VS LT +
Sbjct: 195 EILLIDDIYTTGATVNECAKVLLRAGAESVSALTLA 230


>gi|322434181|ref|YP_004216393.1| phosphoribosyltransferase [Acidobacterium sp. MP5ACTX9]
 gi|321161908|gb|ADW67613.1| phosphoribosyltransferase [Acidobacterium sp. MP5ACTX9]
          Length = 239

 Score = 42.4 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 34/56 (60%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF V       VA  ++LLIDD+ TTGATA+  A  L KAGA  V + T +R+
Sbjct: 156 LRGAFEV----RGDVANKEVLLIDDILTTGATARECARVLVKAGASKVWVATVARA 207


>gi|218960908|ref|YP_001740683.1| putative gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Candidatus Cloacamonas acidaminovorans]
 gi|167729565|emb|CAO80477.1| putative gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Candidatus Cloacamonas acidaminovorans]
          Length = 240

 Score = 42.4 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 29/42 (69%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           VAG KI+LIDDV+TTG+T    A  L+ AGA  +  +T +R+
Sbjct: 199 VAGKKIILIDDVFTTGSTLNEIAKTLRSAGADKICAITVARA 240


>gi|288956999|ref|YP_003447340.1| hypothetical protein AZL_001580 [Azospirillum sp. B510]
 gi|288909307|dbj|BAI70796.1| hypothetical protein AZL_001580 [Azospirillum sp. B510]
          Length = 255

 Score = 42.4 bits (98), Expect = 0.024,   Method: Composition-based stats.
 Identities = 23/47 (48%), Positives = 34/47 (72%), Gaps = 2/47 (4%)

Query: 13  KHVAGLKILLIDDVYTTGAT-AKCAAIALKKAGAMTVSILTFSRSLK 58
           + VAG +++LIDDV TTGAT A+C  + L +AGA  V +LT +R ++
Sbjct: 209 QSVAGQRLVLIDDVMTTGATLAECTRVLL-RAGAARVDVLTLARVVQ 254


>gi|15616187|ref|NP_244492.1| late competence protein required for DNA uptake [Bacillus
           halodurans C-125]
 gi|10176249|dbj|BAB07344.1| late competence protein required for DNA uptake [Bacillus
           halodurans C-125]
          Length = 177

 Score = 42.4 bits (98), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 27/41 (65%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           V G  I+L+DDVYTTGAT + AA  L+  GA  V  +T +R
Sbjct: 137 VEGRSIVLVDDVYTTGATIRQAATVLQAHGAARVRSMTIAR 177


>gi|269836555|ref|YP_003318783.1| phosphoribosyltransferase [Sphaerobacter thermophilus DSM 20745]
 gi|269785818|gb|ACZ37961.1| phosphoribosyltransferase [Sphaerobacter thermophilus DSM 20745]
          Length = 235

 Score = 42.0 bits (97), Expect = 0.024,   Method: Composition-based stats.
 Identities = 22/41 (53%), Positives = 27/41 (65%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           V G  +LLIDDV TTGAT + A +AL +AGA  V  L  +R
Sbjct: 193 VRGASVLLIDDVVTTGATMEAAGLALLEAGARHVRGLALAR 233


>gi|169344244|ref|ZP_02865226.1| comF protein, homolog [Clostridium perfringens C str. JGS1495]
 gi|169297703|gb|EDS79803.1| comF protein, homolog [Clostridium perfringens C str. JGS1495]
          Length = 219

 Score = 42.0 bits (97), Expect = 0.025,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF + +Y  K++ G  I+L+DDV TTG+T K     LKK   + + +LT ++S
Sbjct: 164 VKNAFKLKRY--KNLEGKSIILLDDVMTTGSTLKACVRELKKIKDIKIFLLTIAKS 217


>gi|168213723|ref|ZP_02639348.1| comF protein, homolog [Clostridium perfringens CPE str. F4969]
 gi|170714835|gb|EDT27017.1| comF protein, homolog [Clostridium perfringens CPE str. F4969]
          Length = 219

 Score = 42.0 bits (97), Expect = 0.025,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF + +Y  K++ G  I+L+DDV TTG+T K     LKK   + + +LT ++S
Sbjct: 164 VKNAFKLKRY--KNLEGKSIILLDDVMTTGSTLKACVRELKKIKDIKIFLLTIAKS 217


>gi|56421681|ref|YP_148999.1| late competence protein [Geobacillus kaustophilus HTA426]
 gi|56381523|dbj|BAD77431.1| late competence protein [Geobacillus kaustophilus HTA426]
          Length = 230

 Score = 42.0 bits (97), Expect = 0.025,   Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 8   PQYVSKH--VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           P +++ H  + G +I+LIDD+YTTG T + AA  L +AGA  V  LT  R+
Sbjct: 180 PFFLADHPPLDGKRIVLIDDIYTTGITIRHAARVLLEAGAAEVWALTLVRA 230


>gi|296840875|ref|ZP_06899408.1| ComF/gntX family protein [Neisseria polysaccharea ATCC 43768]
 gi|296839639|gb|EFH23577.1| ComF/gntX family protein [Neisseria polysaccharea ATCC 43768]
          Length = 165

 Score = 42.0 bits (97), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   + ++     ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 109 IKNAFEIRTPIPENC---NILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 161


>gi|291615045|ref|YP_003525202.1| phosphoribosyltransferase [Sideroxydans lithotrophicus ES-1]
 gi|291585157|gb|ADE12815.1| phosphoribosyltransferase [Sideroxydans lithotrophicus ES-1]
          Length = 238

 Score = 42.0 bits (97), Expect = 0.025,   Method: Composition-based stats.
 Identities = 26/57 (45%), Positives = 33/57 (57%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           MR AF      S  V G  I ++DDV TTGA+    A ALK+AGA  VS+   +R+L
Sbjct: 181 MRQAFVCS---STDVRGKHIAIVDDVMTTGASTGELARALKQAGAREVSVWVVARTL 234


>gi|328955032|ref|YP_004372365.1| hypothetical protein Corgl_0432 [Coriobacterium glomerans PW2]
 gi|328455356|gb|AEB06550.1| hypothetical protein Corgl_0432 [Coriobacterium glomerans PW2]
          Length = 256

 Score = 42.0 bits (97), Expect = 0.026,   Method: Composition-based stats.
 Identities = 22/41 (53%), Positives = 30/41 (73%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           V GL++ LIDDV TTGAT + AA AL+ AGA+ ++ L  +R
Sbjct: 214 VRGLRLTLIDDVITTGATMQAAADALRGAGAVEIAGLAVAR 254


>gi|319945284|ref|ZP_08019546.1| competence protein F [Lautropia mirabilis ATCC 51599]
 gi|319741854|gb|EFV94279.1| competence protein F [Lautropia mirabilis ATCC 51599]
          Length = 262

 Score = 42.0 bits (97), Expect = 0.027,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF+VP    K V+G  + L+DDV T+G T   AA  L  AGA +V  L  +R+
Sbjct: 208 LRGAFSVPD--PKRVSGQHLALVDDVMTSGNTLNEAAQTLLAAGAASVMALVVART 261


>gi|323489905|ref|ZP_08095127.1| late competence protein [Planococcus donghaensis MPA1U2]
 gi|323396412|gb|EGA89236.1| late competence protein [Planococcus donghaensis MPA1U2]
          Length = 137

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 27/38 (71%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           K+LL DD+YTTG+T + AA  LK+ GA  + ++T  R+
Sbjct: 100 KVLLFDDLYTTGSTLRLAAKVLKEKGAKEIKVVTLIRA 137


>gi|315283651|ref|ZP_07871780.1| ComF operon protein 3 [Listeria marthii FSL S4-120]
 gi|313612703|gb|EFR86716.1| ComF operon protein 3 [Listeria marthii FSL S4-120]
          Length = 218

 Score = 42.0 bits (97), Expect = 0.029,   Method: Composition-based stats.
 Identities = 20/38 (52%), Positives = 26/38 (68%)

Query: 18  LKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +++LL DD+YTTG+T   AA  LK+AG   VS LT  R
Sbjct: 181 MEVLLFDDIYTTGSTLNLAAQILKEAGVKKVSALTIFR 218


>gi|73540017|ref|YP_294537.1| putative amidophosphoribosyltransferase [Ralstonia eutropha JMP134]
 gi|72117430|gb|AAZ59693.1| putative amidophosphoribosyltransferases [Ralstonia eutropha
           JMP134]
          Length = 222

 Score = 42.0 bits (97), Expect = 0.029,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF + +  S+ +AG+ + L+DDV TTGAT   AA  LK  GA  VS++   R+
Sbjct: 168 VRGAFRISR--SRPLAGMHVGLVDDVMTTGATLDEAARTLKAHGAARVSVIVALRT 221


>gi|119509728|ref|ZP_01628873.1| hypothetical protein N9414_00225 [Nodularia spumigena CCY9414]
 gi|119465594|gb|EAW46486.1| hypothetical protein N9414_00225 [Nodularia spumigena CCY9414]
          Length = 178

 Score = 42.0 bits (97), Expect = 0.031,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 35/59 (59%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF V + + +    + +LL+DD+YTTGATA+ A   L + G   + ++  + ++KD
Sbjct: 119 LAEAFAVGEELRRRRLQVPVLLVDDIYTTGATARSAVKILNQDGIAVLGLVAVTTAVKD 177


>gi|168205590|ref|ZP_02631595.1| comF protein, homolog [Clostridium perfringens E str. JGS1987]
 gi|170662947|gb|EDT15630.1| comF protein, homolog [Clostridium perfringens E str. JGS1987]
          Length = 219

 Score = 42.0 bits (97), Expect = 0.031,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF + +Y  K++ G  I+L+DDV TTG+T K     LKK   + + +LT ++S
Sbjct: 164 VKNAFKLKRY--KNLEGKSIILLDDVMTTGSTLKACVRELKKIKDIKIFLLTIAKS 217


>gi|258591131|emb|CBE67426.1| putative competence protein F (COMF) (fragment) [NC10 bacterium
           'Dutch sediment']
          Length = 165

 Score = 42.0 bits (97), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 27/41 (65%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           V G K+LLIDDV+TTGATA   A  L  AGA  V + T +R
Sbjct: 123 VKGKKLLLIDDVFTTGATAAECARTLLAAGAADVGVYTLAR 163


>gi|146309104|ref|YP_001189569.1| amidophosphoribosyltransferase-like protein [Pseudomonas mendocina
           ymp]
 gi|145577305|gb|ABP86837.1| amidophosphoribosyltransferase-like protein [Pseudomonas mendocina
           ymp]
          Length = 246

 Score = 41.6 bits (96), Expect = 0.032,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF +       VAG  + L+DDV TTGATA   A  L+ AGA  V +   +R+
Sbjct: 187 LRQAFTLD--AKAQVAGCHLALVDDVLTTGATAGTLARLLRHAGAQRVDVYCLART 240


>gi|71906257|ref|YP_283844.1| phosphoribosyltransferase [Dechloromonas aromatica RCB]
 gi|71845878|gb|AAZ45374.1| Phosphoribosyltransferase [Dechloromonas aromatica RCB]
          Length = 247

 Score = 41.6 bits (96), Expect = 0.032,   Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 30/44 (68%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++G ++LLIDDV TTGAT    A  LK  GA +V++   +R+L+
Sbjct: 203 LSGRRLLLIDDVMTTGATVNECARVLKLHGAASVTVAVIARALR 246


>gi|158335498|ref|YP_001516670.1| hypothetical protein AM1_2345 [Acaryochloris marina MBIC11017]
 gi|158305739|gb|ABW27356.1| conserved hypothetical protein [Acaryochloris marina MBIC11017]
          Length = 167

 Score = 41.6 bits (96), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 32/54 (59%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
            AF V   +++   G KI+L+DD+YTTGAT   A   L +AG   V I+  +++
Sbjct: 114 EAFRVGPELAQKSRGSKIVLLDDIYTTGATINSAVETLSQAGFQVVEIVVVAKA 167


>gi|325286004|ref|YP_004261794.1| phosphoribosyltransferase [Cellulophaga lytica DSM 7489]
 gi|324321458|gb|ADY28923.1| phosphoribosyltransferase [Cellulophaga lytica DSM 7489]
          Length = 214

 Score = 41.6 bits (96), Expect = 0.034,   Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 29/42 (69%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++VAG  ILL+DDV TTGAT +  A AL KA  +T+ + T +
Sbjct: 170 ENVAGKTILLVDDVITTGATIEACATALHKAKNVTIYVATIA 211


>gi|298292753|ref|YP_003694692.1| phosphoribosyltransferase [Starkeya novella DSM 506]
 gi|296929264|gb|ADH90073.1| phosphoribosyltransferase [Starkeya novella DSM 506]
          Length = 273

 Score = 41.6 bits (96), Expect = 0.034,   Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 27/39 (69%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           G +++L+DDV TTGAT    A AL +AGA  V +L F+R
Sbjct: 225 GRRVVLVDDVLTTGATIDACAKALTRAGAGRVDVLVFAR 263


>gi|296534746|ref|ZP_06897119.1| ComF family protein [Roseomonas cervicalis ATCC 49957]
 gi|296264925|gb|EFH11177.1| ComF family protein [Roseomonas cervicalis ATCC 49957]
          Length = 67

 Score = 41.6 bits (96), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 1  MRNAFNVPQYVSKHVAGLKILLIDDVYTTGAT-AKCAAIALKKAGAMTVSILTFSR 55
          +  AF + +  +  +AG ++LL+DDV T+GAT + CAA+ L+  GA  V +L  +R
Sbjct: 1  LEGAFALARGAAPRIAGRRLLLVDDVLTSGATVSACAALLLRH-GAAQVDVLAAAR 55


>gi|15595686|ref|NP_249180.1| phosphoribosyl transferase [Pseudomonas aeruginosa PAO1]
 gi|9946352|gb|AAG03878.1|AE004486_7 probable phosphoribosyl transferase [Pseudomonas aeruginosa PAO1]
          Length = 241

 Score = 41.6 bits (96), Expect = 0.034,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +    +  V GL + L+DDV TTGATA+  +  L++AGA  V +   +R+ K
Sbjct: 184 LRHAFALAP--ASDVRGLHLALVDDVLTTGATAERLSRLLRRAGAARVDVYCLARTPK 239


>gi|158521918|ref|YP_001529788.1| phosphoribosyltransferase [Desulfococcus oleovorans Hxd3]
 gi|158510744|gb|ABW67711.1| phosphoribosyltransferase [Desulfococcus oleovorans Hxd3]
          Length = 279

 Score = 41.6 bits (96), Expect = 0.035,   Method: Composition-based stats.
 Identities = 20/41 (48%), Positives = 27/41 (65%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           VAG ++L++DDV+TTGAT    A  L   GA  V +LT +R
Sbjct: 236 VAGKRVLVVDDVFTTGATVNECARVLLAGGAKQVDVLTLAR 276


>gi|296453597|ref|YP_003660740.1| hypothetical protein BLJ_0433 [Bifidobacterium longum subsp. longum
           JDM301]
 gi|296183028|gb|ADG99909.1| hypothetical protein BLJ_0433 [Bifidobacterium longum subsp. longum
           JDM301]
          Length = 279

 Score = 41.6 bits (96), Expect = 0.036,   Method: Composition-based stats.
 Identities = 18/36 (50%), Positives = 27/36 (75%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +LLIDD +T+G TA+ A+I LK++GA  V+I   +R
Sbjct: 204 VLLIDDTWTSGGTAESASIMLKQSGAQRVTIYCLAR 239


>gi|212711653|ref|ZP_03319781.1| hypothetical protein PROVALCAL_02728 [Providencia alcalifaciens DSM
           30120]
 gi|212685755|gb|EEB45283.1| hypothetical protein PROVALCAL_02728 [Providencia alcalifaciens DSM
           30120]
          Length = 227

 Score = 41.6 bits (96), Expect = 0.036,   Method: Composition-based stats.
 Identities = 25/56 (44%), Positives = 30/56 (53%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           RN       +   V+GL I +IDDV TTGAT   AA  L  AGA TV   +  R+L
Sbjct: 172 RNNLKKAFALETSVSGLHIAIIDDVITTGATMHAAAQLLICAGAHTVDAWSLCRTL 227


>gi|18311155|ref|NP_563089.1| comFC protein [Clostridium perfringens str. 13]
 gi|18145838|dbj|BAB81879.1| comFC protein [Clostridium perfringens str. 13]
          Length = 219

 Score = 41.6 bits (96), Expect = 0.036,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF + +Y  K++ G  I+L+DDV TTG+T K     LKK   + + +LT ++S
Sbjct: 164 VQNAFKLKRY--KNLEGKSIILLDDVMTTGSTLKACVRELKKIKDIKIFLLTIAKS 217


>gi|104784036|ref|YP_610534.1| competence protein ComF [Pseudomonas entomophila L48]
 gi|95113023|emb|CAK17751.1| putative competence protein ComF [Pseudomonas entomophila L48]
          Length = 245

 Score = 41.6 bits (96), Expect = 0.036,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R+AF +       V  L + ++DDV TTGATA+  A  L+KAGA  V I   +R+
Sbjct: 186 LRHAFALAP--GTEVKDLHLAVVDDVMTTGATAQAIAALLRKAGARRVDIYCLART 239


>gi|228999934|ref|ZP_04159506.1| ComF operon protein 3 [Bacillus mycoides Rock3-17]
 gi|228759876|gb|EEM08850.1| ComF operon protein 3 [Bacillus mycoides Rock3-17]
          Length = 151

 Score = 41.6 bits (96), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 8   PQYVSKH--VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           P Y  K     G  +LLIDDVYTTG T +  A  L  AGA  +S LT  R
Sbjct: 101 PFYFHKEEMFIGQHLLLIDDVYTTGITVRQVAKCLYDAGAQKISSLTLCR 150


>gi|315607124|ref|ZP_07882128.1| competence protein [Prevotella buccae ATCC 33574]
 gi|315251178|gb|EFU31163.1| competence protein [Prevotella buccae ATCC 33574]
          Length = 228

 Score = 41.6 bits (96), Expect = 0.037,   Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 26/39 (66%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           V G  +LLIDDV TTGAT     + +KKAG + +S+LT 
Sbjct: 185 VHGRHVLLIDDVCTTGATLSSCGMEIKKAGDVRISVLTL 223


>gi|145219107|ref|YP_001129816.1| phosphoribosyltransferase [Prosthecochloris vibrioformis DSM 265]
 gi|145205271|gb|ABP36314.1| phosphoribosyltransferase [Chlorobium phaeovibrioides DSM 265]
          Length = 230

 Score = 41.6 bits (96), Expect = 0.037,   Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 31/45 (68%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           V G+ +LL+DDV TTG+T   A+ AL  AGA  +S+ + + +LK+
Sbjct: 186 VGGMHVLLVDDVVTTGSTMAAASKALLGAGAARISLASVALALKE 230


>gi|330985850|gb|EGH83953.1| competence protein ComF [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 244

 Score = 41.6 bits (96), Expect = 0.038,   Method: Composition-based stats.
 Identities = 26/61 (42%), Positives = 37/61 (60%), Gaps = 8/61 (13%)

Query: 1   MRNAFNV--PQYVS-KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R+AF +  P +V  KH+A     L+DDV TTG+TA+  A  L KAGA  V +   +R+ 
Sbjct: 186 LRDAFTLVDPDWVQGKHLA-----LVDDVLTTGSTAEVIARLLNKAGARRVDVYCLARTP 240

Query: 58  K 58
           K
Sbjct: 241 K 241


>gi|320331599|gb|EFW87537.1| competence protein ComF [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330872324|gb|EGH06473.1| competence protein ComF [Pseudomonas syringae pv. glycinea str.
           race 4]
          Length = 244

 Score = 41.6 bits (96), Expect = 0.038,   Method: Composition-based stats.
 Identities = 26/61 (42%), Positives = 37/61 (60%), Gaps = 8/61 (13%)

Query: 1   MRNAFNV--PQYVS-KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R+AF +  P +V  KH+A     L+DDV TTG+TA+  A  L KAGA  V +   +R+ 
Sbjct: 186 LRDAFTLVDPDWVQGKHLA-----LVDDVLTTGSTAEVIARLLNKAGARRVDVYCLARTP 240

Query: 58  K 58
           K
Sbjct: 241 K 241


>gi|298489185|ref|ZP_07007204.1| Competence protein F [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|298156267|gb|EFH97368.1| Competence protein F [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
          Length = 244

 Score = 41.6 bits (96), Expect = 0.038,   Method: Composition-based stats.
 Identities = 26/61 (42%), Positives = 37/61 (60%), Gaps = 8/61 (13%)

Query: 1   MRNAFNV--PQYVS-KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R+AF +  P +V  KH+A     L+DDV TTG+TA+  A  L KAGA  V +   +R+ 
Sbjct: 186 LRDAFTLVDPDWVQGKHLA-----LVDDVLTTGSTAEVIARLLNKAGARRVDVYCLARTP 240

Query: 58  K 58
           K
Sbjct: 241 K 241


>gi|289624783|ref|ZP_06457737.1| competence protein ComF [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289650640|ref|ZP_06481983.1| competence protein ComF [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|330871186|gb|EGH05895.1| competence protein ComF [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 244

 Score = 41.6 bits (96), Expect = 0.038,   Method: Composition-based stats.
 Identities = 26/61 (42%), Positives = 37/61 (60%), Gaps = 8/61 (13%)

Query: 1   MRNAFNV--PQYVS-KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R+AF +  P +V  KH+A     L+DDV TTG+TA+  A  L KAGA  V +   +R+ 
Sbjct: 186 LRDAFTLVDPDWVQGKHLA-----LVDDVLTTGSTAEVIARLLNKAGARRVDVYCLARTP 240

Query: 58  K 58
           K
Sbjct: 241 K 241


>gi|308234118|ref|ZP_07664855.1| phosphoribosyltransferase [Atopobium vaginae DSM 15829]
 gi|328943658|ref|ZP_08241123.1| hypothetical protein HMPREF0091_10348 [Atopobium vaginae DSM 15829]
 gi|327491627|gb|EGF23401.1| hypothetical protein HMPREF0091_10348 [Atopobium vaginae DSM 15829]
          Length = 314

 Score = 41.6 bits (96), Expect = 0.038,   Method: Composition-based stats.
 Identities = 21/45 (46%), Positives = 32/45 (71%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           V + ++  ++L++DDV TTGA+ + AA ALK+A A  VS L F+R
Sbjct: 268 VLQDMSNKRVLVLDDVITTGASMREAARALKQANAADVSALAFAR 312


>gi|71734602|ref|YP_276823.1| competence protein ComF [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|71555155|gb|AAZ34366.1| competence protein ComF [Pseudomonas syringae pv. phaseolicola
           1448A]
          Length = 244

 Score = 41.6 bits (96), Expect = 0.038,   Method: Composition-based stats.
 Identities = 26/61 (42%), Positives = 37/61 (60%), Gaps = 8/61 (13%)

Query: 1   MRNAFNV--PQYVS-KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R+AF +  P +V  KH+A     L+DDV TTG+TA+  A  L KAGA  V +   +R+ 
Sbjct: 186 LRDAFTLVDPDWVQGKHLA-----LVDDVLTTGSTAEVIARLLNKAGARRVDVYCLARTP 240

Query: 58  K 58
           K
Sbjct: 241 K 241


>gi|288926892|ref|ZP_06420792.1| competence protein ComF [Prevotella buccae D17]
 gi|288336331|gb|EFC74712.1| competence protein ComF [Prevotella buccae D17]
          Length = 235

 Score = 41.6 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 26/39 (66%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           V G  +LLIDDV TTGAT     + +KKAG + +S+LT 
Sbjct: 192 VHGRHVLLIDDVCTTGATLSSCGMEIKKAGNVRISVLTL 230


>gi|282899726|ref|ZP_06307689.1| conserved hypothetical protein [Cylindrospermopsis raciborskii
           CS-505]
 gi|281195341|gb|EFA70275.1| conserved hypothetical protein [Cylindrospermopsis raciborskii
           CS-505]
          Length = 225

 Score = 41.6 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 19/40 (47%), Positives = 27/40 (67%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ILLIDD+YTTGATA  A  +L   G   + + T ++++KD
Sbjct: 181 ILLIDDIYTTGATANSAIHSLDAYGINVIGLATVAKAIKD 220


>gi|325205353|gb|ADZ00806.1| comF/gntX family protein [Neisseria meningitidis M04-240196]
          Length = 241

 Score = 41.6 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   + ++     ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPIPENC---NILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 237


>gi|325145262|gb|EGC67541.1| comF/gntX family protein [Neisseria meningitidis M01-240013]
          Length = 241

 Score = 41.6 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   + ++     ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPIPENC---NILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 237


>gi|325135072|gb|EGC57700.1| comF/gntX family protein [Neisseria meningitidis M13399]
          Length = 241

 Score = 41.6 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   + ++     ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPIPENC---NILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 237


>gi|325130995|gb|EGC53722.1| comF/gntX family protein [Neisseria meningitidis OX99.30304]
 gi|325137094|gb|EGC59690.1| comF/gntX family protein [Neisseria meningitidis M0579]
 gi|325202904|gb|ADY98358.1| comF/gntX family protein [Neisseria meningitidis M01-240149]
 gi|325207297|gb|ADZ02749.1| comF/gntX family protein [Neisseria meningitidis NZ-05/33]
          Length = 241

 Score = 41.6 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   + ++     ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPIPENC---NILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 237


>gi|319411246|emb|CBY91653.1| putative GntX-like protein [Neisseria meningitidis WUE 2594]
          Length = 202

 Score = 41.6 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   + ++     ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 146 IKNAFEIRTPIPENC---NILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 198


>gi|304389097|ref|ZP_07371141.1| ComF/gntX family protein [Neisseria meningitidis ATCC 13091]
 gi|304336970|gb|EFM03160.1| ComF/gntX family protein [Neisseria meningitidis ATCC 13091]
          Length = 241

 Score = 41.6 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   + ++     ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPIPENC---NILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 237


>gi|254805688|ref|YP_003083909.1| competence protein [Neisseria meningitidis alpha14]
 gi|254669229|emb|CBA08067.1| competence protein [Neisseria meningitidis alpha14]
          Length = 241

 Score = 41.6 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   + ++     ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPIPENC---NILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 237


>gi|240017422|ref|ZP_04723962.1| hypothetical protein NgonFA_09723 [Neisseria gonorrhoeae FA6140]
 gi|240113843|ref|ZP_04728333.1| hypothetical protein NgonM_09808 [Neisseria gonorrhoeae MS11]
 gi|240118801|ref|ZP_04732863.1| hypothetical protein NgonPID_10159 [Neisseria gonorrhoeae PID1]
 gi|240126552|ref|ZP_04739438.1| hypothetical protein NgonSK_10160 [Neisseria gonorrhoeae SK-92-679]
 gi|260439662|ref|ZP_05793478.1| hypothetical protein NgonDG_00973 [Neisseria gonorrhoeae DGI2]
 gi|268599910|ref|ZP_06134077.1| competence protein [Neisseria gonorrhoeae MS11]
 gi|268604511|ref|ZP_06138678.1| competence protein [Neisseria gonorrhoeae PID1]
 gi|268685131|ref|ZP_06151993.1| competence protein [Neisseria gonorrhoeae SK-92-679]
 gi|291042904|ref|ZP_06568645.1| competence protein [Neisseria gonorrhoeae DGI2]
 gi|268584041|gb|EEZ48717.1| competence protein [Neisseria gonorrhoeae MS11]
 gi|268588642|gb|EEZ53318.1| competence protein [Neisseria gonorrhoeae PID1]
 gi|268625415|gb|EEZ57815.1| competence protein [Neisseria gonorrhoeae SK-92-679]
 gi|291013338|gb|EFE05304.1| competence protein [Neisseria gonorrhoeae DGI2]
          Length = 241

 Score = 41.6 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   + ++     ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPIPENC---NILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 237


>gi|240014974|ref|ZP_04721887.1| hypothetical protein NgonD_10105 [Neisseria gonorrhoeae DGI18]
 gi|240081564|ref|ZP_04726107.1| hypothetical protein NgonF_09685 [Neisseria gonorrhoeae FA19]
 gi|240116577|ref|ZP_04730639.1| hypothetical protein NgonPID1_10148 [Neisseria gonorrhoeae PID18]
 gi|240122043|ref|ZP_04735005.1| hypothetical protein NgonPI_09815 [Neisseria gonorrhoeae PID24-1]
 gi|240129014|ref|ZP_04741675.1| hypothetical protein NgonS_10394 [Neisseria gonorrhoeae SK-93-1035]
 gi|268597659|ref|ZP_06131826.1| competence protein [Neisseria gonorrhoeae FA19]
 gi|268602245|ref|ZP_06136412.1| competence protein [Neisseria gonorrhoeae PID18]
 gi|268687393|ref|ZP_06154255.1| competence protein [Neisseria gonorrhoeae SK-93-1035]
 gi|268551447|gb|EEZ46466.1| competence protein [Neisseria gonorrhoeae FA19]
 gi|268586376|gb|EEZ51052.1| competence protein [Neisseria gonorrhoeae PID18]
 gi|268627677|gb|EEZ60077.1| competence protein [Neisseria gonorrhoeae SK-93-1035]
          Length = 241

 Score = 41.6 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   + ++     ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPIPENC---NILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 237


>gi|239999818|ref|ZP_04719742.1| hypothetical protein Ngon3_10123 [Neisseria gonorrhoeae 35/02]
 gi|254494599|ref|ZP_05107770.1| competence protein [Neisseria gonorrhoeae 1291]
 gi|268595627|ref|ZP_06129794.1| competence protein [Neisseria gonorrhoeae 35/02]
 gi|293398086|ref|ZP_06642291.1| hypothetical protein NGNG_01641 [Neisseria gonorrhoeae F62]
 gi|226513639|gb|EEH62984.1| competence protein [Neisseria gonorrhoeae 1291]
 gi|268549016|gb|EEZ44434.1| competence protein [Neisseria gonorrhoeae 35/02]
 gi|291611349|gb|EFF40419.1| hypothetical protein NGNG_01641 [Neisseria gonorrhoeae F62]
          Length = 241

 Score = 41.6 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   + ++     ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPIPENC---NILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 237


>gi|194099619|ref|YP_002002750.1| Competence protein [Neisseria gonorrhoeae NCCP11945]
 gi|193934909|gb|ACF30733.1| Competence protein [Neisseria gonorrhoeae NCCP11945]
 gi|317165108|gb|ADV08649.1| hypothetical protein NGTW08_1692 [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 202

 Score = 41.6 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   + ++     ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 146 IKNAFEIRTPIPENC---NILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 198


>gi|121634139|ref|YP_974384.1| hypothetical protein NMC0263 [Neisseria meningitidis FAM18]
 gi|120865845|emb|CAM09577.1| hypothetical protein NMC0263 [Neisseria meningitidis FAM18]
 gi|325131587|gb|EGC54294.1| comF/gntX family protein [Neisseria meningitidis M6190]
 gi|325139158|gb|EGC61704.1| comF/gntX family protein [Neisseria meningitidis ES14902]
          Length = 241

 Score = 41.6 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   + ++     ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPIPENC---NILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 237


>gi|59802047|ref|YP_208759.1| hypothetical protein NGO1726 [Neisseria gonorrhoeae FA 1090]
 gi|59718942|gb|AAW90347.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
          Length = 241

 Score = 41.6 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   + ++     ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPIPENC---NILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 237


>gi|15676193|ref|NP_273325.1| competence protein [Neisseria meningitidis MC58]
 gi|7225493|gb|AAF40723.1| competence protein [Neisseria meningitidis MC58]
 gi|316985199|gb|EFV64151.1| competence protein [Neisseria meningitidis H44/76]
 gi|325141105|gb|EGC63608.1| comF/gntX family protein [Neisseria meningitidis CU385]
 gi|325199472|gb|ADY94927.1| comF/gntX family protein [Neisseria meningitidis H44/76]
          Length = 241

 Score = 41.6 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   + ++     ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPIPENC---NILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 237


>gi|218768948|ref|YP_002343460.1| hypothetical protein NMA2217 [Neisseria meningitidis Z2491]
 gi|121052956|emb|CAM09310.1| hypothetical protein NMA2217 [Neisseria meningitidis Z2491]
          Length = 241

 Score = 41.6 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   + ++     ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPIPENC---NILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 237


>gi|218440666|ref|YP_002378995.1| hypothetical protein PCC7424_3746 [Cyanothece sp. PCC 7424]
 gi|218173394|gb|ACK72127.1| conserved hypothetical protein [Cyanothece sp. PCC 7424]
          Length = 219

 Score = 41.6 bits (96), Expect = 0.040,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++NAF + Q + K  + L +LL+DD+YT+G T K AA  L+  G   + ++  S
Sbjct: 161 IKNAFKIGQGLQKP-SSLPVLLLDDIYTSGQTVKEAAKTLRSHGVQVLGVVALS 213


>gi|110802308|ref|YP_699448.1| comFC protein [Clostridium perfringens SM101]
 gi|110682809|gb|ABG86179.1| comF protein, homolog [Clostridium perfringens SM101]
          Length = 219

 Score = 41.6 bits (96), Expect = 0.040,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF + +Y  K++ G  I+L+DDV TTG+T K     LKK   + + +LT ++S
Sbjct: 164 VQNAFKLKRY--KNLEGKSIILLDDVMTTGSTLKACVRELKKIKDIKIFLLTIAKS 217


>gi|229826214|ref|ZP_04452283.1| hypothetical protein GCWU000182_01586 [Abiotrophia defectiva ATCC
           49176]
 gi|229789084|gb|EEP25198.1| hypothetical protein GCWU000182_01586 [Abiotrophia defectiva ATCC
           49176]
          Length = 177

 Score = 41.6 bits (96), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLK-ILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51
           +R AF +      +   LK ILLIDD+YTTG+TA   +  LK+AG   V +L
Sbjct: 118 LREAFRINHNSKFYEIQLKNILLIDDIYTTGSTADACSAVLKEAGTEKVYVL 169


>gi|39933674|ref|NP_945950.1| phosphoribosyltransferase [Rhodopseudomonas palustris CGA009]
 gi|192289031|ref|YP_001989636.1| phosphoribosyltransferase [Rhodopseudomonas palustris TIE-1]
 gi|39647520|emb|CAE26041.1| possible competence protein F (COMF) [Rhodopseudomonas palustris
           CGA009]
 gi|192282780|gb|ACE99160.1| phosphoribosyltransferase [Rhodopseudomonas palustris TIE-1]
          Length = 271

 Score = 41.6 bits (96), Expect = 0.041,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 36/55 (65%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++ AF VP++    + G +I+LIDDV T+GAT    A AL +A A +V +L F+R
Sbjct: 208 VQGAFKVPKHRKAEIQGRRIVLIDDVLTSGATVDACARALLRARAASVDVLVFAR 262


>gi|302390143|ref|YP_003825964.1| phosphoribosyltransferase [Thermosediminibacter oceani DSM 16646]
 gi|302200771|gb|ADL08341.1| phosphoribosyltransferase [Thermosediminibacter oceani DSM 16646]
          Length = 240

 Score = 41.2 bits (95), Expect = 0.042,   Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 27/36 (75%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +LLIDDVYTTG+TA   + AL +AGA  V +LT +R
Sbjct: 204 LLLIDDVYTTGSTADECSKALLQAGASGVYVLTAAR 239


>gi|269213904|ref|ZP_05983088.2| ComF/gntX family protein [Neisseria cinerea ATCC 14685]
 gi|269145064|gb|EEZ71482.1| ComF/gntX family protein [Neisseria cinerea ATCC 14685]
          Length = 165

 Score = 41.2 bits (95), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   + ++     ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 109 IKNAFEIRTPIPENC---NILLIDDVFTTGATLGELAKMLKKSGANRICCWTLART 161


>gi|299534094|ref|ZP_07047446.1| hypothetical protein CTS44_24793 [Comamonas testosteroni S44]
 gi|298718003|gb|EFI59008.1| hypothetical protein CTS44_24793 [Comamonas testosteroni S44]
          Length = 254

 Score = 41.2 bits (95), Expect = 0.043,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R  F++       V G +ILL+DDV TTGAT    A  L  AGA +VS +  +R+
Sbjct: 198 LRGIFSLAPARQALVKGREILLLDDVMTTGATLDALAGCLLSAGAASVSAVVLART 253


>gi|264680076|ref|YP_003279985.1| hypothetical protein CtCNB1_3943 [Comamonas testosteroni CNB-2]
 gi|262210591|gb|ACY34689.1| conserved hypothetical protein [Comamonas testosteroni CNB-2]
          Length = 254

 Score = 41.2 bits (95), Expect = 0.043,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R  F++       V G +ILL+DDV TTGAT    A  L  AGA +VS +  +R+
Sbjct: 198 LRGIFSLAPARQALVKGREILLLDDVMTTGATLDALAGCLLSAGAASVSAVVLART 253


>gi|51244132|ref|YP_064016.1| competence protein F [Desulfotalea psychrophila LSv54]
 gi|50875169|emb|CAG35009.1| related to competence protein F [Desulfotalea psychrophila LSv54]
          Length = 238

 Score = 41.2 bits (95), Expect = 0.043,   Method: Composition-based stats.
 Identities = 19/44 (43%), Positives = 28/44 (63%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++ + G KI L+DDV+TTG T    +  L+K GA  V +LT +R
Sbjct: 190 AEMIRGRKICLVDDVFTTGTTVDECSKVLRKNGAAEVEVLTLAR 233


>gi|328913611|gb|AEB65207.1| competence protein FC [Bacillus amyloliquefaciens LL3]
          Length = 169

 Score = 41.2 bits (95), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 29/41 (70%), Gaps = 1/41 (2%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAG-AMTVSILTFSRS 56
           G+ ++LIDD+YTTGAT   AA AL  AG A++VS  T  RS
Sbjct: 129 GMNVILIDDIYTTGATLHQAAGALLTAGKALSVSSFTLIRS 169


>gi|16801717|ref|NP_471985.1| hypothetical protein lin2656 [Listeria innocua Clip11262]
 gi|16415192|emb|CAC97882.1| comFC [Listeria innocua Clip11262]
          Length = 218

 Score = 41.2 bits (95), Expect = 0.044,   Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 26/37 (70%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +I+L DD+YTTG+T   AA ALK++G   VS LT  R
Sbjct: 182 EIILFDDIYTTGSTLNLAAQALKESGVKKVSSLTIFR 218


>gi|320539834|ref|ZP_08039493.1| putative gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system [Serratia
           symbiotica str. Tucson]
 gi|320030020|gb|EFW12040.1| putative gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system [Serratia
           symbiotica str. Tucson]
          Length = 239

 Score = 41.2 bits (95), Expect = 0.045,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 33/57 (57%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +RNAF+      + VAG  I L+DDV TTG+T    A  L + GA+++ I    R+L
Sbjct: 187 LRNAFDC----DEQVAGRHIALLDDVVTTGSTVAEIATLLHRQGAVSLQIWCICRTL 239


>gi|170723998|ref|YP_001751686.1| competence protein ComF [Pseudomonas putida W619]
 gi|169762001|gb|ACA75317.1| competence protein ComF [Pseudomonas putida W619]
          Length = 245

 Score = 41.2 bits (95), Expect = 0.045,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++ AF V    + H  GL + ++DDV TTGATA+  A  L+ AGA  V +   +R+ K
Sbjct: 186 LQQAFAVVDEGALH--GLHVAVVDDVLTTGATAQSIAALLRGAGARRVDVYCLARTAK 241


>gi|229007486|ref|ZP_04165083.1| ComF operon protein 3 [Bacillus mycoides Rock1-4]
 gi|228753874|gb|EEM03315.1| ComF operon protein 3 [Bacillus mycoides Rock1-4]
          Length = 144

 Score = 41.2 bits (95), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 8   PQYVSKH--VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           P Y  K     G  +LLIDDVYTTG T +  A  L  AGA  +S LT  R
Sbjct: 94  PFYFHKEEMFIGQHLLLIDDVYTTGITVRQVAKCLYDAGAQKISSLTLCR 143


>gi|261367065|ref|ZP_05979948.1| putative competence protein F [Subdoligranulum variabile DSM 15176]
 gi|282571184|gb|EFB76719.1| putative competence protein F [Subdoligranulum variabile DSM 15176]
          Length = 257

 Score = 41.2 bits (95), Expect = 0.045,   Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 26/35 (74%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVS 49
           + G ++LL+DD+ TTGAT    A+AL KAGA+ V+
Sbjct: 201 LGGKRVLLVDDIITTGATVSACALALLKAGAVDVT 235


>gi|229087668|ref|ZP_04219794.1| ComF operon protein 3 [Bacillus cereus Rock3-44]
 gi|228695629|gb|EEL48488.1| ComF operon protein 3 [Bacillus cereus Rock3-44]
          Length = 234

 Score = 41.2 bits (95), Expect = 0.047,   Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 23/36 (63%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           I+LIDDVYTTG T +  A  L  AG  TVS LT  R
Sbjct: 198 IVLIDDVYTTGITVRQVAACLYDAGTQTVSSLTLCR 233


>gi|221155939|gb|ACM05066.1| conserved hypothetical protein [Thermomicrobium roseum DSM 5159]
          Length = 235

 Score = 41.2 bits (95), Expect = 0.048,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 24/37 (64%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +LLIDD  TTGAT      AL +AGA  V +L F+R+
Sbjct: 195 VLLIDDTITTGATVAAGTTALVRAGASAVVVLAFARA 231


>gi|84514889|ref|ZP_01002252.1| competence protein F, putative [Loktanella vestfoldensis SKA53]
 gi|84511048|gb|EAQ07502.1| competence protein F, putative [Loktanella vestfoldensis SKA53]
          Length = 241

 Score = 41.2 bits (95), Expect = 0.048,   Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 28/46 (60%)

Query: 14  HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            + G  +LL+DDV T+GAT      AL   GA+ VS +T +R +KD
Sbjct: 195 QITGKPVLLVDDVMTSGATLAACTQALLDGGAVRVSTITLARVVKD 240


>gi|308175277|ref|YP_003921982.1| competence protein FC [Bacillus amyloliquefaciens DSM 7]
 gi|307608141|emb|CBI44512.1| competence protein FC [Bacillus amyloliquefaciens DSM 7]
 gi|328555250|gb|AEB25742.1| competence protein FC [Bacillus amyloliquefaciens TA208]
          Length = 225

 Score = 41.2 bits (95), Expect = 0.048,   Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 29/41 (70%), Gaps = 1/41 (2%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAG-AMTVSILTFSRS 56
           G+ ++LIDD+YTTGAT   AA AL  AG A++VS  T  RS
Sbjct: 185 GMNVILIDDIYTTGATLHQAAGALLTAGKALSVSSFTLIRS 225


>gi|240850049|ref|YP_002971442.1| competence protein ComF [Bartonella grahamii as4aup]
 gi|240267172|gb|ACS50760.1| competence protein ComF [Bartonella grahamii as4aup]
          Length = 261

 Score = 41.2 bits (95), Expect = 0.048,   Method: Composition-based stats.
 Identities = 34/59 (57%), Positives = 42/59 (71%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++NAF V   V K++ G  +LLIDDV+TTGAT   AA ALK AGA  V +LTFSR LK+
Sbjct: 196 VKNAFKVSHKVKKYLKGCSVLLIDDVFTTGATVTAAAAALKYAGARQVDVLTFSRVLKE 254


>gi|229124698|ref|ZP_04253879.1| ComF operon protein 3 [Bacillus cereus 95/8201]
 gi|228658793|gb|EEL14452.1| ComF operon protein 3 [Bacillus cereus 95/8201]
          Length = 164

 Score = 41.2 bits (95), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 8   PQYVSKH--VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           P Y  +     G +ILL+DDVYTTG T +     L   GA  VS LT  RS
Sbjct: 114 PFYFQREEMFHGQRILLVDDVYTTGITVRQIGSLLYDRGAREVSSLTLCRS 164


>gi|229094286|ref|ZP_04225362.1| ComF operon protein 3 [Bacillus cereus Rock3-42]
 gi|229187402|ref|ZP_04314545.1| ComF operon protein 3 [Bacillus cereus BGSC 6E1]
 gi|228596106|gb|EEK53783.1| ComF operon protein 3 [Bacillus cereus BGSC 6E1]
 gi|228689139|gb|EEL42962.1| ComF operon protein 3 [Bacillus cereus Rock3-42]
          Length = 164

 Score = 41.2 bits (95), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 8   PQYVSKH--VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           P Y  +     G +ILL+DDVYTTG T +     L   GA  VS LT  RS
Sbjct: 114 PFYFQREEMFHGQRILLVDDVYTTGITVRQIGSLLYDRGAREVSSLTLCRS 164


>gi|126730067|ref|ZP_01745879.1| Competence protein F [Sagittula stellata E-37]
 gi|126709447|gb|EBA08501.1| Competence protein F [Sagittula stellata E-37]
          Length = 237

 Score = 41.2 bits (95), Expect = 0.049,   Method: Composition-based stats.
 Identities = 21/45 (46%), Positives = 28/45 (62%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +AG ++LL+DDV TTGAT    A A   AGA  V +   +R +KD
Sbjct: 192 MAGRRVLLVDDVMTTGATLAACAEACLSAGAQQVCVSVLARVVKD 236


>gi|326387515|ref|ZP_08209122.1| phosphoribosyltransferase [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326208004|gb|EGD58814.1| phosphoribosyltransferase [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 281

 Score = 41.2 bits (95), Expect = 0.050,   Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 26/44 (59%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +  + G  +LLIDDV T+GAT      AL +AGA  V I  F+R
Sbjct: 209 AARLKGANVLLIDDVLTSGATTNACMAALHRAGAARVRIACFAR 252


>gi|188586866|ref|YP_001918411.1| amidophosphoribosyltransferase-like protein [Natranaerobius
           thermophilus JW/NM-WN-LF]
 gi|179351553|gb|ACB85823.1| amidophosphoribosyltransferase-like protein [Natranaerobius
           thermophilus JW/NM-WN-LF]
          Length = 303

 Score = 41.2 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 24/52 (46%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           N FNV  + +      KIL+IDD+YTTGATA   A  LK  G   +++LT S
Sbjct: 253 NVFNV--FSNSISNAGKILIIDDIYTTGATASEMAKVLKTMGFHEITLLTLS 302


>gi|325143108|gb|EGC65455.1| comF/gntX family protein [Neisseria meningitidis 961-5945]
 gi|325197553|gb|ADY93009.1| comF/gntX family protein [Neisseria meningitidis G2136]
          Length = 241

 Score = 41.2 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   + ++     ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPIPENC---NILLIDDVFTTGATLDELAKMLKKSGANRICCWTLART 237


>gi|229181452|ref|ZP_04308780.1| ComF operon protein 3 [Bacillus cereus 172560W]
 gi|228602027|gb|EEK59520.1| ComF operon protein 3 [Bacillus cereus 172560W]
          Length = 164

 Score = 41.2 bits (95), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 25/41 (60%)

Query: 16  AGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +G  ILL+DDVYTTG T +     L + GA  VS LT  RS
Sbjct: 124 SGQHILLVDDVYTTGITVRQIGSLLYERGAREVSSLTLCRS 164


>gi|116492229|ref|YP_803964.1| amidophosphoribosyltransferase [Pediococcus pentosaceus ATCC 25745]
 gi|116102379|gb|ABJ67522.1| Predicted amidophosphoribosyltransferase [Pediococcus pentosaceus
           ATCC 25745]
          Length = 143

 Score = 40.8 bits (94), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 26/41 (63%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++G  ILL+DD+YTTGAT + A   L + GA  V  +T  R
Sbjct: 103 ISGEHILLVDDIYTTGATLRQARTTLLRNGATQVRSVTLCR 143


>gi|325128978|gb|EGC51829.1| comF/gntX family protein [Neisseria meningitidis N1568]
          Length = 241

 Score = 40.8 bits (94), Expect = 0.055,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +     K+     ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPPPKNC---NILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 237


>gi|261391800|emb|CAX49255.1| putative GntX-like protein [Neisseria meningitidis 8013]
          Length = 241

 Score = 40.8 bits (94), Expect = 0.055,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +     K+     ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPPPKNC---NILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 237


>gi|254671567|emb|CBA09213.1| competence protein F [Neisseria meningitidis alpha153]
          Length = 241

 Score = 40.8 bits (94), Expect = 0.055,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +     K+     ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPPPKNC---NILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 237


>gi|161870794|ref|YP_001599967.1| competence protein [Neisseria meningitidis 053442]
 gi|161596347|gb|ABX74007.1| competence protein [Neisseria meningitidis 053442]
          Length = 179

 Score = 40.8 bits (94), Expect = 0.055,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +     K+     ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 123 IKNAFEIRTPPPKNC---NILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 175


>gi|188994134|ref|YP_001928386.1| probable amidophosphoribosyl-transferase [Porphyromonas gingivalis
           ATCC 33277]
 gi|188593814|dbj|BAG32789.1| probable amidophosphoribosyl-transferase [Porphyromonas gingivalis
           ATCC 33277]
          Length = 246

 Score = 40.8 bits (94), Expect = 0.056,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 27/37 (72%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51
           VAG+++LL+DDV TTGAT + AA  L +A A  + +L
Sbjct: 192 VAGIRVLLVDDVLTTGATVQAAAEPLAEAFAAKIGVL 228


>gi|228923916|ref|ZP_04087193.1| ComF operon protein 3 [Bacillus thuringiensis serovar huazhongensis
           BGSC 4BD1]
 gi|228835715|gb|EEM81079.1| ComF operon protein 3 [Bacillus thuringiensis serovar huazhongensis
           BGSC 4BD1]
          Length = 164

 Score = 40.8 bits (94), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 25/41 (60%)

Query: 16  AGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +G  ILL+DDVYTTG T +     L + GA  VS LT  RS
Sbjct: 124 SGQHILLVDDVYTTGITVRQIGSLLYERGAREVSSLTLCRS 164


>gi|139439949|ref|ZP_01773286.1| Hypothetical protein COLAER_02324 [Collinsella aerofaciens ATCC
           25986]
 gi|133774715|gb|EBA38535.1| Hypothetical protein COLAER_02324 [Collinsella aerofaciens ATCC
           25986]
          Length = 175

 Score = 40.8 bits (94), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 28/43 (65%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           + V G ++LLIDDV TTGAT   A+  LK+AGA  V  L  +R
Sbjct: 131 EDVRGKRLLLIDDVITTGATMAAASAELKRAGATAVDGLAIAR 173


>gi|304322117|ref|YP_003855760.1| competence protein F [Parvularcula bermudensis HTCC2503]
 gi|303301019|gb|ADM10618.1| competence protein F [Parvularcula bermudensis HTCC2503]
          Length = 284

 Score = 40.8 bits (94), Expect = 0.058,   Method: Composition-based stats.
 Identities = 20/43 (46%), Positives = 29/43 (67%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           + G   +L+DDV TTGAT    A  L++AGA++VS +T +R L
Sbjct: 229 IRGRSFVLVDDVLTTGATLLSCARPLRQAGALSVSAVTLARVL 271


>gi|297537770|ref|YP_003673539.1| phosphoribosyltransferase [Methylotenera sp. 301]
 gi|297257117|gb|ADI28962.1| phosphoribosyltransferase [Methylotenera sp. 301]
          Length = 223

 Score = 40.8 bits (94), Expect = 0.058,   Method: Composition-based stats.
 Identities = 21/47 (44%), Positives = 29/47 (61%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           VS H+ G +I ++DDV TTGA+    A  LK+AGA  V     +R+L
Sbjct: 175 VSNHLNGKRIAIVDDVMTTGASLNELAKTLKQAGAAHVECWVVARTL 221


>gi|226327548|ref|ZP_03803066.1| hypothetical protein PROPEN_01419 [Proteus penneri ATCC 35198]
 gi|225204074|gb|EEG86428.1| hypothetical protein PROPEN_01419 [Proteus penneri ATCC 35198]
          Length = 166

 Score = 40.8 bits (94), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +   VS  V+G  + LIDDV TTGAT K     L +AGA +V +    R+L
Sbjct: 112 LKNAFILNNTVS--VSGKNLALIDDVITTGATLKSIVPLLFRAGARSVEVWAICRTL 166


>gi|70732979|ref|YP_262752.1| competence protein ComF [Pseudomonas fluorescens Pf-5]
 gi|68347278|gb|AAY94884.1| competence protein ComF [Pseudomonas fluorescens Pf-5]
          Length = 246

 Score = 40.8 bits (94), Expect = 0.059,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF +       VAG  + L+DDV TTGATA+  A  L  AGA  V I   +R+
Sbjct: 186 LRQAFALAD--QAQVAGRHLALVDDVLTTGATAQALARLLINAGARRVDIYCLART 239


>gi|228993897|ref|ZP_04153800.1| ComF operon protein 3 [Bacillus pseudomycoides DSM 12442]
 gi|228765848|gb|EEM14499.1| ComF operon protein 3 [Bacillus pseudomycoides DSM 12442]
          Length = 144

 Score = 40.8 bits (94), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 8   PQYVSKH--VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           P Y  K     G  +LLIDDVYTTG T +  A  L  AGA  +S LT  R
Sbjct: 94  PFYFHKEEMFIGQHLLLIDDVYTTGITVRQVAKCLYDAGARKISSLTLCR 143


>gi|229112599|ref|ZP_04242136.1| ComF operon protein 3 [Bacillus cereus Rock1-15]
 gi|228670979|gb|EEL26286.1| ComF operon protein 3 [Bacillus cereus Rock1-15]
          Length = 164

 Score = 40.8 bits (94), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 25/41 (60%)

Query: 16  AGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +G  ILL+DDVYTTG T +     L + GA  VS LT  RS
Sbjct: 124 SGQHILLVDDVYTTGITVRQIGSLLYERGAREVSSLTLCRS 164


>gi|34540020|ref|NP_904499.1| competence protein F-like protein [Porphyromonas gingivalis W83]
 gi|34396331|gb|AAQ65398.1| competence protein F-related protein [Porphyromonas gingivalis W83]
          Length = 246

 Score = 40.8 bits (94), Expect = 0.060,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 27/37 (72%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51
           VAG+++LL+DDV TTGAT + AA  L +A A  + +L
Sbjct: 192 VAGIRVLLVDDVLTTGATVQAAAEPLAEAFAAKIGVL 228


>gi|229153346|ref|ZP_04281524.1| ComF operon protein 3 [Bacillus cereus m1550]
 gi|228629950|gb|EEK86601.1| ComF operon protein 3 [Bacillus cereus m1550]
          Length = 163

 Score = 40.8 bits (94), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 25/41 (60%)

Query: 16  AGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +G  ILL+DDVYTTG T +     L + GA  VS LT  RS
Sbjct: 123 SGQHILLVDDVYTTGITVRQIGSLLYERGAREVSSLTLCRS 163


>gi|228942326|ref|ZP_04104865.1| ComF operon protein 3 [Bacillus thuringiensis serovar berliner ATCC
           10792]
 gi|228975256|ref|ZP_04135814.1| ComF operon protein 3 [Bacillus thuringiensis serovar thuringiensis
           str. T01001]
 gi|228981894|ref|ZP_04142189.1| ComF operon protein 3 [Bacillus thuringiensis Bt407]
 gi|228778006|gb|EEM26278.1| ComF operon protein 3 [Bacillus thuringiensis Bt407]
 gi|228784535|gb|EEM32556.1| ComF operon protein 3 [Bacillus thuringiensis serovar thuringiensis
           str. T01001]
 gi|228817370|gb|EEM63456.1| ComF operon protein 3 [Bacillus thuringiensis serovar berliner ATCC
           10792]
          Length = 164

 Score = 40.8 bits (94), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 25/41 (60%)

Query: 16  AGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +G  ILL+DDVYTTG T +     L + GA  VS LT  RS
Sbjct: 124 SGQHILLVDDVYTTGITVRQIGSLLYERGAREVSSLTLCRS 164


>gi|116333274|ref|YP_794801.1| amidophosphoribosyltransferase [Lactobacillus brevis ATCC 367]
 gi|116098621|gb|ABJ63770.1| Predicted amidophosphoribosyltransferase [Lactobacillus brevis ATCC
           367]
          Length = 225

 Score = 40.8 bits (94), Expect = 0.061,   Method: Composition-based stats.
 Identities = 19/39 (48%), Positives = 26/39 (66%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           G ++LL+DDVYTTG T + AA  +   GA  V+ LT +R
Sbjct: 187 GQRVLLLDDVYTTGRTLRHAATQINLTGAKAVTSLTLAR 225


>gi|89052786|ref|YP_508237.1| competence protein F, putative [Jannaschia sp. CCS1]
 gi|88862335|gb|ABD53212.1| competence protein F putative [Jannaschia sp. CCS1]
          Length = 242

 Score = 40.8 bits (94), Expect = 0.061,   Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 27/41 (65%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           + G  ++LIDDV T+GAT   A  A ++AGA  VS+L  +R
Sbjct: 197 IKGRNVVLIDDVMTSGATLAIATDACRRAGAENVSVLALAR 237


>gi|229050852|ref|ZP_04194404.1| ComF operon protein 3 [Bacillus cereus AH676]
 gi|229147721|ref|ZP_04276064.1| ComF operon protein 3 [Bacillus cereus BDRD-ST24]
 gi|228635734|gb|EEK92221.1| ComF operon protein 3 [Bacillus cereus BDRD-ST24]
 gi|228722508|gb|EEL73901.1| ComF operon protein 3 [Bacillus cereus AH676]
          Length = 164

 Score = 40.8 bits (94), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 25/41 (60%)

Query: 16  AGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +G  ILL+DDVYTTG T +     L + GA  VS LT  RS
Sbjct: 124 SGQHILLVDDVYTTGITVRQIGSLLYERGAREVSSLTLCRS 164


>gi|225164226|ref|ZP_03726500.1| competence protein F, putative [Opitutaceae bacterium TAV2]
 gi|224801165|gb|EEG19487.1| competence protein F, putative [Opitutaceae bacterium TAV2]
          Length = 257

 Score = 40.8 bits (94), Expect = 0.062,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           ++NAF +    S + A    +LIDDV+TTG+T    A  L++AGA+ + ++TF
Sbjct: 203 LKNAFALVSGASINPAQ-HYILIDDVFTTGSTLNACARVLRRAGALNLDVVTF 254


>gi|212702061|ref|ZP_03310189.1| hypothetical protein DESPIG_00063 [Desulfovibrio piger ATCC 29098]
 gi|212674576|gb|EEB35059.1| hypothetical protein DESPIG_00063 [Desulfovibrio piger ATCC 29098]
          Length = 186

 Score = 40.8 bits (94), Expect = 0.062,   Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           RNA     + +  V GL + L+DD+ TTG+T + A   L +AGA  V +L  +R+
Sbjct: 131 RNA--AGSFRAADVRGLHLWLVDDIITTGSTLRAAGAELLRAGAARVDVLALART 183


>gi|330954916|gb|EGH55176.1| phosphoribosyltransferase [Pseudomonas syringae Cit 7]
          Length = 244

 Score = 40.8 bits (94), Expect = 0.063,   Method: Composition-based stats.
 Identities = 26/61 (42%), Positives = 36/61 (59%), Gaps = 8/61 (13%)

Query: 1   MRNAFNV--PQYVS-KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF +  P +V  KH+A     L+DDV TTG+TA+  A  L KAGA  V +   +R+ 
Sbjct: 186 LRGAFTLVDPDWVQGKHLA-----LVDDVLTTGSTAEVIARLLNKAGARRVDVYCLARTP 240

Query: 58  K 58
           K
Sbjct: 241 K 241


>gi|190015973|ref|YP_001965181.1| hypothetical protein PNSL1.078 [Rhodococcus sp. NS1]
 gi|114796813|gb|ABI79406.1| hypothetical protein PNSL1.078 [Rhodococcus sp. NS1]
          Length = 249

 Score = 40.8 bits (94), Expect = 0.063,   Method: Composition-based stats.
 Identities = 18/41 (43%), Positives = 29/41 (70%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           G  ++++DD +T+G  A+  ++ALK+AG   VSILT +R L
Sbjct: 176 GGHVMVLDDTWTSGGHAQSLSVALKRAGVGAVSILTVARWL 216


>gi|285017173|ref|YP_003374884.1| amidophosphoribosyltransferase [Xanthomonas albilineans GPE PC73]
 gi|283472391|emb|CBA14896.1| putative competence protein (amidophosphoribosyltransferases)
           [Xanthomonas albilineans]
          Length = 243

 Score = 40.8 bits (94), Expect = 0.064,   Method: Composition-based stats.
 Identities = 26/57 (45%), Positives = 31/57 (54%), Gaps = 7/57 (12%)

Query: 1   MRNAFNVPQ--YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +R AF VP    +  HVA     LIDDV TTGAT   AA AL++AG   V     +R
Sbjct: 190 LRGAFAVPDPAVLPAHVA-----LIDDVMTTGATLHAAAQALRRAGVTRVDAWVVAR 241


>gi|253579910|ref|ZP_04857178.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251848909|gb|EES76871.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 234

 Score = 40.8 bits (94), Expect = 0.064,   Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 26/42 (61%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
           V+  V G  IL+IDDVYTTG+T    A  LK+ GA  V  LT
Sbjct: 187 VTGDVRGKNILVIDDVYTTGSTIDAMAGCLKRKGAGNVYFLT 228


>gi|197302526|ref|ZP_03167581.1| hypothetical protein RUMLAC_01254 [Ruminococcus lactaris ATCC
           29176]
 gi|197298424|gb|EDY32969.1| hypothetical protein RUMLAC_01254 [Ruminococcus lactaris ATCC
           29176]
          Length = 186

 Score = 40.8 bits (94), Expect = 0.068,   Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 25/35 (71%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ILLIDD+YT+G+T + AA  LK+AG   V  LT S
Sbjct: 147 ILLIDDIYTSGSTMEHAAGILKRAGVQNVYFLTVS 181


>gi|313676475|ref|YP_004054471.1| phosphoribosyltransferase [Marivirga tractuosa DSM 4126]
 gi|312943173|gb|ADR22363.1| phosphoribosyltransferase [Marivirga tractuosa DSM 4126]
          Length = 235

 Score = 40.8 bits (94), Expect = 0.069,   Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 30/43 (69%), Gaps = 1/43 (2%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           S  + G +ILL+DDV TTGAT +  +  L+KAGA  +SI+T S
Sbjct: 190 STSLKGKRILLVDDVLTTGATVQACSEPLQKAGA-EISIVTIS 231


>gi|229829628|ref|ZP_04455697.1| hypothetical protein GCWU000342_01725 [Shuttleworthia satelles DSM
           14600]
 gi|229791617|gb|EEP27731.1| hypothetical protein GCWU000342_01725 [Shuttleworthia satelles DSM
           14600]
          Length = 258

 Score = 40.8 bits (94), Expect = 0.069,   Method: Composition-based stats.
 Identities = 19/36 (52%), Positives = 26/36 (72%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
           G +ILL+DD+YTTG+T   A+  L +AGA  V +LT
Sbjct: 215 GNRILLVDDIYTTGSTCDAASKVLLEAGAEAVYLLT 250


>gi|209883247|ref|YP_002287104.1| phosphoribosyltransferase [Oligotropha carboxidovorans OM5]
 gi|209871443|gb|ACI91239.1| phosphoribosyltransferase [Oligotropha carboxidovorans OM5]
          Length = 278

 Score = 40.8 bits (94), Expect = 0.070,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 32/55 (58%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++ AF V       V G + +LIDDV T+GAT +    AL +A A +V +L F+R
Sbjct: 215 VQGAFAVEADQRAAVKGRRFILIDDVLTSGATTQACTRALLRAKAASVDVLVFAR 269


>gi|78045960|ref|YP_362135.1| putative competence protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|78034390|emb|CAJ22035.1| putative competence protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
          Length = 241

 Score = 40.8 bits (94), Expect = 0.070,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 30/55 (54%), Gaps = 5/55 (9%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +R+AF     +  HVA     L+DDV TTGAT   AA AL+KAG   V     +R
Sbjct: 190 LRDAFEARGALPAHVA-----LVDDVMTTGATLHAAAKALRKAGVQRVDAWVCAR 239


>gi|253569488|ref|ZP_04846898.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|251841507|gb|EES69588.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
          Length = 235

 Score = 40.4 bits (93), Expect = 0.071,   Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 29/45 (64%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           + S+H+AG  IL++DDV TTGAT    A  L +   + +S+LT +
Sbjct: 188 HCSEHLAGKHILIVDDVLTTGATTVACASRLAEIEGVRISVLTLA 232


>gi|57233732|ref|YP_182161.1| comF family protein, putative [Dehalococcoides ethenogenes 195]
 gi|57224180|gb|AAW39237.1| comF family protein, putative [Dehalococcoides ethenogenes 195]
          Length = 233

 Score = 40.4 bits (93), Expect = 0.071,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 27/37 (72%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++++IDDV TTGAT    A  LK+AGA++V  LT +R
Sbjct: 195 RVIIIDDVATTGATLNACAATLKEAGALSVWGLTIAR 231


>gi|331005762|ref|ZP_08329121.1| Competence protein F [gamma proteobacterium IMCC1989]
 gi|330420399|gb|EGG94706.1| Competence protein F [gamma proteobacterium IMCC1989]
          Length = 249

 Score = 40.4 bits (93), Expect = 0.071,   Method: Composition-based stats.
 Identities = 21/45 (46%), Positives = 27/45 (60%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           V+  +  L +++IDDV TTGAT      ALKKAGA  VS    +R
Sbjct: 202 VTSPLNNLHVVIIDDVMTTGATVDAMTTALKKAGAGKVSAWVLAR 246


>gi|257440338|ref|ZP_05616093.1| competence protein F-related protein [Faecalibacterium prausnitzii
           A2-165]
 gi|257197184|gb|EEU95468.1| competence protein F-related protein [Faecalibacterium prausnitzii
           A2-165]
          Length = 259

 Score = 40.4 bits (93), Expect = 0.071,   Method: Composition-based stats.
 Identities = 21/34 (61%), Positives = 24/34 (70%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           V G +ILL+DDV TTGATA   A AL  AGA +V
Sbjct: 199 VEGKRILLVDDVLTTGATASACAQALLDAGAQSV 232


>gi|67920504|ref|ZP_00514024.1| conserved hypothetical protein [Crocosphaera watsonii WH 8501]
 gi|67857988|gb|EAM53227.1| conserved hypothetical protein [Crocosphaera watsonii WH 8501]
          Length = 219

 Score = 40.4 bits (93), Expect = 0.071,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 31/54 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF + + + KH     +LL+DD+YTTG T K AA  L+  G   + ++  S
Sbjct: 161 IKGAFKLGKTLEKHSLSRPVLLVDDIYTTGTTFKEAAKILRDNGIKVLGVVAVS 214


>gi|229130437|ref|ZP_04259394.1| ComF operon protein 3 [Bacillus cereus BDRD-Cer4]
 gi|228653032|gb|EEL08913.1| ComF operon protein 3 [Bacillus cereus BDRD-Cer4]
          Length = 190

 Score = 40.4 bits (93), Expect = 0.072,   Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 26/41 (63%)

Query: 16  AGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +G  ILL+DDVYTTG+T +     L + GA  VS LT  RS
Sbjct: 150 SGQHILLVDDVYTTGSTVRQIGSLLYERGAREVSSLTLCRS 190


>gi|30023225|ref|NP_834856.1| comF operon protein 3 [Bacillus cereus ATCC 14579]
 gi|29898785|gb|AAP12057.1| Competence protein F [Bacillus cereus ATCC 14579]
          Length = 234

 Score = 40.4 bits (93), Expect = 0.072,   Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 26/41 (63%)

Query: 16  AGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +G  ILL+DDVYTTG+T +     L + GA  VS LT  RS
Sbjct: 194 SGQHILLVDDVYTTGSTVRQIGSLLYERGAREVSSLTLCRS 234


>gi|332708842|ref|ZP_08428813.1| putative amidophosphoribosyltransferase [Lyngbya majuscula 3L]
 gi|332352384|gb|EGJ31953.1| putative amidophosphoribosyltransferase [Lyngbya majuscula 3L]
          Length = 229

 Score = 40.4 bits (93), Expect = 0.072,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 38/61 (62%), Gaps = 3/61 (4%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAM---TVSILTFSRSL 57
           + +AF + ++  +H +   +L++DD+YT+GAT K A   L+K G     +V+I T + S+
Sbjct: 169 LADAFIIGKHFLRHHSTSPVLILDDIYTSGATVKSATQTLRKHGITVYGSVAIATSTASV 228

Query: 58  K 58
           K
Sbjct: 229 K 229


>gi|329902630|ref|ZP_08273189.1| Competence protein F [Oxalobacteraceae bacterium IMCC9480]
 gi|327548688|gb|EGF33333.1| Competence protein F [Oxalobacteraceae bacterium IMCC9480]
          Length = 210

 Score = 40.4 bits (93), Expect = 0.073,   Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 30/53 (56%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           AF VP      V G  + ++DDV TTGAT    A  LK+ GA  V+ L F+R+
Sbjct: 155 AFVVPVQAMASVDGRHVGVVDDVMTTGATLHEVAATLKRYGARRVTNLVFART 207


>gi|78188183|ref|YP_378521.1| competence protein [Chlorobium chlorochromatii CaD3]
 gi|78170382|gb|ABB27478.1| competence protein [Chlorobium chlorochromatii CaD3]
          Length = 269

 Score = 40.4 bits (93), Expect = 0.073,   Method: Composition-based stats.
 Identities = 21/40 (52%), Positives = 27/40 (67%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +LL+DDV TTGAT   AA AL  AG   VSI+T + + K+
Sbjct: 229 VLLVDDVLTTGATMVAAAQALHDAGVAKVSIVTVAVAAKE 268


>gi|110800186|ref|YP_696852.1| competence protein FC [Clostridium perfringens ATCC 13124]
 gi|168210103|ref|ZP_02635728.1| comF protein, homolog [Clostridium perfringens B str. ATCC 3626]
 gi|110674833|gb|ABG83820.1| comF protein, homolog [Clostridium perfringens ATCC 13124]
 gi|170711747|gb|EDT23929.1| comF protein, homolog [Clostridium perfringens B str. ATCC 3626]
          Length = 219

 Score = 40.4 bits (93), Expect = 0.074,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF + +Y  +++ G  I+L+DDV TTG+T K     LKK   + + +LT ++S
Sbjct: 164 VKNAFYLKRY--RNLEGKSIILLDDVMTTGSTLKACVRELKKIKDIKIFLLTIAKS 217


>gi|282895558|ref|ZP_06303692.1| conserved hypothetical protein [Raphidiopsis brookii D9]
 gi|281199398|gb|EFA74262.1| conserved hypothetical protein [Raphidiopsis brookii D9]
          Length = 220

 Score = 40.4 bits (93), Expect = 0.075,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 31/58 (53%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +  AF++ +    H     ILL+DD+YTTGATA  A   L   G   +   T ++++K
Sbjct: 160 LMGAFDLGKDFVNHYPSKPILLVDDIYTTGATANSATHTLDGYGINVIGFATVAKAIK 217


>gi|254446148|ref|ZP_05059624.1| hypothetical protein VDG1235_4397 [Verrucomicrobiae bacterium
           DG1235]
 gi|198260456|gb|EDY84764.1| hypothetical protein VDG1235_4397 [Verrucomicrobiae bacterium
           DG1235]
          Length = 174

 Score = 40.4 bits (93), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 35/52 (67%), Gaps = 1/52 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
           ++NAF++ Q  +   A  + +++DDV+TTG+T    A AL+++GA  + +LT
Sbjct: 120 LKNAFSLRQNRAIDPAQ-RYIIVDDVFTTGSTVNACAAALRRSGARQIDVLT 170


>gi|87200124|ref|YP_497381.1| phosphoribosyltransferase [Novosphingobium aromaticivorans DSM
           12444]
 gi|87135805|gb|ABD26547.1| phosphoribosyltransferase [Novosphingobium aromaticivorans DSM
           12444]
          Length = 269

 Score = 40.4 bits (93), Expect = 0.075,   Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 26/41 (63%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           K+LL+DDV T+GAT      AL++AG   V I  F+R L +
Sbjct: 207 KVLLVDDVMTSGATTNACITALRRAGVAEVRIACFARVLDE 247


>gi|257877559|ref|ZP_05657212.1| competence protein ComFC [Enterococcus casseliflavus EC20]
 gi|257811725|gb|EEV40545.1| competence protein ComFC [Enterococcus casseliflavus EC20]
          Length = 226

 Score = 40.4 bits (93), Expect = 0.077,   Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 30/51 (58%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           F V   V+  + G K+LLIDDVYTTG T   AA AL+  G  ++   + +R
Sbjct: 176 FAVKPDVACEIKGKKLLLIDDVYTTGRTLYHAAEALQSFGPQSIRSFSIAR 226


>gi|257867480|ref|ZP_05647133.1| competence protein ComFC [Enterococcus casseliflavus EC30]
 gi|257873809|ref|ZP_05653462.1| competence protein ComFC [Enterococcus casseliflavus EC10]
 gi|257801536|gb|EEV30466.1| competence protein ComFC [Enterococcus casseliflavus EC30]
 gi|257807973|gb|EEV36795.1| competence protein ComFC [Enterococcus casseliflavus EC10]
          Length = 226

 Score = 40.4 bits (93), Expect = 0.077,   Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 30/51 (58%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           F V   V+  + G K+LLIDDVYTTG T   AA AL+  G  ++   + +R
Sbjct: 176 FAVKPDVACEIKGKKLLLIDDVYTTGRTLYHAAEALQSFGPQSIRSFSIAR 226


>gi|302185790|ref|ZP_07262463.1| phosphoribosyltransferase [Pseudomonas syringae pv. syringae 642]
          Length = 244

 Score = 40.4 bits (93), Expect = 0.078,   Method: Composition-based stats.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 6/60 (10%)

Query: 1   MRNAFNV--PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +  P +V     G  + LIDDV TTG+TA+  A  L KAGA  V +   +R+ K
Sbjct: 186 LRGAFTLVDPDWVQ----GRHLALIDDVVTTGSTAEVIARLLNKAGARRVDVYCLARTPK 241


>gi|259502720|ref|ZP_05745622.1| competence protein F [Lactobacillus antri DSM 16041]
 gi|259169365|gb|EEW53860.1| competence protein F [Lactobacillus antri DSM 16041]
          Length = 141

 Score = 40.4 bits (93), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 33/59 (55%), Gaps = 5/59 (8%)

Query: 2   RNAFNVPQYV-----SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           R     PQ       SK VAG ++LL+DDVYTTG T   AA  + +AGA  V  ++ +R
Sbjct: 83  RERLRTPQPFVLSDSSKAVAGKRVLLVDDVYTTGRTLYHAADLIYQAGAAGVISISLAR 141


>gi|118581139|ref|YP_902389.1| competence protein F [Pelobacter propionicus DSM 2379]
 gi|118503849|gb|ABL00332.1| competence protein F, putative [Pelobacter propionicus DSM 2379]
          Length = 245

 Score = 40.4 bits (93), Expect = 0.078,   Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 36/55 (65%), Gaps = 2/55 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +R+AF V    +  V+G ++LL+DDV+TTG+T +  +  L +AG   + ++T SR
Sbjct: 190 VRDAFRVKN--ASLVSGKRVLLVDDVFTTGSTVEECSRILMQAGTGELLVVTVSR 242


>gi|259046380|ref|ZP_05736781.1| competence protein ComF [Granulicatella adiacens ATCC 49175]
 gi|259036925|gb|EEW38180.1| competence protein ComF [Granulicatella adiacens ATCC 49175]
          Length = 226

 Score = 40.4 bits (93), Expect = 0.079,   Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 24/37 (64%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           K+LL+DDVYTTGAT   AA  L++ G   V  LT  R
Sbjct: 190 KVLLVDDVYTTGATIHLAARTLREMGVEEVESLTLFR 226


>gi|293364485|ref|ZP_06611210.1| conserved hypothetical protein [Streptococcus oralis ATCC 35037]
 gi|291316993|gb|EFE57421.1| conserved hypothetical protein [Streptococcus oralis ATCC 35037]
          Length = 172

 Score = 40.4 bits (93), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 2   RNAFNVPQYVSKHVA-GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           R A  +P ++   ++   KILLIDD+YTTGAT       L++AGA+ V   +  R
Sbjct: 118 RLATEIPFFIKDGISFPKKILLIDDIYTTGATVNRVKRLLEEAGALEVKTFSLVR 172


>gi|168215802|ref|ZP_02641427.1| comF protein, homolog [Clostridium perfringens NCTC 8239]
 gi|182382373|gb|EDT79852.1| comF protein, homolog [Clostridium perfringens NCTC 8239]
          Length = 219

 Score = 40.4 bits (93), Expect = 0.080,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +  Y  K++ G  I+L+DDV TTG+T K     LKK   + + +LT ++S
Sbjct: 164 VQNAFYLKSY--KNLEGKSIILLDDVMTTGSTLKACVRELKKIKDIKIFLLTIAKS 217


>gi|331701708|ref|YP_004398667.1| phosphoribosyltransferase [Lactobacillus buchneri NRRL B-30929]
 gi|329129051|gb|AEB73604.1| phosphoribosyltransferase [Lactobacillus buchneri NRRL B-30929]
          Length = 230

 Score = 40.4 bits (93), Expect = 0.083,   Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 30/51 (58%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           F + +     V    +LL+DDVYTTG T + AA  +++AGA +V   T +R
Sbjct: 180 FEMIESQKNQVKNRAVLLVDDVYTTGTTIRHAAALIQQAGAASVKGFTLAR 230


>gi|228903665|ref|ZP_04067785.1| ComF operon protein 3 [Bacillus thuringiensis IBL 4222]
 gi|228968292|ref|ZP_04129290.1| ComF operon protein 3 [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|228791465|gb|EEM39069.1| ComF operon protein 3 [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|228855933|gb|EEN00473.1| ComF operon protein 3 [Bacillus thuringiensis IBL 4222]
          Length = 164

 Score = 40.4 bits (93), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 24/40 (60%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           G  ILL+DDVYTTG T +     L + GA  VS LT  RS
Sbjct: 125 GQHILLVDDVYTTGITVRQIGSLLYERGAREVSSLTLCRS 164


>gi|182415338|ref|YP_001820404.1| competence protein F, putative [Opitutus terrae PB90-1]
 gi|177842552|gb|ACB76804.1| competence protein F, putative [Opitutus terrae PB90-1]
          Length = 244

 Score = 40.4 bits (93), Expect = 0.084,   Method: Composition-based stats.
 Identities = 16/33 (48%), Positives = 26/33 (78%)

Query: 21  LLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           LL+DDV+TTG+T    A  L++AGA+++ ++TF
Sbjct: 209 LLVDDVFTTGSTLNSCAQTLRRAGAVSLDVVTF 241


>gi|325929420|ref|ZP_08190548.1| putative amidophosphoribosyltransferase [Xanthomonas perforans
           91-118]
 gi|325540195|gb|EGD11809.1| putative amidophosphoribosyltransferase [Xanthomonas perforans
           91-118]
          Length = 222

 Score = 40.4 bits (93), Expect = 0.085,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 30/55 (54%), Gaps = 5/55 (9%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +R+AF     +  HVA     L+DDV TTGAT   AA AL+KAG   V     +R
Sbjct: 171 LRDAFEARGALPAHVA-----LVDDVMTTGATLHAAAKALRKAGVQRVDAWVCAR 220


>gi|298528419|ref|ZP_07015823.1| phosphoribosyltransferase [Desulfonatronospira thiodismutans
           ASO3-1]
 gi|298512071|gb|EFI35973.1| phosphoribosyltransferase [Desulfonatronospira thiodismutans
           ASO3-1]
          Length = 262

 Score = 40.4 bits (93), Expect = 0.086,   Method: Composition-based stats.
 Identities = 20/43 (46%), Positives = 27/43 (62%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           V G  ILL+DD+YTTG+T +     L KAGA  V +L  +R +
Sbjct: 219 VRGQSILLVDDIYTTGSTLEECTRTLIKAGASRVQVLFLARGV 261


>gi|270308613|ref|YP_003330671.1| ComF [Dehalococcoides sp. VS]
 gi|270154505|gb|ACZ62343.1| ComF [Dehalococcoides sp. VS]
          Length = 233

 Score = 40.4 bits (93), Expect = 0.086,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 27/37 (72%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++++IDDV TTGAT    A  LK+AGA++V  LT +R
Sbjct: 195 RVIIIDDVATTGATLNACAATLKEAGALSVWGLTIAR 231


>gi|254486071|ref|ZP_05099276.1| competence protein F [Roseobacter sp. GAI101]
 gi|214042940|gb|EEB83578.1| competence protein F [Roseobacter sp. GAI101]
          Length = 242

 Score = 40.4 bits (93), Expect = 0.087,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 34/59 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  A  V    ++ + G  +L++DDV T+GAT   AA A   AGA ++ ++T +R  KD
Sbjct: 183 LEGAITVHPKRAERLQGRSVLIVDDVMTSGATLCSAAKACIDAGAGSIRVVTLARVAKD 241


>gi|320326429|gb|EFW82482.1| competence protein ComF [Pseudomonas syringae pv. glycinea str.
           B076]
          Length = 244

 Score = 40.4 bits (93), Expect = 0.090,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +       V G  + L+DDV TTG+TA+  A  L KAGA  V +   +R+ K
Sbjct: 186 LRDAFTLVD--PDRVQGKHLALVDDVLTTGSTAEVIARLLNKAGARRVDVYCLARTPK 241


>gi|304386243|ref|ZP_07368576.1| amidophosphoribosyltransferase [Pediococcus acidilactici DSM 20284]
 gi|304327600|gb|EFL94827.1| amidophosphoribosyltransferase [Pediococcus acidilactici DSM 20284]
          Length = 215

 Score = 40.4 bits (93), Expect = 0.090,   Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           N F V +     VAG K ++IDD+YTTG T + A   L K GA  V  +T  R
Sbjct: 165 NPFRVVE--PNKVAGAKWVIIDDIYTTGVTVRQAGRELSKHGARQVRSITLCR 215


>gi|270290718|ref|ZP_06196942.1| ComF operon protein 3 [Pediococcus acidilactici 7_4]
 gi|270280778|gb|EFA26612.1| ComF operon protein 3 [Pediococcus acidilactici 7_4]
          Length = 224

 Score = 40.4 bits (93), Expect = 0.090,   Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           N F V +     VAG K ++IDD+YTTG T + A   L K GA  V  +T  R
Sbjct: 174 NPFRVVE--PNKVAGAKWVIIDDIYTTGVTVRQAGRELSKHGARQVRSITLCR 224


>gi|226225060|ref|YP_002759167.1| late competence protein comFC [Listeria monocytogenes Clip81459]
 gi|254932247|ref|ZP_05265606.1| comFC family protein [Listeria monocytogenes HPB2262]
 gi|225877522|emb|CAS06236.1| Putative late competence protein comFC [Listeria monocytogenes
           serotype 4b str. CLIP 80459]
 gi|293583804|gb|EFF95836.1| comFC family protein [Listeria monocytogenes HPB2262]
 gi|332312942|gb|EGJ26037.1| ComFC family protein [Listeria monocytogenes str. Scott A]
          Length = 218

 Score = 40.4 bits (93), Expect = 0.091,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +++L DD+YTTG+T   AA  LK+AG   VS LT  R
Sbjct: 182 EVILFDDIYTTGSTLNLAAQILKEAGVYKVSALTIFR 218


>gi|327400751|ref|YP_004341590.1| phosphoribosyltransferase [Archaeoglobus veneficus SNP6]
 gi|327316259|gb|AEA46875.1| phosphoribosyltransferase [Archaeoglobus veneficus SNP6]
          Length = 240

 Score = 40.0 bits (92), Expect = 0.092,   Method: Composition-based stats.
 Identities = 19/40 (47%), Positives = 29/40 (72%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           G K++L+DDVYTTG TA+ A   + +AGA  V I+T +++
Sbjct: 185 GKKVILLDDVYTTGNTARAAVQRIYEAGADKVWIITLAKT 224


>gi|46908684|ref|YP_015073.1| comFC family protein [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47093714|ref|ZP_00231466.1| comF operon protein 3, putative [Listeria monocytogenes str. 4b
           H7858]
 gi|254825366|ref|ZP_05230367.1| comFC family protein [Listeria monocytogenes FSL J1-194]
 gi|254853959|ref|ZP_05243307.1| comFC family protein [Listeria monocytogenes FSL R2-503]
 gi|254993059|ref|ZP_05275249.1| comFC family protein [Listeria monocytogenes FSL J2-064]
 gi|255521851|ref|ZP_05389088.1| comFC family protein [Listeria monocytogenes FSL J1-175]
 gi|300764989|ref|ZP_07074977.1| comF operon protein 3 [Listeria monocytogenes FSL N1-017]
 gi|46881956|gb|AAT05250.1| comFC family protein [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47017908|gb|EAL08689.1| comF operon protein 3, putative [Listeria monocytogenes str. 4b
           H7858]
 gi|258607349|gb|EEW19957.1| comFC family protein [Listeria monocytogenes FSL R2-503]
 gi|293594609|gb|EFG02370.1| comFC family protein [Listeria monocytogenes FSL J1-194]
 gi|300514289|gb|EFK41348.1| comF operon protein 3 [Listeria monocytogenes FSL N1-017]
 gi|328465118|gb|EGF36386.1| comFC family protein [Listeria monocytogenes 1816]
          Length = 218

 Score = 40.0 bits (92), Expect = 0.094,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +++L DD+YTTG+T   AA  LK+AG   VS LT  R
Sbjct: 182 EVILFDDIYTTGSTLNLAAQILKEAGVYKVSALTIFR 218


>gi|182623970|ref|ZP_02951758.1| comF protein, homolog [Clostridium perfringens D str. JGS1721]
 gi|177910863|gb|EDT73217.1| comF protein, homolog [Clostridium perfringens D str. JGS1721]
          Length = 219

 Score = 40.0 bits (92), Expect = 0.096,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +  Y  K++ G  I+L+DDV TTG+T K     LKK   + + +LT ++S
Sbjct: 164 VQNAFCLKSY--KNLEGKSIILLDDVMTTGSTLKACVRELKKIKDIKIFLLTIAKS 217


>gi|39995235|ref|NP_951186.1| competence protein F [Geobacter sulfurreducens PCA]
 gi|39981997|gb|AAR33459.1| competence protein F, putative [Geobacter sulfurreducens PCA]
 gi|298504239|gb|ADI82962.1| amidophosphoribosyltransferase, putative [Geobacter sulfurreducens
           KN400]
          Length = 238

 Score = 40.0 bits (92), Expect = 0.097,   Method: Composition-based stats.
 Identities = 20/42 (47%), Positives = 29/42 (69%), Gaps = 2/42 (4%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKK 42
           +R AF VP   +  VAG ++LL+DDV+TTG+T    A+ L+K
Sbjct: 184 IRGAFAVPSPAA--VAGRRVLLLDDVFTTGSTIAECALVLRK 223


>gi|218889229|ref|YP_002438093.1| putative phosphoribosyl transferase [Pseudomonas aeruginosa LESB58]
 gi|218769452|emb|CAW25212.1| probable phosphoribosyl transferase [Pseudomonas aeruginosa LESB58]
          Length = 241

 Score = 40.0 bits (92), Expect = 0.098,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +    +  V GL + L+DDV TTGAT +  +  L++AGA  V +   +R+ K
Sbjct: 184 LRHAFALAP--ASDVRGLHLALVDDVLTTGATTEHLSRLLRRAGAARVDVYCLARTPK 239


>gi|254243583|ref|ZP_04936905.1| hypothetical protein PA2G_04406 [Pseudomonas aeruginosa 2192]
 gi|126196961|gb|EAZ61024.1| hypothetical protein PA2G_04406 [Pseudomonas aeruginosa 2192]
          Length = 241

 Score = 40.0 bits (92), Expect = 0.098,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +    +  V GL + L+DDV TTGAT +  +  L++AGA  V +   +R+ K
Sbjct: 184 LRHAFALAP--ASDVRGLHLALVDDVLTTGATTEHLSRLLRRAGAARVDVYCLARTPK 239


>gi|107099475|ref|ZP_01363393.1| hypothetical protein PaerPA_01000487 [Pseudomonas aeruginosa PACS2]
          Length = 229

 Score = 40.0 bits (92), Expect = 0.098,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +    +  V GL + L+DDV TTGAT +  +  L++AGA  V +   +R+ K
Sbjct: 172 LRHAFALAP--ASDVRGLHLALVDDVLTTGATTEHLSRLLRRAGAARVDVYCLARTPK 227


>gi|92116101|ref|YP_575830.1| phosphoribosyltransferase [Nitrobacter hamburgensis X14]
 gi|91798995|gb|ABE61370.1| phosphoribosyltransferase [Nitrobacter hamburgensis X14]
          Length = 270

 Score = 40.0 bits (92), Expect = 0.099,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 32/55 (58%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++ AF +    +  + G ++++IDDV T+GAT    A  L +A A  V +L F+R
Sbjct: 207 VQGAFKIATERTSRIQGRRVIVIDDVLTSGATVDACARVLLRAKAAQVDVLVFAR 261


>gi|48428733|gb|AAT42382.1| putative amidophosphoribosyltransferase [Collimonas fungivorans
           Ter331]
          Length = 236

 Score = 40.0 bits (92), Expect = 0.099,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 30/56 (53%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF VP      + G  I ++DDV TTG T    A  L++ GA  ++   F+R+
Sbjct: 180 LRQAFIVPPAAMMQIRGRHIGVVDDVMTTGETLHALAQTLRRHGASRITNFVFART 235


>gi|310644341|ref|YP_003949100.1| amidophosphoribosyltransferase-like protein [Paenibacillus polymyxa
           SC2]
 gi|309249292|gb|ADO58859.1| Amidophosphoribosyltransferase-like protein [Paenibacillus polymyxa
           SC2]
          Length = 188

 Score = 40.0 bits (92), Expect = 0.10,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 33/53 (62%), Gaps = 5/53 (9%)

Query: 9   QYVSKHVAGLKILLIDDVYTTGATAKCAA-----IALKKAGAMTVSILTFSRS 56
           Q  ++H   + ILL+DD+YTTG+T +  A     +AL++   + +  LTF+RS
Sbjct: 136 QRATEHRHSVTILLVDDIYTTGSTLQACARVLREMALEQGVHLAIFCLTFARS 188


>gi|73749136|ref|YP_308375.1| putative comF family protein [Dehalococcoides sp. CBDB1]
 gi|147669898|ref|YP_001214716.1| amidophosphoribosyltransferase-like protein [Dehalococcoides sp.
           BAV1]
 gi|289433110|ref|YP_003462983.1| phosphoribosyltransferase [Dehalococcoides sp. GT]
 gi|73660852|emb|CAI83459.1| putative comF family protein [Dehalococcoides sp. CBDB1]
 gi|146270846|gb|ABQ17838.1| amidophosphoribosyltransferase-like protein [Dehalococcoides sp.
           BAV1]
 gi|288946830|gb|ADC74527.1| phosphoribosyltransferase [Dehalococcoides sp. GT]
          Length = 233

 Score = 40.0 bits (92), Expect = 0.10,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 27/37 (72%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++++IDDV TTGAT    A  LK+AGA++V  LT +R
Sbjct: 195 RVIIIDDVATTGATLNACAATLKEAGALSVWGLTIAR 231


>gi|116873876|ref|YP_850657.1| comFC family protein [Listeria welshimeri serovar 6b str. SLCC5334]
 gi|116742754|emb|CAK21878.1| comFC family protein [Listeria welshimeri serovar 6b str. SLCC5334]
          Length = 218

 Score = 40.0 bits (92), Expect = 0.10,   Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 26/38 (68%)

Query: 18  LKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           L+++L DD+YTTG+T   AA  LK+AG   V+ LT  R
Sbjct: 181 LEVILFDDIYTTGSTLNLAAQILKEAGVKKVTALTIFR 218


>gi|323698874|ref|ZP_08110786.1| phosphoribosyltransferase [Desulfovibrio sp. ND132]
 gi|323458806|gb|EGB14671.1| phosphoribosyltransferase [Desulfovibrio desulfuricans ND132]
          Length = 246

 Score = 40.0 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 18/45 (40%), Positives = 29/45 (64%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           V G ++LL+DDVYTTG+T    A  L +AG   + +L  +R+ ++
Sbjct: 197 VRGRRLLLVDDVYTTGSTLNECARTLLRAGCTGLDVLVLARTQRE 241


>gi|54295172|ref|YP_127587.1| hypothetical protein lpl2252 [Legionella pneumophila str. Lens]
 gi|53755004|emb|CAH16492.1| hypothetical protein lpl2252 [Legionella pneumophila str. Lens]
          Length = 234

 Score = 40.0 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 5/57 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R+AF VP    +HV     +++DD+ TTG+TA   A  LK AG   V I   +R++
Sbjct: 180 LRHAFYVPHVTYEHV-----MIVDDLLTTGSTANEMAHTLKNAGVKRVDICCCARAV 231


>gi|189502636|ref|YP_001958353.1| hypothetical protein Aasi_1314 [Candidatus Amoebophilus asiaticus
           5a2]
 gi|189498077|gb|ACE06624.1| hypothetical protein Aasi_1314 [Candidatus Amoebophilus asiaticus
           5a2]
          Length = 226

 Score = 40.0 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
           +R+AF V    +  + G  +LL+DD+ TTGAT +  A+ L  AGA  VSI
Sbjct: 172 LRDAFYVVN--TSLIQGKHVLLVDDIITTGATLEACALPLLAAGAKEVSI 219


>gi|118444213|ref|YP_878983.1| competence protein F [Clostridium novyi NT]
 gi|118134669|gb|ABK61713.1| competence protein F [Clostridium novyi NT]
          Length = 226

 Score = 40.0 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 22/38 (57%), Positives = 26/38 (68%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           K+LL+DDV TTGAT    A  LKK GA  V ILT ++S
Sbjct: 187 KVLLVDDVLTTGATTFYCAKELKKNGAEDVIILTVAKS 224


>gi|163753258|ref|ZP_02160382.1| putative amidophosphoribosyl-transferase [Kordia algicida OT-1]
 gi|161326990|gb|EDP98315.1| putative amidophosphoribosyl-transferase [Kordia algicida OT-1]
          Length = 205

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 27/40 (67%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +A   ILL+DDV TTGAT +  A ALKK   +T+S+ T S
Sbjct: 163 LANTHILLVDDVITTGATLEACANALKKIPNITISVATMS 202


>gi|313617176|gb|EFR89690.1| comFC family protein [Listeria innocua FSL S4-378]
          Length = 218

 Score = 40.0 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 26/37 (70%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +I+L DD+YTTG+T   AA ALK++G   V+ LT  R
Sbjct: 182 EIILFDDIYTTGSTLNLAAQALKESGMKKVTSLTIFR 218


>gi|78044328|ref|YP_359025.1| putative competence protein [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|77996443|gb|ABB15342.1| putative competence protein [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 229

 Score = 40.0 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 28/40 (70%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           KILL+DDV+TTGATA+     L  AGA  V ++T + ++K
Sbjct: 189 KILLVDDVFTTGATAQECTRTLLLAGADKVYVITMATAVK 228


>gi|332982900|ref|YP_004464341.1| phosphoribosyltransferase [Mahella australiensis 50-1 BON]
 gi|332700578|gb|AEE97519.1| phosphoribosyltransferase [Mahella australiensis 50-1 BON]
          Length = 243

 Score = 40.0 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           AF+V    +K + G  I+LIDD+ TTGATA   A AL   GA  V + T +
Sbjct: 190 AFDVKD--AKDIKGKTIMLIDDILTTGATADACAQALLVGGANAVYVFTLA 238


>gi|192361736|ref|YP_001980949.1| competence protein ComF [Cellvibrio japonicus Ueda107]
 gi|190687901|gb|ACE85579.1| competence protein ComF [Cellvibrio japonicus Ueda107]
          Length = 252

 Score = 40.0 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 30/56 (53%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF         + G  + L+DDV TT ATA+C +  L +AGA  V I   +R+
Sbjct: 188 LRRAFAQEPKRCPAIQGKHLALVDDVVTTSATARCLSELLVRAGAARVDIWALART 243


>gi|238916194|ref|YP_002929711.1| competence protein ComFC [Eubacterium eligens ATCC 27750]
 gi|238871554|gb|ACR71264.1| competence protein ComFC [Eubacterium eligens ATCC 27750]
          Length = 243

 Score = 40.0 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 20/48 (41%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           ++NAF   + V ++    K+L++DD+YTTGAT    A  LK AG   V
Sbjct: 188 LQNAFQAGEKVVRYS---KVLIVDDIYTTGATFDACAAVLKHAGVQEV 232


>gi|223939439|ref|ZP_03631317.1| competence protein F, putative [bacterium Ellin514]
 gi|223891931|gb|EEF58414.1| competence protein F, putative [bacterium Ellin514]
          Length = 247

 Score = 40.0 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 18/41 (43%), Positives = 26/41 (63%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           G K++++DDV+TTGAT    A  LK AG   + + T +R L
Sbjct: 207 GKKLVILDDVFTTGATTSACAKLLKPAGVADICVWTVARGL 247


>gi|254497861|ref|ZP_05110627.1| competence protein ComF [Legionella drancourtii LLAP12]
 gi|254352939|gb|EET11708.1| competence protein ComF [Legionella drancourtii LLAP12]
          Length = 253

 Score = 39.7 bits (91), Expect = 0.12,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 5/57 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R+AF+  +   +HVA     LIDD+ TTGAT    A+ LKK G   V +   +R++
Sbjct: 197 LRHAFSAQKRPYQHVA-----LIDDLLTTGATTNELALTLKKTGVQQVDVWCCARTV 248


>gi|254453222|ref|ZP_05066659.1| competence protein F [Octadecabacter antarcticus 238]
 gi|198267628|gb|EDY91898.1| competence protein F [Octadecabacter antarcticus 238]
          Length = 239

 Score = 39.7 bits (91), Expect = 0.12,   Method: Composition-based stats.
 Identities = 21/43 (48%), Positives = 26/43 (60%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           G K+LLIDDV T+GAT   A  A   AG   V +L  +R +KD
Sbjct: 196 GRKVLLIDDVMTSGATFAAATEACYSAGVDDVCVLALARVVKD 238


>gi|257483057|ref|ZP_05637098.1| competence protein ComF [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|331011709|gb|EGH91765.1| competence protein ComF [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 244

 Score = 39.7 bits (91), Expect = 0.12,   Method: Composition-based stats.
 Identities = 25/61 (40%), Positives = 36/61 (59%), Gaps = 8/61 (13%)

Query: 1   MRNAFNV--PQYVS-KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R+AF +  P +   KH+A     L+DDV TTG+TA+  A  L KAGA  V +   +R+ 
Sbjct: 186 LRDAFTLVDPDWAQGKHLA-----LVDDVLTTGSTAEVIARLLNKAGARRVDVYCLARTP 240

Query: 58  K 58
           K
Sbjct: 241 K 241


>gi|78224524|ref|YP_386271.1| phosphoribosyltransferase [Geobacter metallireducens GS-15]
 gi|78195779|gb|ABB33546.1| Phosphoribosyltransferase [Geobacter metallireducens GS-15]
          Length = 242

 Score = 39.7 bits (91), Expect = 0.12,   Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 4/55 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGAT-AKCAAIALKKAGAMTVSILTFS 54
           +R AF V       +AG ++LL+DDV TTG+T A+CA + LK AGA  V ++T +
Sbjct: 185 VRGAFAVSGPAG--IAGRRVLLMDDVVTTGSTVAECARV-LKDAGASAVFVITVA 236


>gi|16804550|ref|NP_466035.1| hypothetical protein lmo2512 [Listeria monocytogenes EGD-e]
 gi|47096105|ref|ZP_00233706.1| comF operon protein 3, putative [Listeria monocytogenes str. 1/2a
           F6854]
 gi|224503248|ref|ZP_03671555.1| hypothetical protein LmonFR_12158 [Listeria monocytogenes FSL
           R2-561]
 gi|254828087|ref|ZP_05232774.1| comFC [Listeria monocytogenes FSL N3-165]
 gi|254900350|ref|ZP_05260274.1| hypothetical protein LmonJ_11067 [Listeria monocytogenes J0161]
 gi|254913411|ref|ZP_05263423.1| comFC [Listeria monocytogenes J2818]
 gi|254937792|ref|ZP_05269489.1| comFC [Listeria monocytogenes F6900]
 gi|255028456|ref|ZP_05300407.1| hypothetical protein LmonL_03206 [Listeria monocytogenes LO28]
 gi|284802950|ref|YP_003414815.1| hypothetical protein LM5578_2707 [Listeria monocytogenes 08-5578]
 gi|284996091|ref|YP_003417859.1| hypothetical protein LM5923_2656 [Listeria monocytogenes 08-5923]
 gi|16412000|emb|CAD00590.1| comFC [Listeria monocytogenes EGD-e]
 gi|47015566|gb|EAL06498.1| comF operon protein 3, putative [Listeria monocytogenes str. 1/2a
           F6854]
 gi|258600471|gb|EEW13796.1| comFC [Listeria monocytogenes FSL N3-165]
 gi|258610395|gb|EEW23003.1| comFC [Listeria monocytogenes F6900]
 gi|284058512|gb|ADB69453.1| hypothetical protein LM5578_2707 [Listeria monocytogenes 08-5578]
 gi|284061558|gb|ADB72497.1| hypothetical protein LM5923_2656 [Listeria monocytogenes 08-5923]
 gi|293591417|gb|EFF99751.1| comFC [Listeria monocytogenes J2818]
          Length = 218

 Score = 39.7 bits (91), Expect = 0.12,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +++L DD+YTTG+T   AA  LK+AG   VS LT  R
Sbjct: 182 EVILFDDIYTTGSTLNLAAQILKEAGVHKVSALTIFR 218


>gi|322375186|ref|ZP_08049700.1| putative competence protein ComF [Streptococcus sp. C300]
 gi|321280686|gb|EFX57725.1| putative competence protein ComF [Streptococcus sp. C300]
          Length = 220

 Score = 39.7 bits (91), Expect = 0.12,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 2   RNAFNVPQYVSKHVA-GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           R A  +P ++   ++   KILLIDD+YTTGAT       L++AGA+ V   +  R
Sbjct: 166 RLATEIPFFIKDGISLPKKILLIDDIYTTGATVNRVKRLLEEAGALEVKTFSLVR 220


>gi|77464774|ref|YP_354278.1| competence protein F [Rhodobacter sphaeroides 2.4.1]
 gi|77389192|gb|ABA80377.1| Competence protein F [Rhodobacter sphaeroides 2.4.1]
          Length = 240

 Score = 39.7 bits (91), Expect = 0.12,   Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 28/45 (62%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           + G  +L++DDV T+GAT   A  A + AGA +VS+   +R  KD
Sbjct: 195 LKGRPVLILDDVMTSGATLATATEACQAAGATSVSVAVLARVAKD 239


>gi|21674817|ref|NP_662882.1| competence protein [Chlorobium tepidum TLS]
 gi|21648036|gb|AAM73224.1| competence protein [Chlorobium tepidum TLS]
          Length = 225

 Score = 39.7 bits (91), Expect = 0.12,   Method: Composition-based stats.
 Identities = 20/41 (48%), Positives = 28/41 (68%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++LL+DDV TTGAT   AA  LK AGA+ V+  T + + K+
Sbjct: 185 RVLLVDDVLTTGATMVSAAKVLKAAGAVEVAFATVALTEKE 225


>gi|225019212|ref|ZP_03708404.1| hypothetical protein CLOSTMETH_03165 [Clostridium methylpentosum
           DSM 5476]
 gi|224948016|gb|EEG29225.1| hypothetical protein CLOSTMETH_03165 [Clostridium methylpentosum
           DSM 5476]
          Length = 148

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 27/39 (69%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           + + +V G  ILL+DDV TTG+T    A ALK+AGA +V
Sbjct: 95  FAASNVKGEHILLVDDVLTTGSTVNECARALKQAGAASV 133


>gi|224499866|ref|ZP_03668215.1| hypothetical protein LmonF1_09364 [Listeria monocytogenes Finland
           1988]
 gi|255025545|ref|ZP_05297531.1| hypothetical protein LmonocytFSL_02968 [Listeria monocytogenes FSL
           J2-003]
          Length = 218

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +++L DD+YTTG+T   AA  LK+AG   VS LT  R
Sbjct: 182 EVILFDDIYTTGSTLNLAAQILKEAGVHKVSALTIFR 218


>gi|254831065|ref|ZP_05235720.1| hypothetical protein Lmon1_06883 [Listeria monocytogenes 10403S]
          Length = 218

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +++L DD+YTTG+T   AA  LK+AG   VS LT  R
Sbjct: 182 EVILFDDIYTTGSTLNLAAQILKEAGVHKVSALTIFR 218


>gi|167760014|ref|ZP_02432141.1| hypothetical protein CLOSCI_02386 [Clostridium scindens ATCC 35704]
 gi|167662307|gb|EDS06437.1| hypothetical protein CLOSCI_02386 [Clostridium scindens ATCC 35704]
          Length = 240

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 23/35 (65%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +LL+DD+YTTG T   AA  LK+AG   V  LT S
Sbjct: 201 VLLVDDIYTTGNTMDAAADILKRAGVEKVYFLTIS 235


>gi|154499872|ref|ZP_02037910.1| hypothetical protein BACCAP_03529 [Bacteroides capillosus ATCC
           29799]
 gi|150271470|gb|EDM98727.1| hypothetical protein BACCAP_03529 [Bacteroides capillosus ATCC
           29799]
          Length = 220

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 23/42 (54%), Positives = 26/42 (61%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           VAG +ILLIDDV TTGAT    A  L  AGA  V   T +R+
Sbjct: 175 VAGKRILLIDDVITTGATISECARTLLTAGAEKVVCATLARA 216


>gi|254414302|ref|ZP_05028069.1| hypothetical protein MC7420_5854 [Microcoleus chthonoplastes PCC
           7420]
 gi|196178977|gb|EDX73974.1| hypothetical protein MC7420_5854 [Microcoleus chthonoplastes PCC
           7420]
          Length = 227

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 30/56 (53%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  AF V +   K      +L++DD+YTTGATA+ A   L++ G     IL  + S
Sbjct: 168 LTEAFAVGKRFGKRSHHSPVLILDDIYTTGATARSATEVLRQQGIAVYGILAIASS 223


>gi|331267306|ref|YP_004326936.1| predicted amidophosphoribosyltransferases, involved in
           transformation [Streptococcus oralis Uo5]
 gi|326683978|emb|CBZ01596.1| predicted amidophosphoribosyltransferases, involved in
           transformation [Streptococcus oralis Uo5]
          Length = 220

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 2   RNAFNVPQYVSKHVA-GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           R A  +P ++   ++   KILLIDD+YTTGAT       L++AGA+ V   +  R
Sbjct: 166 RLATEIPFFIKDGISLPKKILLIDDIYTTGATVNRVKRLLEEAGALDVKTFSLVR 220


>gi|189425986|ref|YP_001953163.1| competence protein F [Geobacter lovleyi SZ]
 gi|189422245|gb|ACD96643.1| competence protein F, putative [Geobacter lovleyi SZ]
          Length = 243

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF V       V    ++L+DDV+TTG+T    A+ L++AG  TVS +T + +
Sbjct: 189 LRGAFAVT--TPDSVNNRHVMLVDDVFTTGSTLAECALVLQRAGCHTVSAVTVAHA 242


>gi|312868558|ref|ZP_07728755.1| comF family protein [Lactobacillus oris PB013-T2-3]
 gi|311095929|gb|EFQ54176.1| comF family protein [Lactobacillus oris PB013-T2-3]
          Length = 226

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 20/41 (48%), Positives = 28/41 (68%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +AG ++LL+DDVYTTG T   AA  L +AGA  V  ++ +R
Sbjct: 186 LAGKRVLLVDDVYTTGRTLYHAADLLYQAGAANVISISLAR 226


>gi|167568631|ref|ZP_02361505.1| ComF family protein [Burkholderia oklahomensis C6786]
          Length = 106

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 31/49 (63%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +++ VAGL + ++DDV T+GAT    A  LK+AGA  V+     R+ KD
Sbjct: 58  IARPVAGLHVGIVDDVMTSGATLDALARKLKEAGARRVTNFVALRTAKD 106


>gi|77461398|ref|YP_350905.1| phosphoribosyltransferase [Pseudomonas fluorescens Pf0-1]
 gi|77385401|gb|ABA76914.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1]
          Length = 246

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +       V G  + L+DDV TTGATA+  A  L  AGA  V +   +R+ K
Sbjct: 186 LRHAFALS--ADAQVQGRHLALVDDVLTTGATAQALARLLMDAGAARVDVYCLARTPK 241


>gi|301056653|ref|YP_003794864.1| ComF operon protein 3 [Bacillus anthracis CI]
 gi|300378822|gb|ADK07726.1| comF operon protein 3 [Bacillus cereus biovar anthracis str. CI]
          Length = 234

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 21/40 (52%), Positives = 24/40 (60%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           G +ILL+DDVYTTG T +     L   GA  VS LT  RS
Sbjct: 195 GQRILLVDDVYTTGITVRQIGSLLYDRGAREVSSLTLCRS 234


>gi|49480782|ref|YP_039180.1| comF operon protein 3 [Bacillus thuringiensis serovar konkukian
           str. 97-27]
 gi|49332338|gb|AAT62984.1| comF operon protein 3 [Bacillus thuringiensis serovar konkukian
           str. 97-27]
          Length = 234

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 21/40 (52%), Positives = 24/40 (60%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           G +ILL+DDVYTTG T +     L   GA  VS LT  RS
Sbjct: 195 GQRILLVDDVYTTGITVRQIGSLLYDRGAREVSSLTLCRS 234


>gi|52140374|ref|YP_086456.1| comF operon protein 3 [Bacillus cereus E33L]
 gi|51973843|gb|AAU15393.1| comF operon protein 3 [Bacillus cereus E33L]
          Length = 234

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 21/40 (52%), Positives = 24/40 (60%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           G +ILL+DDVYTTG T +     L   GA  VS LT  RS
Sbjct: 195 GQRILLVDDVYTTGITVRQIGSLLYDRGAREVSSLTLCRS 234


>gi|47530738|ref|YP_022087.1| ComF operon protein 3 [Bacillus anthracis str. 'Ames Ancestor']
 gi|165869930|ref|ZP_02214587.1| comF operon protein 3 [Bacillus anthracis str. A0488]
 gi|190567658|ref|ZP_03020570.1| comF operon protein 3 [Bacillus anthracis Tsiankovskii-I]
 gi|196032688|ref|ZP_03100101.1| comF operon protein 3 [Bacillus cereus W]
 gi|196045753|ref|ZP_03112983.1| comF operon protein 3 [Bacillus cereus 03BB108]
 gi|218906367|ref|YP_002454201.1| comF operon protein 3 [Bacillus cereus AH820]
 gi|227817951|ref|YP_002817960.1| comF operon protein 3 [Bacillus anthracis str. CDC 684]
 gi|228917795|ref|ZP_04081334.1| ComF operon protein 3 [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
 gi|228948910|ref|ZP_04111183.1| ComF operon protein 3 [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|254686385|ref|ZP_05150244.1| comF operon protein 3 [Bacillus anthracis str. CNEVA-9066]
 gi|254724383|ref|ZP_05186167.1| comF operon protein 3 [Bacillus anthracis str. A1055]
 gi|254735590|ref|ZP_05193297.1| comF operon protein 3 [Bacillus anthracis str. Western North
           America USA6153]
 gi|254744322|ref|ZP_05202002.1| comF operon protein 3 [Bacillus anthracis str. Kruger B]
 gi|254755620|ref|ZP_05207653.1| comF operon protein 3 [Bacillus anthracis str. Vollum]
 gi|254757075|ref|ZP_05209103.1| comF operon protein 3 [Bacillus anthracis str. Australia 94]
 gi|47505886|gb|AAT34562.1| comF operon protein 3 [Bacillus anthracis str. 'Ames Ancestor']
 gi|164714253|gb|EDR19773.1| comF operon protein 3 [Bacillus anthracis str. A0488]
 gi|190561074|gb|EDV15047.1| comF operon protein 3 [Bacillus anthracis Tsiankovskii-I]
 gi|195994117|gb|EDX58072.1| comF operon protein 3 [Bacillus cereus W]
 gi|196023584|gb|EDX62261.1| comF operon protein 3 [Bacillus cereus 03BB108]
 gi|218538725|gb|ACK91123.1| comF operon protein 3 [Bacillus cereus AH820]
 gi|227005492|gb|ACP15235.1| comF operon protein 3 [Bacillus anthracis str. CDC 684]
 gi|228810666|gb|EEM57014.1| ComF operon protein 3 [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228841844|gb|EEM86952.1| ComF operon protein 3 [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
          Length = 190

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 21/40 (52%), Positives = 24/40 (60%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           G +ILL+DDVYTTG T +     L   GA  VS LT  RS
Sbjct: 151 GQRILLVDDVYTTGITVRQIGSLLYDRGAREVSSLTLCRS 190


>gi|49188027|ref|YP_031280.1| comF operon protein 3 [Bacillus anthracis str. Sterne]
 gi|65317163|ref|ZP_00390122.1| COG1040: Predicted amidophosphoribosyltransferases [Bacillus
           anthracis str. A2012]
 gi|118480229|ref|YP_897380.1| comF operon protein 3 [Bacillus thuringiensis str. Al Hakam]
 gi|167635321|ref|ZP_02393636.1| comF operon protein 3 [Bacillus anthracis str. A0442]
 gi|167640506|ref|ZP_02398769.1| comF operon protein 3 [Bacillus anthracis str. A0193]
 gi|170687952|ref|ZP_02879165.1| comF operon protein 3 [Bacillus anthracis str. A0465]
 gi|170707753|ref|ZP_02898204.1| comF operon protein 3 [Bacillus anthracis str. A0389]
 gi|177653020|ref|ZP_02935347.1| comF operon protein 3 [Bacillus anthracis str. A0174]
 gi|225867155|ref|YP_002752533.1| comF operon protein 3 [Bacillus cereus 03BB102]
 gi|228930193|ref|ZP_04093202.1| ComF operon protein 3 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|229601350|ref|YP_002869411.1| comF operon protein 3 [Bacillus anthracis str. A0248]
 gi|270000524|ref|NP_847593.2| comF operon protein 3 [Bacillus anthracis str. Ames]
 gi|49181954|gb|AAT57330.1| comF operon protein 3 [Bacillus anthracis str. Sterne]
 gi|118419454|gb|ABK87873.1| comF operon protein 3 [Bacillus thuringiensis str. Al Hakam]
 gi|167511549|gb|EDR86932.1| comF operon protein 3 [Bacillus anthracis str. A0193]
 gi|167529364|gb|EDR92116.1| comF operon protein 3 [Bacillus anthracis str. A0442]
 gi|170127310|gb|EDS96186.1| comF operon protein 3 [Bacillus anthracis str. A0389]
 gi|170668061|gb|EDT18811.1| comF operon protein 3 [Bacillus anthracis str. A0465]
 gi|172081795|gb|EDT66865.1| comF operon protein 3 [Bacillus anthracis str. A0174]
 gi|225787380|gb|ACO27597.1| comF operon protein 3 [Bacillus cereus 03BB102]
 gi|228829478|gb|EEM75106.1| ComF operon protein 3 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|229265758|gb|ACQ47395.1| comF operon protein 3 [Bacillus anthracis str. A0248]
 gi|269850254|gb|AAP29079.2| comF operon protein 3 [Bacillus anthracis str. Ames]
          Length = 234

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 21/40 (52%), Positives = 24/40 (60%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           G +ILL+DDVYTTG T +     L   GA  VS LT  RS
Sbjct: 195 GQRILLVDDVYTTGITVRQIGSLLYDRGAREVSSLTLCRS 234


>gi|292669715|ref|ZP_06603141.1| competence protein F [Selenomonas noxia ATCC 43541]
 gi|292648512|gb|EFF66484.1| competence protein F [Selenomonas noxia ATCC 43541]
          Length = 131

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 30/48 (62%), Gaps = 2/48 (4%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           +R AF V + +   V+G  ILL+DD+ TTGAT    A  LK+AGA  V
Sbjct: 76  LRGAFAVTEAMD--VSGQDILLLDDIMTTGATLTECARTLKRAGARNV 121


>gi|205375046|ref|ZP_03227837.1| late competence protein [Bacillus coahuilensis m4-4]
          Length = 226

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 30/53 (56%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           N  + P    + +   ++LL+DD+YTTG T   A+  L + GA +V++ T  R
Sbjct: 173 NMVSNPFTCYEEIKQQRVLLVDDIYTTGVTVHSASEVLYRHGAKSVAVFTLVR 225


>gi|325571395|ref|ZP_08146895.1| competence protein FC [Enterococcus casseliflavus ATCC 12755]
 gi|325155871|gb|EGC68067.1| competence protein FC [Enterococcus casseliflavus ATCC 12755]
          Length = 227

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 29/51 (56%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           F V    +  +   K+LLIDDVYTTG T   AA AL+  G  ++   +F+R
Sbjct: 177 FAVKPEATVEIKNKKLLLIDDVYTTGRTLYHAAEALQTFGPQSIRSFSFAR 227


>gi|325264768|ref|ZP_08131497.1| putative competence protein [Clostridium sp. D5]
 gi|324030060|gb|EGB91346.1| putative competence protein [Clostridium sp. D5]
          Length = 191

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 19/36 (52%), Positives = 24/36 (66%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           K+LL+DD+YTTG T +  A  L+ AGA  V  LT S
Sbjct: 151 KVLLVDDIYTTGNTIRRTAKMLRLAGAQKVYFLTIS 186


>gi|291297567|ref|YP_003508845.1| hypothetical protein Snas_0030 [Stackebrandtia nassauensis DSM
          44728]
 gi|290566787|gb|ADD39752.1| hypothetical protein Snas_0030 [Stackebrandtia nassauensis DSM
          44728]
          Length = 126

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 27/41 (65%)

Query: 15 VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
          + G K+L+IDD + +G+T +  A  +K+ GA TV ILT  R
Sbjct: 53 LTGSKVLVIDDTWVSGSTVQSLAHRVKRDGASTVVILTLGR 93


>gi|220910542|ref|YP_002485853.1| hypothetical protein Cyan7425_5199 [Cyanothece sp. PCC 7425]
 gi|219867153|gb|ACL47492.1| conserved hypothetical protein [Cyanothece sp. PCC 7425]
          Length = 243

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 19/33 (57%), Positives = 22/33 (66%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
           ILLIDD+YTTGATA+ A   L +AG     I T
Sbjct: 196 ILLIDDIYTTGATARSAIATLSQAGFQVYGIAT 228


>gi|313673556|ref|YP_004051667.1| phosphoribosyltransferase [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312940312|gb|ADR19504.1| phosphoribosyltransferase [Calditerrivibrio nitroreducens DSM
           19672]
          Length = 221

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 22/45 (48%), Positives = 26/45 (57%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           K +  LKILL+DD+ TTGAT    A  LK AGA  V     S+ L
Sbjct: 176 KELFDLKILLVDDIITTGATLNECAKMLKGAGARKVDCYVLSKGL 220


>gi|126657092|ref|ZP_01728263.1| hypothetical protein CY0110_28339 [Cyanothece sp. CCY0110]
 gi|126621635|gb|EAZ92345.1| hypothetical protein CY0110_28339 [Cyanothece sp. CCY0110]
          Length = 219

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 19/52 (36%), Positives = 30/52 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
           ++ AF + + +  +     ILLIDD+YTTG T K AA  L+  G   + +L+
Sbjct: 161 IKGAFKLGKSLQNYSVSRPILLIDDIYTTGTTVKEAARMLQHQGKKVLGVLS 212


>gi|326942979|gb|AEA18875.1| comF operon protein 3 [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 190

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 25/41 (60%)

Query: 16  AGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +G  ILL+DDVYTTG T +     L + GA  VS LT  RS
Sbjct: 150 SGQHILLVDDVYTTGITVRQIGSLLYERGAREVSSLTLCRS 190


>gi|313622368|gb|EFR92841.1| comFC family protein [Listeria innocua FSL J1-023]
          Length = 218

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +I+L DD+YTTG+T   AA  LK++G   VS LT  R
Sbjct: 182 EIILFDDIYTTGSTLNLAAQVLKESGVKKVSSLTIFR 218


>gi|296505611|ref|YP_003667311.1| ComF operon protein 3 [Bacillus thuringiensis BMB171]
 gi|296326663|gb|ADH09591.1| comF operon protein 3 [Bacillus thuringiensis BMB171]
          Length = 234

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 25/41 (60%)

Query: 16  AGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +G  ILL+DDVYTTG T +     L + GA  VS LT  RS
Sbjct: 194 SGQHILLVDDVYTTGITVRQIGSLLYERGAREVSSLTLCRS 234


>gi|228961428|ref|ZP_04123041.1| ComF operon protein 3 [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228798242|gb|EEM45242.1| ComF operon protein 3 [Bacillus thuringiensis serovar pakistani
           str. T13001]
          Length = 190

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 25/41 (60%)

Query: 16  AGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +G  ILL+DDVYTTG T +     L + GA  VS LT  RS
Sbjct: 150 SGQHILLVDDVYTTGITVRQIGSLLYERGAREVSSLTLCRS 190


>gi|229072645|ref|ZP_04205847.1| ComF operon protein 3 [Bacillus cereus F65185]
 gi|228710621|gb|EEL62594.1| ComF operon protein 3 [Bacillus cereus F65185]
          Length = 190

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 25/41 (60%)

Query: 16  AGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +G  ILL+DDVYTTG T +     L + GA  VS LT  RS
Sbjct: 150 SGQHILLVDDVYTTGITVRQIGSLLYERGAREVSSLTLCRS 190


>gi|229193439|ref|ZP_04320386.1| ComF operon protein 3 [Bacillus cereus ATCC 10876]
 gi|228589971|gb|EEK47843.1| ComF operon protein 3 [Bacillus cereus ATCC 10876]
          Length = 190

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 25/41 (60%)

Query: 16  AGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +G  ILL+DDVYTTG T +     L + GA  VS LT  RS
Sbjct: 150 SGQHILLVDDVYTTGITVRQIGSLLYERGAREVSSLTLCRS 190


>gi|218234900|ref|YP_002369966.1| comF operon protein 3 [Bacillus cereus B4264]
 gi|218162857|gb|ACK62849.1| comF operon protein 3 [Bacillus cereus B4264]
          Length = 190

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 25/41 (60%)

Query: 16  AGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +G  ILL+DDVYTTG T +     L + GA  VS LT  RS
Sbjct: 150 SGQHILLVDDVYTTGITVRQIGSLLYERGAREVSSLTLCRS 190


>gi|206970476|ref|ZP_03231429.1| comF operon protein 3 [Bacillus cereus AH1134]
 gi|206735053|gb|EDZ52222.1| comF operon protein 3 [Bacillus cereus AH1134]
          Length = 190

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 25/41 (60%)

Query: 16  AGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +G  ILL+DDVYTTG T +     L + GA  VS LT  RS
Sbjct: 150 SGQHILLVDDVYTTGITVRQIGSLLYERGAREVSSLTLCRS 190


>gi|163789843|ref|ZP_02184279.1| competence protein F [Carnobacterium sp. AT7]
 gi|159874783|gb|EDP68851.1| competence protein F [Carnobacterium sp. AT7]
          Length = 228

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 30/51 (58%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           F V +   +++ G  I+L+DD+YTTG T   AA  L + GA ++   + SR
Sbjct: 178 FKVAEIFQENIKGKSIILVDDIYTTGRTFFHAADCLFENGAKSIETFSISR 228


>gi|88705178|ref|ZP_01102889.1| conserved hypothetical protein [Congregibacter litoralis KT71]
 gi|88700268|gb|EAQ97376.1| conserved hypothetical protein [Congregibacter litoralis KT71]
          Length = 239

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 34/56 (60%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R+AF V    +  V G ++ ++DDV TTGAT    A AL +AGA  V ++  +R+
Sbjct: 185 LRDAFAV----TGDVRGCRVGIVDDVCTTGATGNAMATALLQAGASEVHLICLART 236


>gi|306826156|ref|ZP_07459491.1| competence protein FC [Streptococcus sp. oral taxon 071 str.
           73H25AP]
 gi|304431632|gb|EFM34613.1| competence protein FC [Streptococcus sp. oral taxon 071 str.
           73H25AP]
          Length = 220

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 2   RNAFNVPQYVSKHVA-GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           R A  +P ++   ++   KILLIDD+YTTGAT       L++AGA+ V   +  R
Sbjct: 166 RLATKIPFFIKDGISLPKKILLIDDIYTTGATVNRVKRLLEEAGALEVKTFSLVR 220


>gi|289668158|ref|ZP_06489233.1| putative competence protein [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 243

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 30/55 (54%), Gaps = 5/55 (9%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +R+AF     +  HVA     L+DDV TTGAT   AA AL+KAG   V     +R
Sbjct: 192 LRDAFVARGALPAHVA-----LVDDVMTTGATLHAAAKALRKAGVQRVDAWVCAR 241


>gi|289664360|ref|ZP_06485941.1| putative competence protein [Xanthomonas campestris pv. vasculorum
           NCPPB702]
          Length = 243

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 30/55 (54%), Gaps = 5/55 (9%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +R+AF     +  HVA     L+DDV TTGAT   AA AL+KAG   V     +R
Sbjct: 192 LRDAFVARGALPAHVA-----LVDDVMTTGATLHAAAKALRKAGVQRVDAWVCAR 241


>gi|307611175|emb|CBX00819.1| hypothetical protein LPW_25231 [Legionella pneumophila 130b]
          Length = 234

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 5/57 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R+AF VP    +HV     +++DD+ TTG+TA   A  LK AG   V I   +R++
Sbjct: 180 LRHAFYVPPVTYEHV-----MIVDDLLTTGSTANEMAHTLKNAGVKRVDICCCARAV 231


>gi|330967246|gb|EGH67506.1| competence protein ComF [Pseudomonas syringae pv. actinidiae str.
           M302091]
          Length = 244

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF+V    +  V G  + LIDDV TTG+TA+  A  L  AGA  V +   +R+ K
Sbjct: 186 LRGAFSVID--ADWVQGKHLALIDDVLTTGSTAEVIARLLNNAGARRVDVYCLARTPK 241


>gi|317504375|ref|ZP_07962359.1| conserved hypothetical protein [Prevotella salivae DSM 15606]
 gi|315664497|gb|EFV04180.1| conserved hypothetical protein [Prevotella salivae DSM 15606]
          Length = 231

 Score = 39.3 bits (90), Expect = 0.16,   Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 27/41 (65%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           + V G  +LLIDDV TTG+T    A  L +AG +T+S+L+ 
Sbjct: 186 ERVRGHHVLLIDDVITTGSTMLACAKELARAGEVTISVLSL 226


>gi|282599873|ref|ZP_05972178.2| competence protein F [Providencia rustigianii DSM 4541]
 gi|282567448|gb|EFB72983.1| competence protein F [Providencia rustigianii DSM 4541]
          Length = 125

 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 26/43 (60%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           V GL I +IDDV TTGAT   AA  L  AGA TV   +  R+L
Sbjct: 83  VYGLHIAIIDDVITTGATMNAAAQLLICAGAHTVDAWSLCRTL 125


>gi|163732997|ref|ZP_02140441.1| competence protein F, putative [Roseobacter litoralis Och 149]
 gi|161393532|gb|EDQ17857.1| competence protein F, putative [Roseobacter litoralis Och 149]
          Length = 175

 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 30/45 (66%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +AG  ILL+DDV+T+GAT   A  A   AG+  V ++T +R +K+
Sbjct: 130 LAGRPILLVDDVFTSGATLSSATDACLAAGSGPVYVVTLARVIKN 174


>gi|197286754|ref|YP_002152626.1| gluconate metabolism protein [Proteus mirabilis HI4320]
 gi|194684241|emb|CAR45762.1| putative gluconate metabolism protein [Proteus mirabilis HI4320]
          Length = 230

 Score = 39.3 bits (90), Expect = 0.16,   Method: Composition-based stats.
 Identities = 25/57 (43%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           + NAF V + VS  VAG  + LIDDV TT AT       L +AGA +V +    R+L
Sbjct: 176 LNNAFIVNRTVS--VAGKDLALIDDVITTSATLNAIVPLLFRAGARSVEVWAICRTL 230


>gi|251787886|ref|YP_003002607.1| gluconate periplasmic binding protein [Dickeya zeae Ech1591]
 gi|247536507|gb|ACT05128.1| gluconate periplasmic binding protein [Dickeya zeae Ech1591]
          Length = 239

 Score = 39.3 bits (90), Expect = 0.16,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 34/58 (58%), Gaps = 1/58 (1%)

Query: 1   MRNAFNVPQ-YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF      V++ VAG +++L+DDV TTG+TA   +  L  AGA  V +    R+L
Sbjct: 181 LRGAFRCRHTVVNQWVAGKRLVLLDDVVTTGSTAAEISRTLLNAGAQQVQVWCVCRTL 238


>gi|113474722|ref|YP_720783.1| hypothetical protein Tery_0911 [Trichodesmium erythraeum IMS101]
 gi|110165770|gb|ABG50310.1| conserved hypothetical protein [Trichodesmium erythraeum IMS101]
          Length = 255

 Score = 39.3 bits (90), Expect = 0.16,   Method: Composition-based stats.
 Identities = 17/37 (45%), Positives = 24/37 (64%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +LL+DD+YTTGAT   A   L+KAG   V +L  + +
Sbjct: 185 VLLVDDIYTTGATVNSAIEVLRKAGIKVVGVLAIATT 221


>gi|330838209|ref|YP_004412789.1| phosphoribosyltransferase [Selenomonas sputigena ATCC 35185]
 gi|329745973|gb|AEB99329.1| phosphoribosyltransferase [Selenomonas sputigena ATCC 35185]
          Length = 229

 Score = 39.3 bits (90), Expect = 0.17,   Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 26/40 (65%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +AG  I+L+DD+ TTGAT    A  LKKAGA +V  L  +
Sbjct: 186 IAGKSIVLLDDILTTGATLTSCAAVLKKAGAGSVYALALA 225


>gi|313606798|gb|EFR83474.1| ComF operon protein 3 [Listeria monocytogenes FSL F2-208]
          Length = 218

 Score = 39.3 bits (90), Expect = 0.17,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 26/37 (70%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +++L DD+YTTG+T   AA  LK++GA  VS LT  R
Sbjct: 182 EVILFDDIYTTGSTLNRAAQILKESGANKVSALTIFR 218


>gi|217963386|ref|YP_002349064.1| ComF operon protein 3 [Listeria monocytogenes HCC23]
 gi|217332656|gb|ACK38450.1| ComF operon protein 3 [Listeria monocytogenes HCC23]
 gi|307572039|emb|CAR85218.1| ComFC family protein [Listeria monocytogenes L99]
          Length = 218

 Score = 39.3 bits (90), Expect = 0.17,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 26/37 (70%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +++L DD+YTTG+T   AA  LK++GA  VS LT  R
Sbjct: 182 EVILFDDIYTTGSTLNRAAQILKESGANKVSALTIFR 218


>gi|315304741|ref|ZP_07874924.1| ComF operon protein 3 [Listeria ivanovii FSL F6-596]
 gi|313626885|gb|EFR95835.1| ComF operon protein 3 [Listeria ivanovii FSL F6-596]
          Length = 218

 Score = 39.3 bits (90), Expect = 0.17,   Method: Composition-based stats.
 Identities = 18/37 (48%), Positives = 24/37 (64%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           K++L DD+YTTG+T   AA  LKK G   V+ +T  R
Sbjct: 182 KVILFDDIYTTGSTLNLAAQELKKVGVKQVTAVTIFR 218


>gi|167835308|ref|ZP_02462191.1| ComF family protein [Burkholderia thailandensis MSMB43]
          Length = 103

 Score = 39.3 bits (90), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 30/49 (61%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           V++ VAGL + ++DDV T+GAT    A  LK AGA  V+     R+ KD
Sbjct: 55  VARPVAGLHVGIVDDVMTSGATLDALARKLKDAGARRVTNFVALRTAKD 103


>gi|218245407|ref|YP_002370778.1| hypothetical protein PCC8801_0531 [Cyanothece sp. PCC 8801]
 gi|257058443|ref|YP_003136331.1| amidophosphoribosyltransferase [Cyanothece sp. PCC 8802]
 gi|218165885|gb|ACK64622.1| conserved hypothetical protein [Cyanothece sp. PCC 8801]
 gi|256588609|gb|ACU99495.1| amidophosphoribosyltransferase [Cyanothece sp. PCC 8802]
          Length = 217

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 31/55 (56%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++ AF V   + K    L +LL+DD+YTTG TA+ A   L++ G   + +   ++
Sbjct: 161 IKQAFQVETSLKKGKPPLTVLLVDDIYTTGTTAQEATRMLRQQGIKVLGVAAIAK 215


>gi|281421477|ref|ZP_06252476.1| ComF family protein [Prevotella copri DSM 18205]
 gi|281404549|gb|EFB35229.1| ComF family protein [Prevotella copri DSM 18205]
          Length = 155

 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 21/39 (53%), Positives = 26/39 (66%), Gaps = 1/39 (2%)

Query: 15  VAGLKILLIDDVYTTGAT-AKCAAIALKKAGAMTVSILT 52
           + G  IL+IDDV TTGAT   CA   +K AG M +S+LT
Sbjct: 111 LEGKHILIIDDVCTTGATIISCAETLIKAAGKMKISVLT 149


>gi|54298222|ref|YP_124591.1| hypothetical protein lpp2280 [Legionella pneumophila str. Paris]
 gi|53752007|emb|CAH13433.1| hypothetical protein lpp2280 [Legionella pneumophila str. Paris]
          Length = 234

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 5/57 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R+AF VP    +HV     +++DD+ TTG+TA   A  LK AG   V I   +R++
Sbjct: 180 LRHAFYVPPVTYEHV-----MIVDDLLTTGSTANEIAHTLKNAGVKRVDICCCARAV 231


>gi|167769927|ref|ZP_02441980.1| hypothetical protein ANACOL_01268 [Anaerotruncus colihominis DSM
           17241]
 gi|167667918|gb|EDS12048.1| hypothetical protein ANACOL_01268 [Anaerotruncus colihominis DSM
           17241]
          Length = 160

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 31/42 (73%), Gaps = 2/42 (4%)

Query: 12  SKHVAGLKILLIDDVYTTGATA-KCAAIALKKAGAMTVSILT 52
            +H+ G  +LLIDDV T+GAT  +CAA+ L++ GA +V ++T
Sbjct: 105 GRHIDGGTVLLIDDVLTSGATVRRCAALLLER-GAQSVYVVT 145


>gi|291486098|dbj|BAI87173.1| competence protein FC [Bacillus subtilis subsp. natto BEST195]
          Length = 240

 Score = 39.3 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 22/41 (53%), Positives = 27/41 (65%), Gaps = 1/41 (2%)

Query: 17  GLKILLIDDVYTTGATAKCAA-IALKKAGAMTVSILTFSRS 56
           G+ I+LIDD+YTTGAT   AA   L+K  A +VS  T  RS
Sbjct: 200 GMNIILIDDLYTTGATLHFAARCLLEKGKAASVSSFTLIRS 240


>gi|241760595|ref|ZP_04758687.1| competence protein [Neisseria flavescens SK114]
 gi|241318776|gb|EER55302.1| competence protein [Neisseria flavescens SK114]
          Length = 238

 Score = 39.3 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++NAF +   + K      ILLIDDV+TTG+T    A  LKK+GA  +   + +R
Sbjct: 182 IKNAFEIKAELPK---ACNILLIDDVFTTGSTLNELAKTLKKSGAGKIFCWSLAR 233


>gi|221311496|ref|ZP_03593343.1| competence protein FC [Bacillus subtilis subsp. subtilis str. 168]
 gi|221315823|ref|ZP_03597628.1| competence protein FC [Bacillus subtilis subsp. subtilis str. NCIB
           3610]
 gi|221320738|ref|ZP_03602032.1| competence protein FC [Bacillus subtilis subsp. subtilis str.
           JH642]
 gi|221325023|ref|ZP_03606317.1| competence protein FC [Bacillus subtilis subsp. subtilis str. SMY]
          Length = 240

 Score = 39.3 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 22/41 (53%), Positives = 27/41 (65%), Gaps = 1/41 (2%)

Query: 17  GLKILLIDDVYTTGATAKCAA-IALKKAGAMTVSILTFSRS 56
           G+ I+LIDD+YTTGAT   AA   L+K  A +VS  T  RS
Sbjct: 200 GMNIILIDDLYTTGATLHFAARCLLEKGKAASVSSFTLIRS 240


>gi|167561404|ref|ZP_02354320.1| ComF family protein [Burkholderia oklahomensis EO147]
          Length = 80

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 31/49 (63%)

Query: 11 VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
          +++ VAGL + ++DDV T+GAT    A  LK+AGA  V+     R+ KD
Sbjct: 32 IARPVAGLHVGIVDDVMTSGATLDALARKLKEAGARRVTNFVALRTAKD 80


>gi|451867|gb|AAB59015.1| in Z18629, ORFX is called comForf3; ORFX; putative [Bacillus
           subtilis]
          Length = 250

 Score = 39.3 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 22/41 (53%), Positives = 27/41 (65%), Gaps = 1/41 (2%)

Query: 17  GLKILLIDDVYTTGATAKCAA-IALKKAGAMTVSILTFSRS 56
           G+ I+LIDD+YTTGAT   AA   L+K  A +VS  T  RS
Sbjct: 210 GMNIILIDDLYTTGATLHFAARCLLEKGKAASVSSFTLIRS 250


>gi|16080598|ref|NP_391425.1| component of the DNA transport apparatus [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|729159|sp|P39147|COMFC_BACSU RecName: Full=ComF operon protein 3
 gi|580842|emb|CAA79228.1| F3 [Bacillus subtilis subsp. subtilis str. 168]
 gi|1762334|gb|AAC44942.1| involved in transformation [Bacillus subtilis subsp. subtilis str.
           168]
 gi|2636071|emb|CAB15562.1| putative component of the DNA transport apparatus [Bacillus
           subtilis subsp. subtilis str. 168]
          Length = 229

 Score = 39.3 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 22/41 (53%), Positives = 27/41 (65%), Gaps = 1/41 (2%)

Query: 17  GLKILLIDDVYTTGATAKCAA-IALKKAGAMTVSILTFSRS 56
           G+ I+LIDD+YTTGAT   AA   L+K  A +VS  T  RS
Sbjct: 189 GMNIILIDDLYTTGATLHFAARCLLEKGKAASVSSFTLIRS 229


>gi|110677794|ref|YP_680801.1| competence protein F, putative [Roseobacter denitrificans OCh 114]
 gi|109453910|gb|ABG30115.1| competence protein F, putative [Roseobacter denitrificans OCh 114]
          Length = 243

 Score = 39.3 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 29/45 (64%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +AG  +LL+DDV+T+GAT   A  A   AG+  V ++T +R  K+
Sbjct: 198 MAGRPVLLVDDVFTSGATLSSATDACLAAGSGPVYVVTLARVTKN 242


>gi|294012632|ref|YP_003546092.1| putative amidophosphoribosyltransferase [Sphingobium japonicum
           UT26S]
 gi|292675962|dbj|BAI97480.1| putative amidophosphoribosyltransferase [Sphingobium japonicum
           UT26S]
          Length = 251

 Score = 39.3 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 32/45 (71%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           + G  +LLIDDV+T+GATA   A ALK+ GA +V +L ++R L D
Sbjct: 204 LKGRAVLLIDDVHTSGATAAACARALKRGGAASVHLLCWARVLPD 248


>gi|160941942|ref|ZP_02089267.1| hypothetical protein CLOBOL_06836 [Clostridium bolteae ATCC
           BAA-613]
 gi|158435149|gb|EDP12916.1| hypothetical protein CLOBOL_06836 [Clostridium bolteae ATCC
           BAA-613]
          Length = 257

 Score = 39.3 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 28/38 (73%), Gaps = 1/38 (2%)

Query: 16  AGLK-ILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
           +G+K I+L+DD+YTTG+T +    AL+KAGA  V  +T
Sbjct: 213 SGMKNIILVDDIYTTGSTIEACTRALRKAGAEHVYFVT 250


>gi|315651636|ref|ZP_07904647.1| competence protein F [Eubacterium saburreum DSM 3986]
 gi|315486090|gb|EFU76461.1| competence protein F [Eubacterium saburreum DSM 3986]
          Length = 247

 Score = 39.3 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 28/53 (52%), Positives = 33/53 (62%), Gaps = 5/53 (9%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGAT-AKCAAIALKKAGAMTVSILT 52
           + NAF V  + SK V    +L++DDVYTTG T  KCA I LK AGA  V  LT
Sbjct: 192 LDNAFVVKGF-SKEVK--NVLIVDDVYTTGTTIEKCAKI-LKDAGANEVYFLT 240


>gi|300692667|ref|YP_003753662.1| amidophosphoribosyltransferase, comF/gntX family [Ralstonia
           solanacearum PSI07]
 gi|299079727|emb|CBJ52403.1| putative amidophosphoribosyltransferase, comF/gntX family
           [Ralstonia solanacearum PSI07]
          Length = 240

 Score = 39.3 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 21/49 (42%), Positives = 30/49 (61%), Gaps = 2/49 (4%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVS 49
           ++ AF+VP      +AG  + ++DDV TTGAT    A  LK+AGA  V+
Sbjct: 186 LQGAFDVPD--PARIAGRHVGVVDDVMTTGATLSEIATQLKRAGAARVT 232


>gi|218900311|ref|YP_002448722.1| comF operon protein 3 [Bacillus cereus G9842]
 gi|218543390|gb|ACK95784.1| comF operon protein 3 [Bacillus cereus G9842]
          Length = 190

 Score = 39.3 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 21/40 (52%), Positives = 24/40 (60%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           G  ILL+DDVYTTG T +     L + GA  VS LT  RS
Sbjct: 151 GQHILLVDDVYTTGITVRQIGSLLYERGAREVSSLTLCRS 190


>gi|207727801|ref|YP_002256195.1| competence protein f-related protein [Ralstonia solanacearum MolK2]
 gi|206591042|emb|CAQ56654.1| competence protein f-related protein [Ralstonia solanacearum MolK2]
          Length = 240

 Score = 39.3 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 22/49 (44%), Positives = 30/49 (61%), Gaps = 2/49 (4%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVS 49
           ++ AF+VP      VAG  + ++DDV TTGAT    A  LK+AGA  V+
Sbjct: 186 LQGAFDVPDPAC--VAGRHVGVVDDVMTTGATLSEVATQLKRAGAARVT 232


>gi|75759031|ref|ZP_00739139.1| COMF operon protein 3 [Bacillus thuringiensis serovar israelensis
           ATCC 35646]
 gi|74493497|gb|EAO56605.1| COMF operon protein 3 [Bacillus thuringiensis serovar israelensis
           ATCC 35646]
          Length = 234

 Score = 39.3 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 21/40 (52%), Positives = 24/40 (60%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           G  ILL+DDVYTTG T +     L + GA  VS LT  RS
Sbjct: 195 GQHILLVDDVYTTGITVRQIGSLLYERGAREVSSLTLCRS 234


>gi|333029574|ref|ZP_08457635.1| phosphoribosyltransferase [Bacteroides coprosuis DSM 18011]
 gi|332740171|gb|EGJ70653.1| phosphoribosyltransferase [Bacteroides coprosuis DSM 18011]
          Length = 230

 Score = 38.9 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 21/43 (48%), Positives = 26/43 (60%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +K + G  ILL+DDV TTGAT       LK    + VSILTF+
Sbjct: 184 NKRMEGKHILLVDDVLTTGATLTACCSLLKSEMNVKVSILTFA 226


>gi|300727430|ref|ZP_07060839.1| competence protein [Prevotella bryantii B14]
 gi|299775310|gb|EFI71909.1| competence protein [Prevotella bryantii B14]
          Length = 231

 Score = 38.9 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 21/44 (47%), Positives = 26/44 (59%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + V G  ILLIDD+ TTGAT       + KAG + +SILT   S
Sbjct: 186 EKVRGKHILLIDDICTTGATMVSCGKEIAKAGNVKISILTLGYS 229


>gi|149925626|ref|ZP_01913890.1| putative competence protein f-related protein [Limnobacter sp.
           MED105]
 gi|149825743|gb|EDM84951.1| putative competence protein f-related protein [Limnobacter sp.
           MED105]
          Length = 245

 Score = 38.9 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 18/41 (43%), Positives = 27/41 (65%)

Query: 16  AGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           A ++I L+DDV TTGAT +   +AL KAGA ++  +   R+
Sbjct: 203 ANIRIGLVDDVITTGATIQSCKVALYKAGAESIVTMAVCRT 243


>gi|58580077|ref|YP_199093.1| competence protein F [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84622075|ref|YP_449447.1| competence protein F [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|58424671|gb|AAW73708.1| competence protein F [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84366015|dbj|BAE67173.1| competence protein F [Xanthomonas oryzae pv. oryzae MAFF 311018]
          Length = 243

 Score = 38.9 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 30/55 (54%), Gaps = 5/55 (9%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +R+AF     +  HVA     L+DDV TTGAT   AA AL+KAG   V     +R
Sbjct: 192 LRDAFVARGPLPAHVA-----LVDDVMTTGATLHAAAKALRKAGVQRVDAWVCAR 241


>gi|227505515|ref|ZP_03935564.1| conserved hypothetical protein [Corynebacterium striatum ATCC 6940]
 gi|227197879|gb|EEI77927.1| conserved hypothetical protein [Corynebacterium striatum ATCC 6940]
          Length = 163

 Score = 38.9 bits (89), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 31/46 (67%), Gaps = 1/46 (2%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAM 46
           MR A ++ +  S+ VAG +I+L+DDV TTGAT   +A  L+ AG +
Sbjct: 109 MRTAVHLTRAASQ-VAGTRIVLVDDVVTTGATLSASAARLRGAGGV 153


>gi|307132918|ref|YP_003884934.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system [Dickeya
           dadantii 3937]
 gi|306530447|gb|ADN00378.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system [Dickeya
           dadantii 3937]
          Length = 234

 Score = 38.9 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 20/49 (40%), Positives = 31/49 (63%), Gaps = 1/49 (2%)

Query: 10  YVSKH-VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +  +H V G +++L+DDV TTG+TA   + AL+ AGA  V +    R+L
Sbjct: 185 FACRHDVDGKRLVLLDDVVTTGSTAAEVSRALRHAGARQVQVWCLCRTL 233


>gi|82702257|ref|YP_411823.1| phosphoribosyltransferase [Nitrosospira multiformis ATCC 25196]
 gi|82410322|gb|ABB74431.1| Phosphoribosyltransferase [Nitrosospira multiformis ATCC 25196]
          Length = 239

 Score = 38.9 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 35/58 (60%), Gaps = 6/58 (10%)

Query: 1   MRNAFNVPQYVS-KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +RNAF+  + +  KH+A     ++DDV TTGAT    A  L+K GA+ +S    +R+L
Sbjct: 183 IRNAFDCEENLDGKHIA-----IVDDVMTTGATLNELARVLRKCGAVHISAWVVARTL 235


>gi|325294534|ref|YP_004281048.1| phosphoribosyltransferase [Desulfurobacterium thermolithotrophum
           DSM 11699]
 gi|325064982|gb|ADY72989.1| phosphoribosyltransferase [Desulfurobacterium thermolithotrophum
           DSM 11699]
          Length = 245

 Score = 38.9 bits (89), Expect = 0.22,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 30/47 (63%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           V + V G +ILL DDV+TTG+T    +  LK+ GA  V + + +RS+
Sbjct: 199 VVEKVWGKRILLFDDVFTTGSTVNEISRVLKENGASKVFVYSVARSI 245


>gi|319638737|ref|ZP_07993496.1| competence protein [Neisseria mucosa C102]
 gi|317399978|gb|EFV80640.1| competence protein [Neisseria mucosa C102]
          Length = 238

 Score = 38.9 bits (89), Expect = 0.22,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++NAF +   + K      ILLIDDV+TTG+T    A  LKK+GA  +   + +R
Sbjct: 182 IKNAFKIKAELPK---ACNILLIDDVFTTGSTLDELAKTLKKSGAGKIFCWSLAR 233


>gi|254436580|ref|ZP_05050074.1| hypothetical protein OA307_1450 [Octadecabacter antarcticus 307]
 gi|198252026|gb|EDY76340.1| hypothetical protein OA307_1450 [Octadecabacter antarcticus 307]
          Length = 239

 Score = 38.9 bits (89), Expect = 0.22,   Method: Composition-based stats.
 Identities = 21/46 (45%), Positives = 28/46 (60%)

Query: 14  HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            +AG K+LLIDDV T+GAT   A      AGA  V +L  +R +K+
Sbjct: 193 QLAGRKVLLIDDVMTSGATFAAATEPCYGAGADDVCVLALARVVKN 238


>gi|332971725|gb|EGK10673.1| putative competence protein F [Desmospora sp. 8437]
          Length = 157

 Score = 38.9 bits (89), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 22/38 (57%), Positives = 28/38 (73%), Gaps = 2/38 (5%)

Query: 19  KILLIDDVYTTGAT-AKCAAIALKKAGAMTVSILTFSR 55
           K L++DDVYTTG+T A+CA   LK AGA  V  LT++R
Sbjct: 121 KWLVVDDVYTTGSTLAECAKT-LKAAGAKQVCSLTWAR 157


>gi|166714084|ref|ZP_02245291.1| competence protein F [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 219

 Score = 38.9 bits (89), Expect = 0.22,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 30/55 (54%), Gaps = 5/55 (9%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +R+AF     +  HVA     L+DDV TTGAT   AA AL+KAG   V     +R
Sbjct: 168 LRDAFVARGPLPAHVA-----LVDDVMTTGATLNAAAKALRKAGVQRVDAWVCAR 217


>gi|144900147|emb|CAM77011.1| competence protein F [Magnetospirillum gryphiswaldense MSR-1]
          Length = 244

 Score = 38.9 bits (89), Expect = 0.22,   Method: Composition-based stats.
 Identities = 21/44 (47%), Positives = 29/44 (65%), Gaps = 2/44 (4%)

Query: 15  VAGLKILLIDDVYTTGAT-AKCAAIALKKAGAMTVSILTFSRSL 57
           V G  +LL+DDV TTGAT  +C+ + L++ GA  V +LT  R L
Sbjct: 198 VCGKNVLLVDDVLTTGATLGECSRVLLRQ-GAARVDVLTLGRVL 240


>gi|332798810|ref|YP_004460309.1| phosphoribosyltransferase [Tepidanaerobacter sp. Re1]
 gi|332696545|gb|AEE91002.1| phosphoribosyltransferase [Tepidanaerobacter sp. Re1]
          Length = 238

 Score = 38.9 bits (89), Expect = 0.22,   Method: Composition-based stats.
 Identities = 19/36 (52%), Positives = 25/36 (69%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +LLIDDVYTTGAT      +L +AGA  V ++T +R
Sbjct: 202 VLLIDDVYTTGATTGECTKSLLEAGAKAVYVMTCAR 237


>gi|91787139|ref|YP_548091.1| hypothetical protein Bpro_1242 [Polaromonas sp. JS666]
 gi|91696364|gb|ABE43193.1| conserved hypothetical protein [Polaromonas sp. JS666]
          Length = 271

 Score = 38.9 bits (89), Expect = 0.23,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  AF V       + G ++LL+DDV T+GA+   AA AL++AGA  ++ +  +R+
Sbjct: 215 VEGAFLVDPLRVGELEGRRVLLVDDVMTSGASLFTAARALREAGAAHITAVVLART 270


>gi|124009197|ref|ZP_01693878.1| competence protein [Microscilla marina ATCC 23134]
 gi|123985182|gb|EAY25116.1| competence protein [Microscilla marina ATCC 23134]
          Length = 241

 Score = 38.9 bits (89), Expect = 0.23,   Method: Composition-based stats.
 Identities = 20/43 (46%), Positives = 27/43 (62%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           V G  +LL+DDV TTGAT +  A +L K G   VS+ T + +L
Sbjct: 199 VKGQHVLLVDDVVTTGATLEACANSLLKVGTAKVSVATIAVAL 241


>gi|317494417|ref|ZP_07952831.1| comF family protein [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316917667|gb|EFV39012.1| comF family protein [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 227

 Score = 38.9 bits (89), Expect = 0.24,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +RNAF   Q  S    G  ILL+DDV+TTG+T    +  L   GA ++ ++   R+L
Sbjct: 175 LRNAFTCQQNPS----GKHILLVDDVFTTGSTIGEVSRLLIAQGAKSIQVVCLCRTL 227


>gi|260593451|ref|ZP_05858909.1| competence protein F-related protein [Prevotella veroralis F0319]
 gi|260534567|gb|EEX17184.1| competence protein F-related protein [Prevotella veroralis F0319]
          Length = 207

 Score = 38.9 bits (89), Expect = 0.25,   Method: Composition-based stats.
 Identities = 20/42 (47%), Positives = 27/42 (64%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           S  +AGL ILLIDD+ T+GAT   AA  L K   + +S+L+ 
Sbjct: 160 SSSIAGLHILLIDDIITSGATLVSAAQELLKGENVKLSVLSL 201


>gi|254520269|ref|ZP_05132325.1| ComF protein [Clostridium sp. 7_2_43FAA]
 gi|226914018|gb|EEH99219.1| ComF protein [Clostridium sp. 7_2_43FAA]
          Length = 214

 Score = 38.9 bits (89), Expect = 0.25,   Method: Composition-based stats.
 Identities = 21/45 (46%), Positives = 30/45 (66%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +K++    I+LIDDV TTGAT       LKK+GA ++ ILT ++S
Sbjct: 168 NKNIKDKNIILIDDVITTGATLLECEKLLKKSGANSIKILTVAKS 212


>gi|73666726|ref|YP_302742.1| competence protein F [Ehrlichia canis str. Jake]
 gi|72393867|gb|AAZ68144.1| competence protein F [Ehrlichia canis str. Jake]
          Length = 230

 Score = 38.9 bits (89), Expect = 0.25,   Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 26/38 (68%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ILL+DDV TTG TA+     L +AGA  V ++T +R+L
Sbjct: 193 ILLVDDVITTGITARTCTNKLIEAGAKEVRVITLARTL 230


>gi|24213204|ref|NP_710685.1| ComFC-like protein [Leptospira interrogans serovar Lai str. 56601]
 gi|24193923|gb|AAN47703.1| ComFC-like protein [Leptospira interrogans serovar Lai str. 56601]
          Length = 251

 Score = 38.9 bits (89), Expect = 0.25,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           R AF + +   + + G   LLIDDV+TTGA+A   A  L + GA +V ILT  R+
Sbjct: 184 RLAFKIKKEYKEKLKG-NYLLIDDVFTTGASANELARILIQNGADSVRILTLIRT 237


>gi|229118683|ref|ZP_04248035.1| ComF operon protein 3 [Bacillus cereus Rock1-3]
 gi|228664875|gb|EEL20365.1| ComF operon protein 3 [Bacillus cereus Rock1-3]
          Length = 144

 Score = 38.9 bits (89), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 23/40 (57%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           G  ILL+DDVYTTG T +     L   GA  VS LT  RS
Sbjct: 105 GQHILLVDDVYTTGITVRQIGSILYDRGANEVSSLTLCRS 144


>gi|331270420|ref|YP_004396912.1| competence protein F [Clostridium botulinum BKT015925]
 gi|329126970|gb|AEB76915.1| competence protein F [Clostridium botulinum BKT015925]
          Length = 226

 Score = 38.9 bits (89), Expect = 0.25,   Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 28/42 (66%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + G KILL+DDV TTGATA   +  +   GA  VSILT ++S
Sbjct: 183 IQGKKILLVDDVLTTGATAFYCSKEMILNGAKDVSILTVAKS 224


>gi|260888482|ref|ZP_05899745.1| competence protein F [Selenomonas sputigena ATCC 35185]
 gi|260861679|gb|EEX76179.1| competence protein F [Selenomonas sputigena ATCC 35185]
          Length = 185

 Score = 38.9 bits (89), Expect = 0.25,   Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 26/40 (65%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +AG  I+L+DD+ TTGAT    A  LKKAGA +V  L  +
Sbjct: 142 IAGKSIVLLDDILTTGATLTSCAAVLKKAGAGSVYALALA 181


>gi|229158755|ref|ZP_04286813.1| ComF operon protein 3 [Bacillus cereus ATCC 4342]
 gi|228624739|gb|EEK81508.1| ComF operon protein 3 [Bacillus cereus ATCC 4342]
          Length = 234

 Score = 38.9 bits (89), Expect = 0.25,   Method: Composition-based stats.
 Identities = 21/40 (52%), Positives = 23/40 (57%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           G  ILL+DDVYTTG T +     L   GA  VS LT  RS
Sbjct: 195 GQHILLVDDVYTTGITVRQIGSLLYDKGAKEVSSLTLCRS 234


>gi|47567404|ref|ZP_00238117.1| competence protein F [Bacillus cereus G9241]
 gi|47568474|ref|ZP_00239174.1| competence protein F [Bacillus cereus G9241]
 gi|47569298|ref|ZP_00239983.1| competence protein F [Bacillus cereus G9241]
 gi|228988415|ref|ZP_04148506.1| ComF operon protein 3 [Bacillus thuringiensis serovar tochigiensis
           BGSC 4Y1]
 gi|47554069|gb|EAL12435.1| competence protein F [Bacillus cereus G9241]
 gi|47554865|gb|EAL13216.1| competence protein F [Bacillus cereus G9241]
 gi|47556025|gb|EAL14363.1| competence protein F [Bacillus cereus G9241]
 gi|228771271|gb|EEM19746.1| ComF operon protein 3 [Bacillus thuringiensis serovar tochigiensis
           BGSC 4Y1]
          Length = 234

 Score = 38.9 bits (89), Expect = 0.25,   Method: Composition-based stats.
 Identities = 21/40 (52%), Positives = 23/40 (57%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           G  ILL+DDVYTTG T +     L   GA  VS LT  RS
Sbjct: 195 GQHILLVDDVYTTGITVRQIGSLLYDKGAKEVSSLTLCRS 234


>gi|313206314|ref|YP_004045491.1| phosphoribosyltransferase [Riemerella anatipestifer DSM 15868]
 gi|312445630|gb|ADQ81985.1| phosphoribosyltransferase [Riemerella anatipestifer DSM 15868]
 gi|315023180|gb|EFT36191.1| competence protein [Riemerella anatipestifer RA-YM]
 gi|325336241|gb|ADZ12515.1| phosphoribosyltransferase [Riemerella anatipestifer RA-GD]
          Length = 217

 Score = 38.9 bits (89), Expect = 0.26,   Method: Composition-based stats.
 Identities = 23/54 (42%), Positives = 29/54 (53%), Gaps = 4/54 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           M+N F+V     + + G  ILLIDDVYTTG T   A   L K     VS+L  +
Sbjct: 165 MQNIFSV----DEKIEGKHILLIDDVYTTGNTMSKAVWELLKGNGNQVSVLVLA 214


>gi|126734442|ref|ZP_01750189.1| Competence protein F [Roseobacter sp. CCS2]
 gi|126717308|gb|EBA14172.1| Competence protein F [Roseobacter sp. CCS2]
          Length = 240

 Score = 38.9 bits (89), Expect = 0.26,   Method: Composition-based stats.
 Identities = 21/46 (45%), Positives = 32/46 (69%)

Query: 14  HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            + G  ++L+DDV T+GAT   +A A++ AGA  VSI+T +R +KD
Sbjct: 194 QIVGRPVILVDDVMTSGATLAASAEAVRAAGATNVSIVTLARVVKD 239


>gi|313149331|ref|ZP_07811524.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
 gi|313138098|gb|EFR55458.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
          Length = 230

 Score = 38.9 bits (89), Expect = 0.26,   Method: Composition-based stats.
 Identities = 17/41 (41%), Positives = 24/41 (58%)

Query: 14  HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           H  G  +LL+DDV TTGAT    A A  +   + +S+LT +
Sbjct: 187 HFEGKHVLLVDDVLTTGATTVACASAFARVSGIRISVLTLA 227


>gi|255011505|ref|ZP_05283631.1| amidophosphoribosyl-transferase [Bacteroides fragilis 3_1_12]
          Length = 185

 Score = 38.9 bits (89), Expect = 0.26,   Method: Composition-based stats.
 Identities = 17/41 (41%), Positives = 24/41 (58%)

Query: 14  HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           H  G  +LL+DDV TTGAT    A A  +   + +S+LT +
Sbjct: 142 HFEGKHVLLVDDVLTTGATTVACASAFARVSGIRISVLTLA 182


>gi|219670750|ref|YP_002461185.1| phosphoribosyltransferase [Desulfitobacterium hafniense DCB-2]
 gi|219541010|gb|ACL22749.1| phosphoribosyltransferase [Desulfitobacterium hafniense DCB-2]
          Length = 276

 Score = 38.9 bits (89), Expect = 0.26,   Method: Composition-based stats.
 Identities = 25/63 (39%), Positives = 34/63 (53%), Gaps = 5/63 (7%)

Query: 1   MRNAFNVPQYVS-----KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           + N  +V Q VS     K + G ++ LIDDV TTGAT +  A  LK+ GA  V  L  + 
Sbjct: 187 LHNLESVFQIVSSSRGLKQIQGARVWLIDDVTTTGATLEHCAKVLKRGGAAQVYGLVLAA 246

Query: 56  SLK 58
            L+
Sbjct: 247 GLE 249


>gi|89897623|ref|YP_521110.1| hypothetical protein DSY4877 [Desulfitobacterium hafniense Y51]
 gi|89337071|dbj|BAE86666.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 276

 Score = 38.9 bits (89), Expect = 0.26,   Method: Composition-based stats.
 Identities = 25/63 (39%), Positives = 34/63 (53%), Gaps = 5/63 (7%)

Query: 1   MRNAFNVPQYVS-----KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           + N  +V Q VS     K + G ++ LIDDV TTGAT +  A  LK+ GA  V  L  + 
Sbjct: 187 LHNLESVFQIVSSSRGLKQIQGARVWLIDDVTTTGATLEHCAKVLKRGGAAQVYGLVLAA 246

Query: 56  SLK 58
            L+
Sbjct: 247 GLE 249


>gi|148543599|ref|YP_001270969.1| amidophosphoribosyltransferase-like protein [Lactobacillus reuteri
           DSM 20016]
 gi|184153007|ref|YP_001841348.1| competence protein [Lactobacillus reuteri JCM 1112]
 gi|227363439|ref|ZP_03847563.1| competence protein FC [Lactobacillus reuteri MM2-3]
 gi|325681952|ref|ZP_08161470.1| competence protein FC [Lactobacillus reuteri MM4-1A]
 gi|148530633|gb|ABQ82632.1| amidophosphoribosyltransferase-like protein [Lactobacillus reuteri
           DSM 20016]
 gi|183224351|dbj|BAG24868.1| competence protein [Lactobacillus reuteri JCM 1112]
 gi|227071539|gb|EEI09838.1| competence protein FC [Lactobacillus reuteri MM2-3]
 gi|324978596|gb|EGC15545.1| competence protein FC [Lactobacillus reuteri MM4-1A]
          Length = 226

 Score = 38.9 bits (89), Expect = 0.26,   Method: Composition-based stats.
 Identities = 18/43 (41%), Positives = 27/43 (62%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           + V   +ILL+DDVYTTG T   AA+  K+AG   +  ++ +R
Sbjct: 184 EEVINKRILLVDDVYTTGRTLYHAAVLFKQAGCKEIGSVSLAR 226


>gi|194468147|ref|ZP_03074133.1| conserved hypothetical protein [Lactobacillus reuteri 100-23]
 gi|194453000|gb|EDX41898.1| conserved hypothetical protein [Lactobacillus reuteri 100-23]
          Length = 226

 Score = 38.5 bits (88), Expect = 0.27,   Method: Composition-based stats.
 Identities = 18/43 (41%), Positives = 27/43 (62%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           + V   +ILL+DDVYTTG T   AA+  K+AG   +  ++ +R
Sbjct: 184 QKVINKRILLVDDVYTTGRTLYHAAVLFKQAGCKEIGSVSLAR 226


>gi|187918630|ref|YP_001884195.1| adenine phosphoribosyltransferase [Borrelia hermsii DAH]
 gi|85726175|gb|ABC79610.1| adenine phosphoribosyltransferase [Borrelia hermsii DAH]
 gi|119861478|gb|AAX17273.1| adenine phosphoribosyltransferase [Borrelia hermsii DAH]
          Length = 180

 Score = 38.5 bits (88), Expect = 0.27,   Method: Composition-based stats.
 Identities = 19/39 (48%), Positives = 24/39 (61%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ILL+DD+  TG T K AA+ LKKAG +   I  F   +K
Sbjct: 123 ILLVDDILATGGTLKAAAMLLKKAGGVVSDIFCFIELVK 161


>gi|323340158|ref|ZP_08080422.1| competence protein FC [Lactobacillus ruminis ATCC 25644]
 gi|323092349|gb|EFZ34957.1| competence protein FC [Lactobacillus ruminis ATCC 25644]
          Length = 230

 Score = 38.5 bits (88), Expect = 0.28,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           KILL+DD+YTTG T   A   L+ AGA  V+ +T +R
Sbjct: 194 KILLVDDIYTTGRTLYHAKTLLEDAGAKFVTSVTLAR 230


>gi|284799525|ref|ZP_05984223.2| ComF/gntX family protein [Neisseria subflava NJ9703]
 gi|284798135|gb|EFC53482.1| ComF/gntX family protein [Neisseria subflava NJ9703]
          Length = 165

 Score = 38.5 bits (88), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   + K      ILLIDDV+TTG+T    A  LKK+GA  +   + +R 
Sbjct: 109 IKNAFKIKTELPK---ACNILLIDDVFTTGSTLNELAKTLKKSGAGKIFCWSLARP 161


>gi|119946807|ref|YP_944487.1| amidophosphoribosyltransferase [Psychromonas ingrahamii 37]
 gi|119865411|gb|ABM04888.1| amidophosphoribosyltransferase [Psychromonas ingrahamii 37]
          Length = 226

 Score = 38.5 bits (88), Expect = 0.28,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 31/56 (55%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  AF++   + + + G  I++IDDV TTGAT       L +AGA  + I   SR+
Sbjct: 164 LNGAFSICPSMQQEIIGAYIVIIDDVVTTGATVNSLCHTLLEAGAQRIDIWCISRT 219


>gi|197333961|ref|YP_002154886.1| competence protein F [Vibrio fischeri MJ11]
 gi|197315451|gb|ACH64898.1| competence protein F [Vibrio fischeri MJ11]
          Length = 247

 Score = 38.5 bits (88), Expect = 0.29,   Method: Composition-based stats.
 Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 6/54 (11%)

Query: 4   AFNVPQYV-SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           AF + Q +  KHVA     L+DDV TTGAT     + L+KAG   + + T  R+
Sbjct: 188 AFKITQPIKEKHVA-----LVDDVVTTGATINLLCVELRKAGVERIDVYTVCRT 236


>gi|117618528|ref|YP_854828.1| comF family protein [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
 gi|117559935|gb|ABK36883.1| comF family protein [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
          Length = 242

 Score = 38.5 bits (88), Expect = 0.29,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 5/58 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +  +  +HVA     L+DDV TTGATA      L ++G   V +    R+LK
Sbjct: 187 LRGAFQIRPHAYQHVA-----LLDDVVTTGATAGHLTRLLHESGVTKVEVWAVCRTLK 239


>gi|59710724|ref|YP_203500.1| gluconate periplasmic binding protein [Vibrio fischeri ES114]
 gi|59478825|gb|AAW84612.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system [Vibrio
           fischeri ES114]
          Length = 239

 Score = 38.5 bits (88), Expect = 0.29,   Method: Composition-based stats.
 Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 6/54 (11%)

Query: 4   AFNVPQYV-SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           AF + Q +  KHVA     L+DDV TTGAT     + L+KAG   + + T  R+
Sbjct: 188 AFKITQPIKEKHVA-----LVDDVVTTGATINLLCVELRKAGVERIDVYTVCRT 236


>gi|321313092|ref|YP_004205379.1| putative component of the DNA transport apparatus [Bacillus
           subtilis BSn5]
 gi|320019366|gb|ADV94352.1| putative component of the DNA transport apparatus [Bacillus
           subtilis BSn5]
          Length = 159

 Score = 38.5 bits (88), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query: 16  AGLKILLIDDVYTTGATAKCAA-IALKKAGAMTVSILTFSRS 56
            G+ I+LIDD+YTTGAT   AA   L+K  A +VS  T  RS
Sbjct: 118 EGMNIILIDDLYTTGATLHFAARCLLEKGKAASVSSFTLIRS 159


>gi|210620508|ref|ZP_03292084.1| hypothetical protein CLOHIR_00027 [Clostridium hiranonis DSM 13275]
 gi|210155318|gb|EEA86324.1| hypothetical protein CLOHIR_00027 [Clostridium hiranonis DSM 13275]
          Length = 299

 Score = 38.5 bits (88), Expect = 0.29,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           ++NAF V +  S+ + G +I+L+DD++TTG T    +  LK  G   + +LTF
Sbjct: 242 LKNAFEV-KGGSEKIIGKRIILVDDIFTTGTTVNEISKKLKIYGVDEIIVLTF 293


>gi|188578947|ref|YP_001915876.1| competence protein F [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188523399|gb|ACD61344.1| competence protein F [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 118

 Score = 38.5 bits (88), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 30/55 (54%), Gaps = 5/55 (9%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +R+AF     +  HVA     L+DDV TTGAT   AA AL+KAG   V     +R
Sbjct: 67  LRDAFVARGPLPAHVA-----LVDDVMTTGATLHAAAKALRKAGVQRVDAWVCAR 116


>gi|16125083|ref|NP_419647.1| competence protein F [Caulobacter crescentus CB15]
 gi|13422081|gb|AAK22815.1| competence protein F [Caulobacter crescentus CB15]
          Length = 265

 Score = 38.5 bits (88), Expect = 0.29,   Method: Composition-based stats.
 Identities = 29/52 (55%), Positives = 34/52 (65%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           AF VP    + VAG KILLIDDV TTGATA+  A AL  AGA  V++   +R
Sbjct: 205 AFVVPPSRRRLVAGRKILLIDDVLTTGATAEGCARALLAAGAARVTLAIVAR 256


>gi|196039439|ref|ZP_03106744.1| comF operon protein 3 [Bacillus cereus NVH0597-99]
 gi|196029599|gb|EDX68201.1| comF operon protein 3 [Bacillus cereus NVH0597-99]
          Length = 190

 Score = 38.5 bits (88), Expect = 0.31,   Method: Composition-based stats.
 Identities = 21/40 (52%), Positives = 23/40 (57%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           G  ILL+DDVYTTG T +     L   GA  VS LT  RS
Sbjct: 151 GQHILLVDDVYTTGITVRQIGSLLYDRGAKEVSSLTLCRS 190


>gi|229164129|ref|ZP_04292065.1| ComF operon protein 3 [Bacillus cereus R309803]
 gi|228619365|gb|EEK76255.1| ComF operon protein 3 [Bacillus cereus R309803]
          Length = 234

 Score = 38.5 bits (88), Expect = 0.31,   Method: Composition-based stats.
 Identities = 21/40 (52%), Positives = 23/40 (57%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           G  ILL+DDVYTTG T +     L   GA  VS LT  RS
Sbjct: 195 GQHILLVDDVYTTGITVRQIGSLLYDRGAREVSSLTLCRS 234


>gi|189347657|ref|YP_001944186.1| phosphoribosyltransferase [Chlorobium limicola DSM 245]
 gi|189341804|gb|ACD91207.1| phosphoribosyltransferase [Chlorobium limicola DSM 245]
          Length = 230

 Score = 38.5 bits (88), Expect = 0.31,   Method: Composition-based stats.
 Identities = 18/41 (43%), Positives = 28/41 (68%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +ILL+DDV TTG+T   AA AL+  GA ++S+   + + K+
Sbjct: 190 RILLVDDVVTTGSTVVAAASALRNGGAGSISVAALALTGKE 230


>gi|254784709|ref|YP_003072137.1| competence protein ComF [Teredinibacter turnerae T7901]
 gi|237683729|gb|ACR10993.1| competence protein ComF [Teredinibacter turnerae T7901]
          Length = 234

 Score = 38.5 bits (88), Expect = 0.32,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +RN++ +    ++ V    ILL+DDV TTGAT    A  L+ AGA  V I   +R+ K
Sbjct: 180 VRNSYAI----TRDVRHRHILLVDDVMTTGATVGAIAQLLRDAGANRVDIACLARTPK 233


>gi|225077353|ref|ZP_03720552.1| hypothetical protein NEIFLAOT_02413 [Neisseria flavescens
           NRL30031/H210]
 gi|224951345|gb|EEG32554.1| hypothetical protein NEIFLAOT_02413 [Neisseria flavescens
           NRL30031/H210]
          Length = 165

 Score = 38.5 bits (88), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   + K      ILLIDDV+TTG+T    A  LKK+GA  +   + +R 
Sbjct: 109 IKNAFKIKAELPK---ACNILLIDDVFTTGSTLNELAKTLKKSGAGKIFCWSLARP 161


>gi|315612190|ref|ZP_07887105.1| competence protein FC [Streptococcus sanguinis ATCC 49296]
 gi|315315751|gb|EFU63788.1| competence protein FC [Streptococcus sanguinis ATCC 49296]
          Length = 220

 Score = 38.5 bits (88), Expect = 0.32,   Method: Composition-based stats.
 Identities = 18/37 (48%), Positives = 24/37 (64%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           KIL+IDD+YTTGAT       L++AGA+ V   +  R
Sbjct: 184 KILVIDDIYTTGATVNRVKRLLEEAGALDVKTFSLVR 220


>gi|319795688|ref|YP_004157328.1| phosphoribosyltransferase [Variovorax paradoxus EPS]
 gi|315598151|gb|ADU39217.1| phosphoribosyltransferase [Variovorax paradoxus EPS]
          Length = 238

 Score = 38.5 bits (88), Expect = 0.32,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 34/56 (60%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF V    +  +   +I+L+DDV T+GA+   AA  L+ AGA+ ++ +  +R+
Sbjct: 179 LRGAFAVEPLRADRLREKRIVLVDDVMTSGASLFAAAGVLRMAGAVHITAVVLART 234


>gi|229105795|ref|ZP_04236424.1| ComF operon protein 3 [Bacillus cereus Rock3-28]
 gi|228677684|gb|EEL31932.1| ComF operon protein 3 [Bacillus cereus Rock3-28]
          Length = 234

 Score = 38.5 bits (88), Expect = 0.32,   Method: Composition-based stats.
 Identities = 21/40 (52%), Positives = 23/40 (57%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           G  ILL+DDVYTTG T +     L   GA  VS LT  RS
Sbjct: 195 GQHILLVDDVYTTGITVRQIGSLLYDRGASEVSSLTLCRS 234


>gi|126666962|ref|ZP_01737938.1| probable phosphoribosyl transferase [Marinobacter sp. ELB17]
 gi|126628678|gb|EAZ99299.1| probable phosphoribosyl transferase [Marinobacter sp. ELB17]
          Length = 252

 Score = 38.5 bits (88), Expect = 0.32,   Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 26/38 (68%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +I +IDDV TTGATA+  A  L++AGA  + I   +R+
Sbjct: 213 RIAIIDDVVTTGATARLLAHVLQQAGAEHIQIWALART 250


>gi|299142045|ref|ZP_07035179.1| competence protein F [Prevotella oris C735]
 gi|298576507|gb|EFI48379.1| competence protein F [Prevotella oris C735]
          Length = 231

 Score = 38.5 bits (88), Expect = 0.32,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           +++AF +     + + G  +LLIDDV TTG+T    A  L KAG + VS+L+ 
Sbjct: 176 VKDAFRLQH--PERIIGRHLLLIDDVITTGSTMLACAKELAKAGDIKVSVLSL 226


>gi|332533245|ref|ZP_08409112.1| competence protein F [Pseudoalteromonas haloplanktis ANT/505]
 gi|332037324|gb|EGI73779.1| competence protein F [Pseudoalteromonas haloplanktis ANT/505]
          Length = 225

 Score = 38.5 bits (88), Expect = 0.33,   Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 4/52 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
           ++NAF      ++ + G  + ++DDV TTGAT   A  ALK+AGA  V   T
Sbjct: 172 LKNAF----ICTQDMGGKTVAIVDDVMTTGATLNAATSALKQAGAKQVWAFT 219


>gi|291288809|ref|YP_003505625.1| competence protein F [Denitrovibrio acetiphilus DSM 12809]
 gi|290885969|gb|ADD69669.1| competence protein F [Denitrovibrio acetiphilus DSM 12809]
          Length = 219

 Score = 38.5 bits (88), Expect = 0.33,   Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 32/52 (61%), Gaps = 4/52 (7%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           NAF+     ++ V GL+ILLIDD+ TTG+T +  +  LK +GA  V +   +
Sbjct: 168 NAFSC----ARDVDGLRILLIDDIITTGSTTEECSRILKCSGASKVDVFALT 215


>gi|90422044|ref|YP_530414.1| phosphoribosyltransferase [Rhodopseudomonas palustris BisB18]
 gi|90104058|gb|ABD86095.1| phosphoribosyltransferase [Rhodopseudomonas palustris BisB18]
          Length = 269

 Score = 38.5 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 34/55 (61%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++ AF VP      V G +I+L+DDV T+GAT    A AL +A A +V +L F+R
Sbjct: 206 VQGAFRVPSENKATVQGRRIVLVDDVLTSGATVDACARALLRARAASVDVLVFAR 260


>gi|325917189|ref|ZP_08179416.1| putative amidophosphoribosyltransferase [Xanthomonas vesicatoria
           ATCC 35937]
 gi|325536579|gb|EGD08348.1| putative amidophosphoribosyltransferase [Xanthomonas vesicatoria
           ATCC 35937]
          Length = 241

 Score = 38.5 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 30/55 (54%), Gaps = 5/55 (9%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +R+AF     +  HVA     L+DDV TTGAT   AA AL++AG   V     +R
Sbjct: 190 LRDAFIARGALPAHVA-----LVDDVMTTGATLHAAAQALRRAGVQRVDAWVCAR 239


>gi|227513679|ref|ZP_03943728.1| late competence protein [Lactobacillus buchneri ATCC 11577]
 gi|227083090|gb|EEI18402.1| late competence protein [Lactobacillus buchneri ATCC 11577]
          Length = 229

 Score = 38.5 bits (88), Expect = 0.35,   Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 30/51 (58%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           F +  + S+ +    I+++DDVYTTG T + AA  L +AGA  V   T +R
Sbjct: 179 FELIDHESELIRQKTIVVVDDVYTTGTTIRHAAALLYRAGARCVKGFTLAR 229


>gi|146278666|ref|YP_001168825.1| amidophosphoribosyltransferase-like protein [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145556907|gb|ABP71520.1| amidophosphoribosyltransferase-like protein [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 240

 Score = 38.1 bits (87), Expect = 0.35,   Method: Composition-based stats.
 Identities = 18/43 (41%), Positives = 26/43 (60%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           G ++L++DDV T+GAT   A  A   AGA  V++   +R  KD
Sbjct: 197 GRRVLIVDDVMTSGATLAAATEACHGAGATHVTVAVLARVAKD 239


>gi|262282227|ref|ZP_06059996.1| competence protein ComFC [Streptococcus sp. 2_1_36FAA]
 gi|262262681|gb|EEY81378.1| competence protein ComFC [Streptococcus sp. 2_1_36FAA]
          Length = 221

 Score = 38.1 bits (87), Expect = 0.35,   Method: Composition-based stats.
 Identities = 20/36 (55%), Positives = 26/36 (72%), Gaps = 2/36 (5%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           KILL+DD+YTTGAT + A + L + GA    I+TFS
Sbjct: 185 KILLVDDIYTTGATLQDAKLTLFENGAK--EIMTFS 218


>gi|269797854|ref|YP_003311754.1| amidophosphoribosyltransferase-like protein [Veillonella parvula
           DSM 2008]
 gi|269094483|gb|ACZ24474.1| amidophosphoribosyltransferase-like protein [Veillonella parvula
           DSM 2008]
          Length = 231

 Score = 38.1 bits (87), Expect = 0.35,   Method: Composition-based stats.
 Identities = 17/35 (48%), Positives = 24/35 (68%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           IL++DD+YTTGAT +  A  L+K  A+ V  LT +
Sbjct: 193 ILIVDDIYTTGATIEAVAKVLQKHNALRVDALTLA 227


>gi|157150610|ref|YP_001449925.1| competence protein ComFC [Streptococcus gordonii str. Challis
           substr. CH1]
 gi|157075404|gb|ABV10087.1| competence protein ComFC [Streptococcus gordonii str. Challis
           substr. CH1]
          Length = 221

 Score = 38.1 bits (87), Expect = 0.35,   Method: Composition-based stats.
 Identities = 20/36 (55%), Positives = 26/36 (72%), Gaps = 2/36 (5%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           KILL+DD+YTTGAT + A + L + GA    I+TFS
Sbjct: 185 KILLVDDIYTTGATLQDAKLTLFENGAK--EIMTFS 218


>gi|134300912|ref|YP_001114408.1| phosphoribosyltransferase [Desulfotomaculum reducens MI-1]
 gi|134053612|gb|ABO51583.1| phosphoribosyltransferase [Desulfotomaculum reducens MI-1]
          Length = 237

 Score = 38.1 bits (87), Expect = 0.35,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF+V     + + G  IL++DDV+TTG+T    A  L K GA  + ++T + + K
Sbjct: 182 LRGAFDVN--TPEAIKGKAILIVDDVFTTGSTMAEVAETLHKKGAGKLYVITLANAGK 237


>gi|300776281|ref|ZP_07086139.1| possible competence protein [Chryseobacterium gleum ATCC 35910]
 gi|300501791|gb|EFK32931.1| possible competence protein [Chryseobacterium gleum ATCC 35910]
          Length = 217

 Score = 38.1 bits (87), Expect = 0.36,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 27/47 (57%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +++ V G  ILLIDDV+TTG T    A  +  AG   VS+L  +  +
Sbjct: 171 ITRPVTGKHILLIDDVFTTGNTVSSVAWEILNAGDNKVSVLVMAEDV 217


>gi|326403688|ref|YP_004283770.1| putative phosphoribosyltransferase [Acidiphilium multivorum AIU301]
 gi|325050550|dbj|BAJ80888.1| putative phosphoribosyltransferase [Acidiphilium multivorum AIU301]
          Length = 241

 Score = 38.1 bits (87), Expect = 0.36,   Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 33/55 (60%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++ A  + +    H+AG  ILL+DDV TTGATA   A AL  AGA  V +L  +R
Sbjct: 180 LKGAIGIREGREAHIAGRTILLVDDVLTTGATASACADALYAAGAAAVDVLAIAR 234


>gi|300088792|ref|YP_003759314.1| phosphoribosyltransferase [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
 gi|299528525|gb|ADJ26993.1| phosphoribosyltransferase [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
          Length = 230

 Score = 38.1 bits (87), Expect = 0.36,   Method: Composition-based stats.
 Identities = 19/43 (44%), Positives = 25/43 (58%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           + G  ++LIDDV T+GAT    A AL   GA  V  LT +R +
Sbjct: 188 LTGRSVILIDDVATSGATLNACARALTAGGAAEVRALTLAREI 230


>gi|145300947|ref|YP_001143788.1| competence protein F [Aeromonas salmonicida subsp. salmonicida
           A449]
 gi|142853719|gb|ABO92040.1| competence protein F [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 242

 Score = 38.1 bits (87), Expect = 0.36,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 5/58 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF+V  +  +HVA     L+DDV TTGATA      L ++G   V +    R+LK
Sbjct: 187 LRGAFHVRSHHYRHVA-----LLDDVVTTGATAGQLTRLLHESGIEKVEVWAICRTLK 239


>gi|226939033|ref|YP_002794104.1| ComF [Laribacter hongkongensis HLHK9]
 gi|226713957|gb|ACO73095.1| ComF [Laribacter hongkongensis HLHK9]
          Length = 234

 Score = 38.1 bits (87), Expect = 0.36,   Method: Composition-based stats.
 Identities = 19/30 (63%), Positives = 22/30 (73%)

Query: 16  AGLKILLIDDVYTTGATAKCAAIALKKAGA 45
           AG   +L+DDV TTGAT   AA ALK+AGA
Sbjct: 191 AGQSCVLVDDVLTTGATLSAAARALKRAGA 220


>gi|300705286|ref|YP_003746889.1| amidophosphoribosyltransferase, comf/gntx family [Ralstonia
           solanacearum CFBP2957]
 gi|299072950|emb|CBJ44306.1| putative amidophosphoribosyltransferase, comF/gntX family
           [Ralstonia solanacearum CFBP2957]
          Length = 240

 Score = 38.1 bits (87), Expect = 0.38,   Method: Composition-based stats.
 Identities = 22/49 (44%), Positives = 30/49 (61%), Gaps = 2/49 (4%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVS 49
           ++ AF+VP      VAG  + ++DDV TTGAT    A  LK+AGA  V+
Sbjct: 186 LQGAFDVPDPAC--VAGRHVGVVDDVMTTGATLSEIATQLKRAGAARVT 232


>gi|329113385|ref|ZP_08242166.1| Competence protein F [Acetobacter pomorum DM001]
 gi|326697210|gb|EGE48870.1| Competence protein F [Acetobacter pomorum DM001]
          Length = 255

 Score = 38.1 bits (87), Expect = 0.38,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 31/51 (60%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51
           M++A        + + G  ++L+DD+ TTGATA     AL++AG + VS+L
Sbjct: 188 MQSAITFRPKWQQKLHGRSVVLVDDMLTTGATATACVQALRQAGVLDVSLL 238


>gi|332296611|ref|YP_004438534.1| phosphoribosyltransferase [Thermodesulfobium narugense DSM 14796]
 gi|332179714|gb|AEE15403.1| phosphoribosyltransferase [Thermodesulfobium narugense DSM 14796]
          Length = 208

 Score = 38.1 bits (87), Expect = 0.38,   Method: Composition-based stats.
 Identities = 20/38 (52%), Positives = 26/38 (68%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           KILLIDDV T+GAT + A   L ++G+  V  LTF+ S
Sbjct: 158 KILLIDDVITSGATLRSAYKELTRSGSKIVYSLTFAVS 195


>gi|325923495|ref|ZP_08185148.1| putative amidophosphoribosyltransferase [Xanthomonas gardneri ATCC
           19865]
 gi|325546023|gb|EGD17224.1| putative amidophosphoribosyltransferase [Xanthomonas gardneri ATCC
           19865]
          Length = 241

 Score = 38.1 bits (87), Expect = 0.38,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 30/55 (54%), Gaps = 5/55 (9%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +R+AF     +  HVA     L+DDV TTGAT   AA AL++AG   V     +R
Sbjct: 190 VRDAFVARGVLPAHVA-----LVDDVMTTGATLHAAAQALRRAGVQRVDAWVCAR 239


>gi|17230418|ref|NP_486966.1| hypothetical protein alr2926 [Nostoc sp. PCC 7120]
 gi|17132020|dbj|BAB74625.1| alr2926 [Nostoc sp. PCC 7120]
          Length = 229

 Score = 38.1 bits (87), Expect = 0.38,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 31/59 (52%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF + Q          +LLIDD+YTTGAT K A   L++     + + T + ++KD
Sbjct: 166 LAEAFAIGQDFRHSCPKSPVLLIDDIYTTGATVKSAVQILRQNEITVLGLATTASAVKD 224


>gi|158321545|ref|YP_001514052.1| competence protein F, putative [Alkaliphilus oremlandii OhILAs]
 gi|158141744|gb|ABW20056.1| competence protein F, putative [Alkaliphilus oremlandii OhILAs]
          Length = 228

 Score = 38.1 bits (87), Expect = 0.39,   Method: Composition-based stats.
 Identities = 18/36 (50%), Positives = 25/36 (69%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ILL+DD+ TTG+T    +  L   GA TV++LTF+R
Sbjct: 192 ILLVDDILTTGSTVNECSKILLNFGAKTVTVLTFAR 227


>gi|229099618|ref|ZP_04230546.1| ComF operon protein 3 [Bacillus cereus Rock3-29]
 gi|228683914|gb|EEL37864.1| ComF operon protein 3 [Bacillus cereus Rock3-29]
          Length = 181

 Score = 38.1 bits (87), Expect = 0.39,   Method: Composition-based stats.
 Identities = 21/40 (52%), Positives = 23/40 (57%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           G  ILL+DDVYTTG T +     L   GA  VS LT  RS
Sbjct: 142 GQHILLVDDVYTTGITVRQIGSLLYDRGANEVSSLTLCRS 181


>gi|153877991|ref|ZP_02004442.1| conserved hypothetical protein [Beggiatoa sp. PS]
 gi|152065545|gb|EDN65558.1| conserved hypothetical protein [Beggiatoa sp. PS]
          Length = 145

 Score = 38.1 bits (87), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           AF V Q +  H     I+LIDDV TTGAT +  A+A KKAG   V +   +R
Sbjct: 96  AFKVVQ-IQPHWQ--HIVLIDDVMTTGATVRELALAFKKAGVSRVDVWCCAR 144


>gi|152977401|ref|YP_001376918.1| comF operon protein 3 [Bacillus cereus subsp. cytotoxis NVH 391-98]
 gi|152026153|gb|ABS23923.1| comF operon protein 3 [Bacillus cytotoxicus NVH 391-98]
          Length = 234

 Score = 38.1 bits (87), Expect = 0.39,   Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 25/41 (60%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           + G  +++IDDVYTTG T +     L  AGA +VS LT  R
Sbjct: 193 LTGQHLVIIDDVYTTGITVRQVGELLYHAGAQSVSSLTLCR 233


>gi|322388451|ref|ZP_08062054.1| competence protein FC [Streptococcus infantis ATCC 700779]
 gi|321140764|gb|EFX36266.1| competence protein FC [Streptococcus infantis ATCC 700779]
          Length = 220

 Score = 38.1 bits (87), Expect = 0.39,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 22/37 (59%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           KILLIDD+YTTGAT       L+ AGA  V   +  R
Sbjct: 184 KILLIDDIYTTGATVNRVKSMLENAGAEEVKTFSLVR 220


>gi|291560001|emb|CBL38801.1| Predicted amidophosphoribosyltransferases [butyrate-producing
           bacterium SSC/2]
          Length = 236

 Score = 38.1 bits (87), Expect = 0.39,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 35/58 (60%), Gaps = 7/58 (12%)

Query: 1   MRNAF--NVPQYVSKHVAGL--KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF  N+ +Y     AG+  ++L+IDD+YTTG+TA+    ALK+ G   V +   +
Sbjct: 176 LKKAFRGNLKEY---QKAGMPKRVLVIDDIYTTGSTAEAVTTALKQLGVQEVYVFCIA 230


>gi|307068817|ref|YP_003877783.1| putative amidophosphoribosyltransferase [Streptococcus pneumoniae
           AP200]
 gi|306410354|gb|ADM85781.1| Predicted amidophosphoribosyltransferase [Streptococcus pneumoniae
           AP200]
          Length = 112

 Score = 38.1 bits (87), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 23/37 (62%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           KILLIDD+YTTGAT       L++AGA  V   +  R
Sbjct: 76  KILLIDDIYTTGATINRVKKLLEEAGAKDVKTFSLVR 112


>gi|213967736|ref|ZP_03395883.1| competence protein ComF [Pseudomonas syringae pv. tomato T1]
 gi|301382373|ref|ZP_07230791.1| competence protein ComF, putative [Pseudomonas syringae pv. tomato
           Max13]
 gi|302062356|ref|ZP_07253897.1| competence protein ComF, putative [Pseudomonas syringae pv. tomato
           K40]
 gi|302130674|ref|ZP_07256664.1| competence protein ComF, putative [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|213927512|gb|EEB61060.1| competence protein ComF [Pseudomonas syringae pv. tomato T1]
          Length = 244

 Score = 38.1 bits (87), Expect = 0.40,   Method: Composition-based stats.
 Identities = 25/61 (40%), Positives = 35/61 (57%), Gaps = 8/61 (13%)

Query: 1   MRNAFNV--PQYV-SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF +  P +V  KH+A     L+DDV TTG+TA+  A  L  AGA  V +   +R+ 
Sbjct: 186 LRGAFALIDPDWVHGKHLA-----LVDDVLTTGSTAEVIARLLNSAGARRVDVYCLARTP 240

Query: 58  K 58
           K
Sbjct: 241 K 241


>gi|28867723|ref|NP_790342.1| competence protein ComF [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|28850958|gb|AAO54037.1| competence protein ComF, putative [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|331015040|gb|EGH95096.1| competence protein ComF, putative [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 244

 Score = 38.1 bits (87), Expect = 0.40,   Method: Composition-based stats.
 Identities = 25/61 (40%), Positives = 35/61 (57%), Gaps = 8/61 (13%)

Query: 1   MRNAFNV--PQYV-SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF +  P +V  KH+A     L+DDV TTG+TA+  A  L  AGA  V +   +R+ 
Sbjct: 186 LRGAFALIDPDWVHGKHLA-----LVDDVLTTGSTAEVIARLLNSAGARRVDVYCLARTP 240

Query: 58  K 58
           K
Sbjct: 241 K 241


>gi|284040351|ref|YP_003390281.1| phosphoribosyltransferase [Spirosoma linguale DSM 74]
 gi|283819644|gb|ADB41482.1| phosphoribosyltransferase [Spirosoma linguale DSM 74]
          Length = 239

 Score = 38.1 bits (87), Expect = 0.40,   Method: Composition-based stats.
 Identities = 18/43 (41%), Positives = 27/43 (62%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +  V G  I+L+DDV TTGAT +  A+ L K+G  +V  +T +
Sbjct: 193 ASEVNGKHIVLVDDVLTTGATLEACAVELLKSGCKSVGFITLA 235


>gi|148656009|ref|YP_001276214.1| amidophosphoribosyltransferase-like protein [Roseiflexus sp. RS-1]
 gi|148568119|gb|ABQ90264.1| amidophosphoribosyltransferase-like protein [Roseiflexus sp. RS-1]
          Length = 215

 Score = 38.1 bits (87), Expect = 0.40,   Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 24/38 (63%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +++L+DDV TTGAT    A AL+  GA  V  L  +RS
Sbjct: 174 RVVLVDDVLTTGATVNACAQALRAGGARDVYALALARS 211


>gi|78355831|ref|YP_387280.1| ComF family protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78218236|gb|ABB37585.1| ComF family protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 251

 Score = 38.1 bits (87), Expect = 0.41,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R+AF     V     G  +LL+DDV TTGAT +  A AL  AGA  V  +  +R+
Sbjct: 191 LRDAFEADSCVR----GRNVLLVDDVMTTGATLEHCAQALYHAGAQQVHAVVAART 242


>gi|311277653|ref|YP_003939884.1| phosphoribosyltransferase [Enterobacter cloacae SCF1]
 gi|308746848|gb|ADO46600.1| phosphoribosyltransferase [Enterobacter cloacae SCF1]
          Length = 224

 Score = 38.1 bits (87), Expect = 0.41,   Method: Composition-based stats.
 Identities = 23/59 (38%), Positives = 35/59 (59%), Gaps = 8/59 (13%)

Query: 1   MRNAF--NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF  ++P      VAG  I ++DDV TTGATA   +  L ++GA +V +    R+L
Sbjct: 172 LKNAFRLDIP------VAGHHIAIVDDVVTTGATAAEISRLLLQSGAASVQVWCLCRTL 224


>gi|154505998|ref|ZP_02042736.1| hypothetical protein RUMGNA_03540 [Ruminococcus gnavus ATCC 29149]
 gi|153793497|gb|EDN75917.1| hypothetical protein RUMGNA_03540 [Ruminococcus gnavus ATCC 29149]
          Length = 191

 Score = 38.1 bits (87), Expect = 0.42,   Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 22/35 (62%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +L+IDD+YTTG T    A  LK AGA  V  LT S
Sbjct: 152 VLVIDDIYTTGNTIHRVAKVLKNAGAQKVYFLTIS 186


>gi|291521802|emb|CBK80095.1| Predicted amidophosphoribosyltransferases [Coprococcus catus GD/7]
          Length = 240

 Score = 38.1 bits (87), Expect = 0.42,   Method: Composition-based stats.
 Identities = 20/43 (46%), Positives = 29/43 (67%), Gaps = 1/43 (2%)

Query: 12  SKHVAGLK-ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           ++++ G++  LLIDD+YTTG+T    A ALK+AG   V  LT 
Sbjct: 192 ARYLQGVRRALLIDDIYTTGSTVNYCAGALKQAGIEKVWFLTL 234


>gi|187922548|ref|YP_001894190.1| phosphoribosyltransferase [Burkholderia phytofirmans PsJN]
 gi|187713742|gb|ACD14966.1| phosphoribosyltransferase [Burkholderia phytofirmans PsJN]
          Length = 261

 Score = 38.1 bits (87), Expect = 0.42,   Method: Composition-based stats.
 Identities = 22/49 (44%), Positives = 30/49 (61%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           V+  V GL + ++DDV TTGAT +  A ALK AGA  V+     R+ K+
Sbjct: 213 VAGSVRGLHVGIVDDVMTTGATLEALARALKAAGARRVTNFVALRTPKN 261


>gi|308071112|ref|YP_003872717.1| amidophosphoribosyltransferase [Paenibacillus polymyxa E681]
 gi|305860391|gb|ADM72179.1| Predicted amidophosphoribosyltransferase [Paenibacillus polymyxa
           E681]
          Length = 275

 Score = 38.1 bits (87), Expect = 0.43,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 34/53 (64%), Gaps = 5/53 (9%)

Query: 9   QYVSKHVAGLKILLIDDVYTTGATAK-CAAI----ALKKAGAMTVSILTFSRS 56
           Q V+K    + +LL+DD+YTTG+T + CA +    AL++   +T+  LT +RS
Sbjct: 223 QCVTKDKLSVTVLLVDDIYTTGSTLQACARVLREKALEQGIHLTIFCLTLARS 275


>gi|289163908|ref|YP_003454046.1| competence protein ComF [Legionella longbeachae NSW150]
 gi|288857081|emb|CBJ10896.1| competence protein ComF [Legionella longbeachae NSW150]
          Length = 234

 Score = 38.1 bits (87), Expect = 0.43,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 5/58 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF   Q   +HVA     +IDD+ TTG TA   A  LKK+G   V +   +R+++
Sbjct: 180 LRSAFVTHQLPYQHVA-----IIDDLLTTGNTANELAYTLKKSGVKQVDVWCCARTIE 232


>gi|270157826|ref|ZP_06186483.1| putative competence protein ComF family [Legionella longbeachae
           D-4968]
 gi|269989851|gb|EEZ96105.1| putative competence protein ComF family [Legionella longbeachae
           D-4968]
          Length = 196

 Score = 38.1 bits (87), Expect = 0.43,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 5/58 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF   Q   +HVA     +IDD+ TTG TA   A  LKK+G   V +   +R+++
Sbjct: 142 LRSAFVTHQLPYQHVA-----IIDDLLTTGNTANELAYTLKKSGVKQVDVWCCARTIE 194


>gi|317049908|ref|YP_004117556.1| phosphoribosyltransferase [Pantoea sp. At-9b]
 gi|316951525|gb|ADU71000.1| phosphoribosyltransferase [Pantoea sp. At-9b]
          Length = 225

 Score = 38.1 bits (87), Expect = 0.43,   Method: Composition-based stats.
 Identities = 21/43 (48%), Positives = 26/43 (60%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           V G  ILLIDDV TTG+T    +  L+ AGA +V I    R+L
Sbjct: 183 VTGRHILLIDDVVTTGSTVAEISRMLQAAGAASVQIGCLCRTL 225


>gi|330874793|gb|EGH08942.1| competence protein ComF [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
          Length = 244

 Score = 38.1 bits (87), Expect = 0.43,   Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 26/44 (59%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           V G  + LIDDV TTG+TA+  A  L  AGA  V +   +R+ K
Sbjct: 198 VQGKHLALIDDVLTTGSTAEVIARLLNSAGAQRVDVYCLARTPK 241


>gi|186475042|ref|YP_001856512.1| putative competence protein F-like protein [Burkholderia phymatum
           STM815]
 gi|184191501|gb|ACC69466.1| putative competence protein F-related protein [Burkholderia
           phymatum STM815]
          Length = 268

 Score = 38.1 bits (87), Expect = 0.43,   Method: Composition-based stats.
 Identities = 22/49 (44%), Positives = 29/49 (59%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           V+  V GL + ++DDV TTGAT    A  LK AGA  V+ L   R+ K+
Sbjct: 220 VATRVRGLHVAIVDDVMTTGATLDALARTLKAAGARRVTNLVALRTPKN 268


>gi|307154802|ref|YP_003890186.1| phosphoribosyltransferase [Cyanothece sp. PCC 7822]
 gi|306985030|gb|ADN16911.1| phosphoribosyltransferase [Cyanothece sp. PCC 7822]
          Length = 221

 Score = 38.1 bits (87), Expect = 0.43,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 31/58 (53%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +  AF + + + K      +LL+DD+YTTG T K AA  L+  G   + ++  S + K
Sbjct: 161 INKAFKIGKSLLKSFPHSSVLLVDDIYTTGTTVKEAAQTLRLGGIEVMGVVALSTAKK 218


>gi|116491314|ref|YP_810858.1| amidophosphoribosyltransferase [Oenococcus oeni PSU-1]
 gi|116092039|gb|ABJ57193.1| Predicted amidophosphoribosyltransferase [Oenococcus oeni PSU-1]
          Length = 226

 Score = 38.1 bits (87), Expect = 0.44,   Method: Composition-based stats.
 Identities = 18/36 (50%), Positives = 24/36 (66%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +LL+DDVYTTG T    A  L +AGA  V+ +T +R
Sbjct: 191 VLLLDDVYTTGTTLHQTAAVLYEAGAKKVNSITLAR 226


>gi|237650499|ref|ZP_04524751.1| competence protein ComF, putative [Streptococcus pneumoniae CCRI
           1974]
 gi|237822400|ref|ZP_04598245.1| competence protein ComF, putative [Streptococcus pneumoniae CCRI
           1974M2]
          Length = 220

 Score = 38.1 bits (87), Expect = 0.44,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 23/37 (62%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           KILLIDD+YTTGAT       L++AGA  V   +  R
Sbjct: 184 KILLIDDIYTTGATINRVKKLLEEAGAKDVKTFSLVR 220


>gi|228955436|ref|ZP_04117441.1| ComF operon protein 3 [Bacillus thuringiensis serovar kurstaki str.
           T03a001]
 gi|228804228|gb|EEM50842.1| ComF operon protein 3 [Bacillus thuringiensis serovar kurstaki str.
           T03a001]
          Length = 190

 Score = 38.1 bits (87), Expect = 0.44,   Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 23/37 (62%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ILL+DDVYTTG T +     L + GA  VS LT  RS
Sbjct: 154 ILLVDDVYTTGITVRQIGSLLYERGAREVSSLTLCRS 190


>gi|229082404|ref|ZP_04214867.1| ComF operon protein 3 [Bacillus cereus Rock4-2]
 gi|228700836|gb|EEL53359.1| ComF operon protein 3 [Bacillus cereus Rock4-2]
          Length = 190

 Score = 38.1 bits (87), Expect = 0.44,   Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 23/37 (62%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ILL+DDVYTTG T +     L + GA  VS LT  RS
Sbjct: 154 ILLVDDVYTTGITVRQIGSLLYERGAREVSSLTLCRS 190


>gi|225855700|ref|YP_002737212.1| putative competence protein ComF [Streptococcus pneumoniae JJA]
 gi|225723406|gb|ACO19259.1| putative competence protein ComF [Streptococcus pneumoniae JJA]
          Length = 220

 Score = 38.1 bits (87), Expect = 0.44,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 23/37 (62%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           KILLIDD+YTTGAT       L++AGA  V   +  R
Sbjct: 184 KILLIDDIYTTGATINRVKKLLEEAGAKDVKTFSLVR 220


>gi|182685144|ref|YP_001836891.1| competence protein ComF, putative [Streptococcus pneumoniae CGSP14]
 gi|225862023|ref|YP_002743532.1| putative competence protein ComF [Streptococcus pneumoniae
           Taiwan19F-14]
 gi|298229657|ref|ZP_06963338.1| putative competence protein ComF [Streptococcus pneumoniae str.
           Canada MDR_19F]
 gi|298255677|ref|ZP_06979263.1| putative competence protein ComF [Streptococcus pneumoniae str.
           Canada MDR_19A]
 gi|298501722|ref|YP_003723662.1| competence protein ComF [Streptococcus pneumoniae TCH8431/19A]
 gi|303254868|ref|ZP_07340953.1| competence protein ComF, putative [Streptococcus pneumoniae BS455]
 gi|303259695|ref|ZP_07345671.1| competence protein ComF, putative [Streptococcus pneumoniae
           SP-BS293]
 gi|303262162|ref|ZP_07348107.1| competence protein ComF, putative [Streptococcus pneumoniae
           SP14-BS292]
 gi|303264597|ref|ZP_07350516.1| competence protein ComF, putative [Streptococcus pneumoniae BS397]
 gi|303266094|ref|ZP_07351988.1| competence protein ComF, putative [Streptococcus pneumoniae BS457]
 gi|303268502|ref|ZP_07354296.1| competence protein ComF, putative [Streptococcus pneumoniae BS458]
 gi|182630478|gb|ACB91426.1| competence protein ComF, putative [Streptococcus pneumoniae CGSP14]
 gi|225728335|gb|ACO24186.1| putative competence protein ComF [Streptococcus pneumoniae
           Taiwan19F-14]
 gi|298237317|gb|ADI68448.1| competence protein ComF [Streptococcus pneumoniae TCH8431/19A]
 gi|301795119|emb|CBW37589.1| putative late competence protein [Streptococcus pneumoniae INV104]
 gi|301802871|emb|CBW35649.1| putative late competence protein [Streptococcus pneumoniae INV200]
 gi|302598139|gb|EFL65200.1| competence protein ComF, putative [Streptococcus pneumoniae BS455]
 gi|302636802|gb|EFL67292.1| competence protein ComF, putative [Streptococcus pneumoniae
           SP14-BS292]
 gi|302639247|gb|EFL69706.1| competence protein ComF, putative [Streptococcus pneumoniae
           SP-BS293]
 gi|302642003|gb|EFL72356.1| competence protein ComF, putative [Streptococcus pneumoniae BS458]
 gi|302644398|gb|EFL74651.1| competence protein ComF, putative [Streptococcus pneumoniae BS457]
 gi|302645967|gb|EFL76195.1| competence protein ComF, putative [Streptococcus pneumoniae BS397]
 gi|327388951|gb|EGE87299.1| hypothetical protein SPAR5_2131 [Streptococcus pneumoniae GA04375]
          Length = 220

 Score = 38.1 bits (87), Expect = 0.44,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 23/37 (62%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           KILLIDD+YTTGAT       L++AGA  V   +  R
Sbjct: 184 KILLIDDIYTTGATINRVKKLLEEAGAKDVKTFSLVR 220


>gi|149007749|ref|ZP_01831358.1| competence protein ComF, putative [Streptococcus pneumoniae
           SP18-BS74]
 gi|194397008|ref|YP_002038803.1| competence protein ComF [Streptococcus pneumoniae G54]
 gi|307128473|ref|YP_003880504.1| involved in transformation [Streptococcus pneumoniae 670-6B]
 gi|147760744|gb|EDK67716.1| competence protein ComF, putative [Streptococcus pneumoniae
           SP18-BS74]
 gi|194356675|gb|ACF55123.1| competence protein ComF, putative [Streptococcus pneumoniae G54]
 gi|306485535|gb|ADM92404.1| involved in transformation [Streptococcus pneumoniae 670-6B]
          Length = 220

 Score = 38.1 bits (87), Expect = 0.44,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 23/37 (62%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           KILLIDD+YTTGAT       L++AGA  V   +  R
Sbjct: 184 KILLIDDIYTTGATINRVKKLLEEAGAKDVKTFSLVR 220


>gi|15902014|ref|NP_346618.1| competence protein ComF, putative [Streptococcus pneumoniae TIGR4]
 gi|148984510|ref|ZP_01817798.1| competence protein ComF, putative [Streptococcus pneumoniae
           SP3-BS71]
 gi|148988853|ref|ZP_01820268.1| competence protein ComF, putative [Streptococcus pneumoniae
           SP6-BS73]
 gi|148991933|ref|ZP_01821707.1| competence protein ComF, putative [Streptococcus pneumoniae
           SP9-BS68]
 gi|149012819|ref|ZP_01833764.1| competence protein ComF, putative [Streptococcus pneumoniae
           SP19-BS75]
 gi|149020126|ref|ZP_01835100.1| competence protein ComF, putative [Streptococcus pneumoniae
           SP23-BS72]
 gi|168484336|ref|ZP_02709288.1| comF family protein [Streptococcus pneumoniae CDC1873-00]
 gi|168489281|ref|ZP_02713480.1| comF family protein [Streptococcus pneumoniae SP195]
 gi|168491740|ref|ZP_02715883.1| comF family protein [Streptococcus pneumoniae CDC0288-04]
 gi|168494032|ref|ZP_02718175.1| comF family protein [Streptococcus pneumoniae CDC3059-06]
 gi|169833565|ref|YP_001695563.1| transformation protein [Streptococcus pneumoniae Hungary19A-6]
 gi|225859978|ref|YP_002741488.1| transformation-related protein [Streptococcus pneumoniae 70585]
 gi|14973719|gb|AAK76258.1| putative competence protein ComF [Streptococcus pneumoniae TIGR4]
 gi|147763250|gb|EDK70189.1| competence protein ComF, putative [Streptococcus pneumoniae
           SP19-BS75]
 gi|147923287|gb|EDK74401.1| competence protein ComF, putative [Streptococcus pneumoniae
           SP3-BS71]
 gi|147925664|gb|EDK76740.1| competence protein ComF, putative [Streptococcus pneumoniae
           SP6-BS73]
 gi|147928982|gb|EDK79993.1| competence protein ComF, putative [Streptococcus pneumoniae
           SP9-BS68]
 gi|147930804|gb|EDK81785.1| competence protein ComF, putative [Streptococcus pneumoniae
           SP23-BS72]
 gi|168996067|gb|ACA36679.1| involved in transformation [Streptococcus pneumoniae Hungary19A-6]
 gi|172042439|gb|EDT50485.1| comF family protein [Streptococcus pneumoniae CDC1873-00]
 gi|183572258|gb|EDT92786.1| comF family protein [Streptococcus pneumoniae SP195]
 gi|183574042|gb|EDT94570.1| comF family protein [Streptococcus pneumoniae CDC0288-04]
 gi|183575943|gb|EDT96471.1| comF family protein [Streptococcus pneumoniae CDC3059-06]
 gi|225719973|gb|ACO15827.1| transformation-related protein [Streptococcus pneumoniae 70585]
 gi|301800942|emb|CBW33601.1| putative late competence protein [Streptococcus pneumoniae OXC141]
 gi|332071649|gb|EGI82142.1| transformation protein [Streptococcus pneumoniae GA17570]
 gi|332198832|gb|EGJ12914.1| transformation protein [Streptococcus pneumoniae GA47368]
          Length = 220

 Score = 38.1 bits (87), Expect = 0.44,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 23/37 (62%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           KILLIDD+YTTGAT       L++AGA  V   +  R
Sbjct: 184 KILLIDDIYTTGATINRVKKLLEEAGAKDVKTFSLVR 220


>gi|15904053|ref|NP_359603.1| competence protein ComF, putative [Streptococcus pneumoniae R6]
 gi|116515869|ref|YP_817419.1| competence protein ComF, putative [Streptococcus pneumoniae D39]
 gi|148997991|ref|ZP_01825504.1| competence protein ComF, putative [Streptococcus pneumoniae
           SP11-BS70]
 gi|168576079|ref|ZP_02721984.1| comF family protein [Streptococcus pneumoniae MLV-016]
 gi|221232908|ref|YP_002512062.1| late competence protein [Streptococcus pneumoniae ATCC 700669]
 gi|225857776|ref|YP_002739287.1| putative competence protein ComF [Streptococcus pneumoniae P1031]
 gi|15459717|gb|AAL00814.1| Involved in transformation (competence for DNA uptake)
           [Streptococcus pneumoniae R6]
 gi|116076445|gb|ABJ54165.1| competence protein ComF, putative [Streptococcus pneumoniae D39]
 gi|147756001|gb|EDK63044.1| competence protein ComF, putative [Streptococcus pneumoniae
           SP11-BS70]
 gi|183578021|gb|EDT98549.1| comF family protein [Streptococcus pneumoniae MLV-016]
 gi|220675370|emb|CAR69969.1| putative late competence protein [Streptococcus pneumoniae ATCC
           700669]
 gi|225725351|gb|ACO21203.1| putative competence protein ComF [Streptococcus pneumoniae P1031]
          Length = 220

 Score = 38.1 bits (87), Expect = 0.44,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 23/37 (62%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           KILLIDD+YTTGAT       L++AGA  V   +  R
Sbjct: 184 KILLIDDIYTTGATINRVKKLLEEAGAKDVKTFSLVR 220


>gi|227431276|ref|ZP_03913330.1| competence protein FC [Leuconostoc mesenteroides subsp. cremoris
           ATCC 19254]
 gi|227353038|gb|EEJ43210.1| competence protein FC [Leuconostoc mesenteroides subsp. cremoris
           ATCC 19254]
          Length = 158

 Score = 38.1 bits (87), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 26/41 (63%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           + G  ILL+DDVYTTG+T   AA  L   GA +V  ++ +R
Sbjct: 118 IEGQSILLVDDVYTTGSTLHHAADLLLAHGADSVKSISLAR 158


>gi|94987553|ref|YP_595486.1| amidophosphoribosyltransferases [Lawsonia intracellularis
           PHE/MN1-00]
 gi|94731802|emb|CAJ55165.1| predicted amidophosphoribosyltransferases [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 260

 Score = 38.1 bits (87), Expect = 0.45,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF         V GL+ILLIDD+ TTG T + A  AL K     + +   +R+
Sbjct: 201 IKNAFQA----DPGVKGLRILLIDDIMTTGTTLQQATKALLKQHTQAIDVCIIART 252


>gi|325963931|ref|YP_004241837.1| amidophosphoribosyltransferase [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323470018|gb|ADX73703.1| putative amidophosphoribosyltransferase [Arthrobacter
           phenanthrenivorans Sphe3]
          Length = 299

 Score = 38.1 bits (87), Expect = 0.45,   Method: Composition-based stats.
 Identities = 22/45 (48%), Positives = 28/45 (62%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGA 45
           +R +  V +   K VAG + ++IDDV TTGAT   AA AL  AGA
Sbjct: 213 VRGSMQVRKRGRKRVAGRRCIIIDDVLTTGATLAEAARALHGAGA 257


>gi|221233810|ref|YP_002516246.1| amidophosphoribosyltransferase family protein [Caulobacter
           crescentus NA1000]
 gi|220962982|gb|ACL94338.1| amidophosphoribosyltransferase family protein [Caulobacter
           crescentus NA1000]
          Length = 208

 Score = 38.1 bits (87), Expect = 0.45,   Method: Composition-based stats.
 Identities = 29/52 (55%), Positives = 34/52 (65%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           AF VP    + VAG KILLIDDV TTGATA+  A AL  AGA  V++   +R
Sbjct: 148 AFVVPPSRRRLVAGRKILLIDDVLTTGATAEGCARALLAAGAARVTLAIVAR 199


>gi|154687660|ref|YP_001422821.1| hypothetical protein RBAM_032600 [Bacillus amyloliquefaciens FZB42]
 gi|154353511|gb|ABS75590.1| ComFC [Bacillus amyloliquefaciens FZB42]
          Length = 225

 Score = 38.1 bits (87), Expect = 0.45,   Method: Composition-based stats.
 Identities = 22/41 (53%), Positives = 27/41 (65%), Gaps = 1/41 (2%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAG-AMTVSILTFSRS 56
           G+ ++LIDD+YTTGAT   AA  L  AG A +VS  T  RS
Sbjct: 185 GMNVILIDDIYTTGATLHQAAEVLLTAGKASSVSSFTLIRS 225


>gi|317499399|ref|ZP_07957666.1| hypothetical protein HMPREF0996_02650 [Lachnospiraceae bacterium
          5_1_63FAA]
 gi|316893271|gb|EFV15486.1| hypothetical protein HMPREF0996_02650 [Lachnospiraceae bacterium
          5_1_63FAA]
          Length = 92

 Score = 37.7 bits (86), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 23/33 (69%)

Query: 19 KILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51
          +IL+IDD+YTTG+TA+    ALK+ G   V + 
Sbjct: 51 RILVIDDIYTTGSTAEAVTTALKQLGVQEVYVF 83


>gi|91203265|emb|CAJ72904.1| similar to competence protein F [Candidatus Kuenenia
           stuttgartiensis]
          Length = 249

 Score = 37.7 bits (86), Expect = 0.46,   Method: Composition-based stats.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           G ++LL+DDV TTG T +  A  LKK GA ++ +  F+
Sbjct: 206 GKRVLLVDDVLTTGLTMRECAKKLKKTGAKSIHLFVFA 243


>gi|124485144|ref|YP_001029760.1| orotate phosphoribosyltransferase [Methanocorpusculum labreanum Z]
 gi|156633589|sp|A2SQ87|PYRE_METLZ RecName: Full=Orotate phosphoribosyltransferase; Short=OPRT;
           Short=OPRTase
 gi|124362685|gb|ABN06493.1| orotate phosphoribosyltransferase [Methanocorpusculum labreanum Z]
          Length = 169

 Score = 37.7 bits (86), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 30/44 (68%)

Query: 9   QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
           Q +  +V G ++LLI+DV T+G ++K     L+KAGA+  S++T
Sbjct: 96  QMIIGNVKGQRVLLIEDVTTSGGSSKYGVEELRKAGALIDSVVT 139


>gi|311745081|ref|ZP_07718866.1| competence protein F-related protein [Algoriphagus sp. PR1]
 gi|126577594|gb|EAZ81814.1| competence protein F-related protein [Algoriphagus sp. PR1]
          Length = 230

 Score = 37.7 bits (86), Expect = 0.47,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 27/42 (64%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           + V+GL++LL+DDV TTGAT    A  L   GA  V ++T +
Sbjct: 186 QSVSGLRVLLVDDVMTTGATLCACANVLLANGAKMVDLVTIA 227


>gi|326693422|ref|ZP_08230427.1| late competence protein [Leuconostoc argentinum KCTC 3773]
          Length = 136

 Score = 37.7 bits (86), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 28/45 (62%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           V+K +   ++LL+D+VYTTG T   AA  L + GA  V  L+ +R
Sbjct: 92  VTKDLGNQRVLLVDNVYTTGNTLDHAAALLYQLGAKEVKSLSLAR 136


>gi|149003071|ref|ZP_01827980.1| competence protein ComF, putative [Streptococcus pneumoniae
           SP14-BS69]
 gi|147758812|gb|EDK65808.1| competence protein ComF, putative [Streptococcus pneumoniae
           SP14-BS69]
          Length = 220

 Score = 37.7 bits (86), Expect = 0.47,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 23/37 (62%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           KILLIDD+YTTGAT       L++AGA  V   +  R
Sbjct: 184 KILLIDDIYTTGATINRVKKLLEEAGAKDVKTFSLVR 220


>gi|206890480|ref|YP_002248775.1| phosphoribosyltransferase [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|206742418|gb|ACI21475.1| phosphoribosyltransferase [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 219

 Score = 37.7 bits (86), Expect = 0.48,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NA+ V   + +    +K+ L+DDV TTGAT    A  LKKAG   V  +T +R++
Sbjct: 167 VKNAYKVTGLMKE----IKVGLVDDVVTTGATLMECAKTLKKAGIKEVHAITLARTI 219


>gi|330827872|ref|YP_004390824.1| Competence protein F [Aeromonas veronii B565]
 gi|328803008|gb|AEB48207.1| Competence protein F [Aeromonas veronii B565]
          Length = 242

 Score = 37.7 bits (86), Expect = 0.48,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 5/58 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +  +  +HVA     L+DDV TTGATA   +  L ++G   V +    R+L+
Sbjct: 187 LREAFRIRSHQYRHVA-----LLDDVVTTGATAGQLSRLLHESGITKVEVWAICRTLR 239


>gi|45658877|ref|YP_002963.1| ComFC-like protein [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
 gi|45602122|gb|AAS71600.1| ComFC-like protein [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
          Length = 251

 Score = 37.7 bits (86), Expect = 0.49,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           R AF + +     + G   LLIDDV+TTGA+A   A  L + GA +V ILT  R+
Sbjct: 184 RLAFKIKKEYKGKLKG-NYLLIDDVFTTGASANELARILIQNGADSVRILTLIRT 237


>gi|160893717|ref|ZP_02074501.1| hypothetical protein CLOL250_01271 [Clostridium sp. L2-50]
 gi|156864702|gb|EDO58133.1| hypothetical protein CLOL250_01271 [Clostridium sp. L2-50]
          Length = 240

 Score = 37.7 bits (86), Expect = 0.49,   Method: Composition-based stats.
 Identities = 16/31 (51%), Positives = 23/31 (74%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
           +LLIDD+YTTGAT +    AL++AGA  + +
Sbjct: 201 VLLIDDIYTTGATVQACTEALQEAGAEQIYV 231


>gi|21229867|ref|NP_635784.1| competence protein F [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66766744|ref|YP_241506.1| competence protein F [Xanthomonas campestris pv. campestris str.
           8004]
 gi|188989813|ref|YP_001901823.1| hypothetical protein xccb100_0417 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21111369|gb|AAM39708.1| competence protein F [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66572076|gb|AAY47486.1| competence protein F [Xanthomonas campestris pv. campestris str.
           8004]
 gi|167731573|emb|CAP49748.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris]
          Length = 243

 Score = 37.7 bits (86), Expect = 0.49,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 30/55 (54%), Gaps = 5/55 (9%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +R+AF     +  HVA     L+DDV TTGAT   AA AL++AG   V     +R
Sbjct: 192 LRDAFLAHGPLPTHVA-----LVDDVMTTGATLHAAAQALRRAGVQRVDAWVCAR 241


>gi|298386098|ref|ZP_06995655.1| competence protein F-related protein [Bacteroides sp. 1_1_14]
 gi|298261326|gb|EFI04193.1| competence protein F-related protein [Bacteroides sp. 1_1_14]
          Length = 226

 Score = 37.7 bits (86), Expect = 0.50,   Method: Composition-based stats.
 Identities = 18/43 (41%), Positives = 28/43 (65%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           S+++AG  IL++DDV TTGAT    A  L +   + +S+LT +
Sbjct: 181 SEYLAGKHILIVDDVLTTGATTVACASRLAEIEGVRISVLTLA 223


>gi|126724616|ref|ZP_01740459.1| Competence protein F [Rhodobacterales bacterium HTCC2150]
 gi|126705780|gb|EBA04870.1| Competence protein F [Rhodobacterales bacterium HTCC2150]
          Length = 240

 Score = 37.7 bits (86), Expect = 0.50,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 30/56 (53%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           A +V       + G  +L+IDDV T+GA    +  A K+AGA  V + T +R  KD
Sbjct: 184 AIDVHPKAQDFIKGRSVLIIDDVMTSGAILAASTEAAKQAGADDVFVATLARVAKD 239


>gi|29348209|ref|NP_811712.1| putative amidophosphoribosyl-transferase [Bacteroides
           thetaiotaomicron VPI-5482]
 gi|29340112|gb|AAO77906.1| putative amidophosphoribosyl-transferase [Bacteroides
           thetaiotaomicron VPI-5482]
          Length = 235

 Score = 37.7 bits (86), Expect = 0.50,   Method: Composition-based stats.
 Identities = 18/43 (41%), Positives = 28/43 (65%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           S+++AG  IL++DDV TTGAT    A  L +   + +S+LT +
Sbjct: 190 SEYLAGKHILIVDDVLTTGATTVACASRLAEIEGVRISVLTLA 232


>gi|167766043|ref|ZP_02438096.1| hypothetical protein CLOSS21_00536 [Clostridium sp. SS2/1]
 gi|167712123|gb|EDS22702.1| hypothetical protein CLOSS21_00536 [Clostridium sp. SS2/1]
          Length = 190

 Score = 37.7 bits (86), Expect = 0.51,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 35/58 (60%), Gaps = 7/58 (12%)

Query: 1   MRNAF--NVPQYVSKHVAGL--KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF  N+ +Y     AG+  ++L+IDD+YTTG+TA+    ALK+ G   V +   +
Sbjct: 130 LKKAFRGNLKEY---QKAGMPKRVLVIDDIYTTGSTAEAVTTALKQLGVQEVYVFCIA 184


>gi|257091917|ref|YP_003165558.1| phosphoribosyltransferase [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257044441|gb|ACV33629.1| phosphoribosyltransferase [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 235

 Score = 37.7 bits (86), Expect = 0.51,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 36/57 (63%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF    + +  + G +++L+DDV TTGA+    A  +K  GA+ V++LT +R+L
Sbjct: 181 VRGAF----HCATDLTGKRLVLVDDVMTTGASLNELARTVKLHGAVEVTLLTLARAL 233


>gi|114327260|ref|YP_744417.1| amidophosphoribosyltransferase family protein [Granulibacter
           bethesdensis CGDNIH1]
 gi|114315434|gb|ABI61494.1| amidophosphoribosyltransferase family protein [Granulibacter
           bethesdensis CGDNIH1]
          Length = 282

 Score = 37.7 bits (86), Expect = 0.51,   Method: Composition-based stats.
 Identities = 20/55 (36%), Positives = 30/55 (54%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           MR A        + +   +I+++DDV T+GAT      AL  AGA +V +LT +R
Sbjct: 211 MRGAIQTRAARRQKLRAARIVVVDDVMTSGATISACVRALYAAGAASVDVLTAAR 265


>gi|311695378|gb|ADP98251.1| competence protein ComF [marine bacterium HP15]
          Length = 247

 Score = 37.7 bits (86), Expect = 0.52,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 5/56 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R  F V   V + +A     ++DDV TTGAT +  + AL++AGA  + +   +R+
Sbjct: 195 LRGVFEVIPPVPERIA-----IVDDVVTTGATVRVLSSALREAGARNIQVWALART 245


>gi|294789652|ref|ZP_06754886.1| ComF/gntX family protein [Simonsiella muelleri ATCC 29453]
 gi|294482453|gb|EFG30146.1| ComF/gntX family protein [Simonsiella muelleri ATCC 29453]
          Length = 211

 Score = 37.7 bits (86), Expect = 0.54,   Method: Composition-based stats.
 Identities = 20/41 (48%), Positives = 25/41 (60%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           V GL IL+IDD+ TTGAT      +LK AGA  + I   +R
Sbjct: 170 VRGLNILIIDDILTTGATLTELTRSLKNAGANHIYIWVVAR 210


>gi|227355055|ref|ZP_03839466.1| competence protein F [Proteus mirabilis ATCC 29906]
 gi|227164842|gb|EEI49689.1| competence protein F [Proteus mirabilis ATCC 29906]
          Length = 166

 Score = 37.7 bits (86), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           NAF V + VS  VAG  + LIDDV TT AT       L +AGA +V +    R+L
Sbjct: 114 NAFIVNRTVS--VAGKDLALIDDVITTSATLNAIVPLLFRAGARSVEVWAICRTL 166


>gi|116617377|ref|YP_817748.1| amidophosphoribosyltransferase [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
 gi|116096224|gb|ABJ61375.1| Predicted amidophosphoribosyltransferase [Leuconostoc mesenteroides
           subsp. mesenteroides ATCC 8293]
          Length = 224

 Score = 37.7 bits (86), Expect = 0.54,   Method: Composition-based stats.
 Identities = 20/43 (46%), Positives = 27/43 (62%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           K + G  ILL+DDVYTTG+T   AA  L   GA +V  ++ +R
Sbjct: 182 KIIEGQSILLVDDVYTTGSTLHHAADLLLAHGADSVKSISLAR 224


>gi|298370454|ref|ZP_06981770.1| ComF/gntX family protein [Neisseria sp. oral taxon 014 str. F0314]
 gi|298281914|gb|EFI23403.1| ComF/gntX family protein [Neisseria sp. oral taxon 014 str. F0314]
          Length = 240

 Score = 37.7 bits (86), Expect = 0.54,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF++   V K      ILLIDDV TTG+T    A  LKK+GA  V   + +R+
Sbjct: 184 VKNAFSIENDVFKK---RNILLIDDVVTTGSTFGELAQTLKKSGAEKVFCWSLARA 236


>gi|332071476|gb|EGI81970.1| transformation protein [Streptococcus pneumoniae GA41301]
          Length = 172

 Score = 37.7 bits (86), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 23/37 (62%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           KILLIDD+YTTGAT       L++AGA  V   +  R
Sbjct: 136 KILLIDDIYTTGATINRVKKLLEEAGAKDVKTFSLVR 172


>gi|111657978|ref|ZP_01408684.1| hypothetical protein SpneT_02000834 [Streptococcus pneumoniae
           TIGR4]
 gi|183603360|ref|ZP_02711693.2| comF family protein [Streptococcus pneumoniae CDC1087-00]
 gi|183569921|gb|EDT90449.1| comF family protein [Streptococcus pneumoniae CDC1087-00]
 gi|332071288|gb|EGI81783.1| transformation protein [Streptococcus pneumoniae GA17545]
          Length = 172

 Score = 37.7 bits (86), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 23/37 (62%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           KILLIDD+YTTGAT       L++AGA  V   +  R
Sbjct: 136 KILLIDDIYTTGATINRVKKLLEEAGAKDVKTFSLVR 172


>gi|161505924|ref|YP_001573035.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160867271|gb|ABX23894.1| hypothetical protein SARI_04105 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 243

 Score = 37.7 bits (86), Expect = 0.55,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L ++GA TV +    R+L
Sbjct: 191 LKNAFRL----ELPVRGLHMVIVDDVVTTGSTVAEIAQLLLRSGAATVQVWCLCRTL 243


>gi|20806995|ref|NP_622166.1| amidophosphoribosyltransferase [Thermoanaerobacter tengcongensis
           MB4]
 gi|254478842|ref|ZP_05092207.1| Phosphoribosyl transferase domain protein [Carboxydibrachium
           pacificum DSM 12653]
 gi|20515478|gb|AAM23770.1| predicted amidophosphoribosyltransferases [Thermoanaerobacter
           tengcongensis MB4]
 gi|214035204|gb|EEB75913.1| Phosphoribosyl transferase domain protein [Carboxydibrachium
           pacificum DSM 12653]
          Length = 228

 Score = 37.7 bits (86), Expect = 0.55,   Method: Composition-based stats.
 Identities = 19/40 (47%), Positives = 26/40 (65%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           + G  +LL+DDV TTGAT    A ALK+ GA  V ++T +
Sbjct: 185 IEGKNVLLVDDVLTTGATLDECAKALKENGAKEVYVVTIA 224


>gi|291280268|ref|YP_003497103.1| hypothetical protein DEFDS_1895 [Deferribacter desulfuricans SSM1]
 gi|290754970|dbj|BAI81347.1| conserved hypothetical protein [Deferribacter desulfuricans SSM1]
          Length = 221

 Score = 37.7 bits (86), Expect = 0.55,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 26/42 (61%)

Query: 14  HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++ GLKILL+DD+ TTGAT    +  L K GA  V +   ++
Sbjct: 176 NLKGLKILLVDDIMTTGATINECSKVLLKNGAKKVDVFCLTK 217


>gi|328956710|ref|YP_004374096.1| putative component of the DNA transport apparatus [Carnobacterium
           sp. 17-4]
 gi|328673034|gb|AEB29080.1| putative component of the DNA transport apparatus [Carnobacterium
           sp. 17-4]
          Length = 228

 Score = 37.7 bits (86), Expect = 0.57,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 30/51 (58%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           F V + +   + G  ++L+DD+YTTG T   AA  L ++GA ++   + SR
Sbjct: 178 FVVDKSLQISIKGKHLILVDDIYTTGRTFFHAADCLMRSGAQSIETFSVSR 228


>gi|325299192|ref|YP_004259109.1| phosphoribosyltransferase [Bacteroides salanitronis DSM 18170]
 gi|324318745|gb|ADY36636.1| phosphoribosyltransferase [Bacteroides salanitronis DSM 18170]
          Length = 229

 Score = 37.7 bits (86), Expect = 0.58,   Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 23/38 (60%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           G  ILL+DDV TTGAT    A AL   G + +S+ T +
Sbjct: 189 GKHILLVDDVLTTGATLTACADALSSVGGIRISVATLA 226


>gi|257465154|ref|ZP_05629525.1| competence protein F [Actinobacillus minor 202]
 gi|257450814|gb|EEV24857.1| competence protein F [Actinobacillus minor 202]
          Length = 229

 Score = 37.7 bits (86), Expect = 0.58,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 2   RNAFNVPQYVSKHVAG---LKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           RN     +Y  +  AG    +I +IDDV TTG+T     + LKKAG   V + T +R+
Sbjct: 172 RNLKGAFRYQPQRQAGKFYQRIAIIDDVVTTGSTLNTICLELKKAGVKEVQVWTLARA 229


>gi|240949768|ref|ZP_04754100.1| competence protein F [Actinobacillus minor NM305]
 gi|240295800|gb|EER46487.1| competence protein F [Actinobacillus minor NM305]
          Length = 229

 Score = 37.7 bits (86), Expect = 0.58,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 2   RNAFNVPQYVSKHVAG---LKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           RN     +Y  +  AG    +I +IDDV TTG+T     + LKKAG   V + T +R+
Sbjct: 172 RNLKGAFRYQPQRQAGKFYQRIAIIDDVVTTGSTLNTICLELKKAGVKEVQVWTLARA 229


>gi|114762234|ref|ZP_01441702.1| Competence protein F [Pelagibaca bermudensis HTCC2601]
 gi|114545258|gb|EAU48261.1| Competence protein F [Roseovarius sp. HTCC2601]
          Length = 241

 Score = 37.7 bits (86), Expect = 0.58,   Method: Composition-based stats.
 Identities = 19/40 (47%), Positives = 25/40 (62%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +LL+DDV T+GAT   A  A   AGA  V + T +R +KD
Sbjct: 201 LLLVDDVMTSGATLSAATEACLAAGAGDVCVCTLARVVKD 240


>gi|83746861|ref|ZP_00943908.1| Amidophosphoribosyltransferase family protein [Ralstonia
           solanacearum UW551]
 gi|207742204|ref|YP_002258596.1| competence protein f-related protein [Ralstonia solanacearum
           IPO1609]
 gi|83726446|gb|EAP73577.1| Amidophosphoribosyltransferase family protein [Ralstonia
           solanacearum UW551]
 gi|206593592|emb|CAQ60519.1| competence protein f-related protein [Ralstonia solanacearum
           IPO1609]
          Length = 245

 Score = 37.7 bits (86), Expect = 0.58,   Method: Composition-based stats.
 Identities = 21/49 (42%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVS 49
           ++  F+VP      VAG  + ++DDV TTGAT    A  LK+AGA  V+
Sbjct: 191 LQGTFDVPDPAC--VAGRHVGVVDDVMTTGATLSEVATQLKRAGAARVT 237


>gi|332199028|gb|EGJ13109.1| transformation protein [Streptococcus pneumoniae GA47901]
          Length = 172

 Score = 37.7 bits (86), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 23/37 (62%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           KILLIDD+YTTGAT       L++AGA  V   +  R
Sbjct: 136 KILLIDDIYTTGATINRVKKLLEEAGAKDVKTFSLVR 172


>gi|332198620|gb|EGJ12703.1| transformation protein [Streptococcus pneumoniae GA41317]
          Length = 172

 Score = 37.7 bits (86), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 23/37 (62%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           KILLIDD+YTTGAT       L++AGA  V   +  R
Sbjct: 136 KILLIDDIYTTGATINRVKKLLEEAGAKDVKTFSLVR 172


>gi|320547867|ref|ZP_08042150.1| competence protein FC [Streptococcus equinus ATCC 9812]
 gi|320447407|gb|EFW88167.1| competence protein FC [Streptococcus equinus ATCC 9812]
          Length = 221

 Score = 37.7 bits (86), Expect = 0.59,   Method: Composition-based stats.
 Identities = 20/36 (55%), Positives = 23/36 (63%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           IL+IDD+YTTGAT K     L K GA  V  LT +R
Sbjct: 186 ILIIDDIYTTGATLKGIYHLLYKNGAQNVKSLTIAR 221


>gi|120612548|ref|YP_972226.1| ComF family protein [Acidovorax citrulli AAC00-1]
 gi|120591012|gb|ABM34452.1| ComF family protein [Acidovorax citrulli AAC00-1]
          Length = 238

 Score = 37.4 bits (85), Expect = 0.61,   Method: Composition-based stats.
 Identities = 22/52 (42%), Positives = 29/52 (55%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           F V    +  V G  I+L+DDV TTGAT   AA  L +AGA  V  +  +R+
Sbjct: 186 FAVAPDRAARVRGQGIVLVDDVMTTGATLHAAARVLLQAGAARVDAVVLART 237


>gi|323142221|ref|ZP_08077055.1| comF family protein [Phascolarctobacterium sp. YIT 12067]
 gi|322413284|gb|EFY04169.1| comF family protein [Phascolarctobacterium sp. YIT 12067]
          Length = 241

 Score = 37.4 bits (85), Expect = 0.62,   Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 24/39 (61%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           V+G  +LL DD+YTTG+T   AA  L  AGA  VS L  
Sbjct: 195 VSGKHVLLCDDIYTTGSTFAEAAQVLLDAGAARVSALAL 233


>gi|300173966|ref|YP_003773132.1| ComF operon protein 3 [Leuconostoc gasicomitatum LMG 18811]
 gi|299888345|emb|CBL92313.1| ComF operon protein 3 [Leuconostoc gasicomitatum LMG 18811]
          Length = 223

 Score = 37.4 bits (85), Expect = 0.62,   Method: Composition-based stats.
 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +  F + + VS  + G ++LL+DDVYTTG T   AA  L + GA  V  ++ SR
Sbjct: 172 KQPFTMIEQVS--LKGKEVLLVDDVYTTGNTLYHAADLLYECGAKNVKSISLSR 223


>gi|255534812|ref|YP_003095183.1| competence protein [Flavobacteriaceae bacterium 3519-10]
 gi|255341008|gb|ACU07121.1| competence protein [Flavobacteriaceae bacterium 3519-10]
          Length = 228

 Score = 37.4 bits (85), Expect = 0.62,   Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 6/53 (11%)

Query: 3   NAFNVPQYV-SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           N F+V Q + +KHV     L+IDDV+TTG T    A  + KAG   VS+L  +
Sbjct: 179 NMFSVTQKIDNKHV-----LIIDDVFTTGNTMSSVAWEILKAGNNQVSVLVMA 226


>gi|209542312|ref|YP_002274541.1| putative phosphoribosyltransferase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209529989|gb|ACI49926.1| putative phosphoribosyltransferase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 260

 Score = 37.4 bits (85), Expect = 0.62,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 27/42 (64%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +A  +I+L+DDV TTGAT    A  L  AGA +V +L  +R+
Sbjct: 204 IANRRIVLVDDVMTTGATTGECARVLLAAGAASVDVLVAARA 245


>gi|330956967|gb|EGH57227.1| competence protein ComF [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 244

 Score = 37.4 bits (85), Expect = 0.63,   Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 35/61 (57%), Gaps = 8/61 (13%)

Query: 1   MRNAFNV--PQYV-SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF +  P +V  KH+A     ++DDV TTG+TA+  A  L  AGA  V +   +R+ 
Sbjct: 186 LRGAFTLRDPDWVHGKHLA-----VVDDVLTTGSTAEVIARLLNSAGARRVDVYCLARTP 240

Query: 58  K 58
           K
Sbjct: 241 K 241


>gi|167579697|ref|ZP_02372571.1| ComF family protein [Burkholderia thailandensis TXDOH]
          Length = 85

 Score = 37.4 bits (85), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 29/49 (59%)

Query: 11 VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
          V++ VAG  I ++DDV T+GAT    A  LK AGA  V+     R+ KD
Sbjct: 37 VARPVAGWHIGVVDDVMTSGATLDALARKLKDAGARRVTNFVALRTAKD 85


>gi|119953552|ref|YP_945762.1| adenine phosphoribosyltransferase [Borrelia turicatae 91E135]
 gi|86156132|gb|ABC86784.1| adenine phosphoribosyltransferase [Borrelia turicatae]
 gi|119862323|gb|AAX18091.1| adenine phosphoribosyltransferase [Borrelia turicatae 91E135]
          Length = 181

 Score = 37.4 bits (85), Expect = 0.63,   Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 22/34 (64%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           ILL+DD+  TG T K AA+ LKK+G +   I  F
Sbjct: 124 ILLVDDILATGGTLKAAAMLLKKSGGVVSDIFCF 157


>gi|146296670|ref|YP_001180441.1| phosphoribosyltransferase [Caldicellulosiruptor saccharolyticus DSM
           8903]
 gi|145410246|gb|ABP67250.1| phosphoribosyltransferase [Caldicellulosiruptor saccharolyticus DSM
           8903]
          Length = 232

 Score = 37.4 bits (85), Expect = 0.63,   Method: Composition-based stats.
 Identities = 19/43 (44%), Positives = 30/43 (69%), Gaps = 2/43 (4%)

Query: 15  VAGLKILLIDDVYTTGATA-KCAAIALKK-AGAMTVSILTFSR 55
           V G  +LL+DD++TTGATA +C+ + LK  A  + VS+L  ++
Sbjct: 186 VKGKTVLLVDDIFTTGATADECSKVLLKSGANKVYVSVLAITK 228


>gi|74316335|ref|YP_314075.1| hypothetical protein Tbd_0317 [Thiobacillus denitrificans ATCC
           25259]
 gi|74055830|gb|AAZ96270.1| conserved hypothetical protein [Thiobacillus denitrificans ATCC
           25259]
          Length = 230

 Score = 37.4 bits (85), Expect = 0.64,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF      S  + G+ + +IDDV TTG +    A  LK+AGA  VS    +R+L
Sbjct: 174 LRGAFAC----STDLGGMHVAVIDDVMTTGTSLNELAATLKRAGAREVSCWVAARTL 226


>gi|170691540|ref|ZP_02882705.1| putative competence protein F-related protein [Burkholderia
           graminis C4D1M]
 gi|170143745|gb|EDT11908.1| putative competence protein F-related protein [Burkholderia
           graminis C4D1M]
          Length = 233

 Score = 37.4 bits (85), Expect = 0.65,   Method: Composition-based stats.
 Identities = 21/49 (42%), Positives = 30/49 (61%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           V+ +V GL + ++DDV TTGAT +  A  LK AGA  V+     R+ K+
Sbjct: 185 VAGNVQGLHVGIVDDVMTTGATLEALARTLKAAGARRVTNFVALRTPKN 233


>gi|119471388|ref|ZP_01613860.1| hypothetical protein ATW7_17117 [Alteromonadales bacterium TW-7]
 gi|119445664|gb|EAW26948.1| hypothetical protein ATW7_17117 [Alteromonadales bacterium TW-7]
          Length = 224

 Score = 37.4 bits (85), Expect = 0.66,   Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 4/52 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
           + NAF      ++ ++G  + ++DD+ TTGAT   A  ALKKAGA  V   T
Sbjct: 171 LTNAF----ICTEDMSGKTVAIVDDIMTTGATLNAATQALKKAGAKQVWAFT 218


>gi|88811929|ref|ZP_01127182.1| competence protein F [Nitrococcus mobilis Nb-231]
 gi|88790813|gb|EAR21927.1| competence protein F [Nitrococcus mobilis Nb-231]
          Length = 219

 Score = 37.4 bits (85), Expect = 0.67,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 31/56 (55%), Gaps = 6/56 (10%)

Query: 2   RNAFNVP-QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           R AF V  ++V  HVA     +IDDV TTGAT       L++AGA  V I   +R+
Sbjct: 164 RGAFQVTTRHVPAHVA-----VIDDVLTTGATVTELTKTLRRAGAERVEIWVMART 214


>gi|325268457|ref|ZP_08135087.1| putative amidophosphoribosyl-transferase [Prevotella multiformis
           DSM 16608]
 gi|324988985|gb|EGC20938.1| putative amidophosphoribosyl-transferase [Prevotella multiformis
           DSM 16608]
          Length = 229

 Score = 37.4 bits (85), Expect = 0.67,   Method: Composition-based stats.
 Identities = 19/34 (55%), Positives = 24/34 (70%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           +LL+DDV TTGAT   AA  L KAG + VS+L+ 
Sbjct: 190 VLLVDDVITTGATLVAAARELFKAGNVKVSVLSL 223


>gi|320458227|dbj|BAJ68848.1| hypothetical protein BLIJ_1260 [Bifidobacterium longum subsp.
           infantis ATCC 15697]
          Length = 221

 Score = 37.4 bits (85), Expect = 0.67,   Method: Composition-based stats.
 Identities = 18/36 (50%), Positives = 23/36 (63%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +LL+DD + TGA A+  A  LK AGA  VSI   +R
Sbjct: 146 VLLLDDSWVTGANAQSVAACLKTAGAEQVSIYCVAR 181


>gi|282880493|ref|ZP_06289200.1| ComF family protein [Prevotella timonensis CRIS 5C-B1]
 gi|281305596|gb|EFA97649.1| ComF family protein [Prevotella timonensis CRIS 5C-B1]
          Length = 239

 Score = 37.4 bits (85), Expect = 0.67,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           + NAF +    S  + G  +LLIDD+ TTGAT    A  L++ G + +S+L    + K
Sbjct: 184 VENAFELIN--STLIVGKHVLLIDDIVTTGATVCSCAETLQRDGTVKISVLALGCTRK 239


>gi|213692110|ref|YP_002322696.1| hypothetical protein Blon_1230 [Bifidobacterium longum subsp.
           infantis ATCC 15697]
 gi|213523571|gb|ACJ52318.1| hypothetical protein Blon_1230 [Bifidobacterium longum subsp.
           infantis ATCC 15697]
          Length = 252

 Score = 37.4 bits (85), Expect = 0.67,   Method: Composition-based stats.
 Identities = 18/36 (50%), Positives = 23/36 (63%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +LL+DD + TGA A+  A  LK AGA  VSI   +R
Sbjct: 177 VLLLDDSWVTGANAQSVAACLKTAGAEQVSIYCVAR 212


>gi|162147687|ref|YP_001602148.1| phosphoribosyltransferase [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786264|emb|CAP55846.1| putative phosphoribosyltransferase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 276

 Score = 37.4 bits (85), Expect = 0.68,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 27/42 (64%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +A  +I+L+DDV TTGAT    A  L  AGA +V +L  +R+
Sbjct: 220 IANRRIVLVDDVMTTGATTGECARVLLAAGAASVDVLVAARA 261


>gi|229032809|ref|ZP_04188765.1| ComF operon protein 3 [Bacillus cereus AH1271]
 gi|228728482|gb|EEL79502.1| ComF operon protein 3 [Bacillus cereus AH1271]
          Length = 234

 Score = 37.4 bits (85), Expect = 0.68,   Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 22/37 (59%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ILL+DDVYTTG T +     L   GA  VS LT  RS
Sbjct: 198 ILLVDDVYTTGITVRQIGSLLYDRGAREVSSLTLCRS 234


>gi|229175862|ref|ZP_04303360.1| ComF operon protein 3 [Bacillus cereus MM3]
 gi|228607595|gb|EEK64919.1| ComF operon protein 3 [Bacillus cereus MM3]
          Length = 181

 Score = 37.4 bits (85), Expect = 0.68,   Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 22/37 (59%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ILL+DDVYTTG T +     L   GA  VS LT  RS
Sbjct: 145 ILLVDDVYTTGITVRQIGSLLYDRGAREVSSLTLCRS 181


>gi|331086209|ref|ZP_08335291.1| hypothetical protein HMPREF0987_01594 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330406368|gb|EGG85882.1| hypothetical protein HMPREF0987_01594 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 258

 Score = 37.4 bits (85), Expect = 0.69,   Method: Composition-based stats.
 Identities = 18/36 (50%), Positives = 23/36 (63%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           K+LL+DD+YTTG+T    A  LK+ G   V  LT S
Sbjct: 218 KVLLVDDIYTTGSTVDELARILKENGVQKVYFLTIS 253


>gi|325662408|ref|ZP_08151017.1| hypothetical protein HMPREF0490_01756 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|325471410|gb|EGC74633.1| hypothetical protein HMPREF0490_01756 [Lachnospiraceae bacterium
           4_1_37FAA]
          Length = 258

 Score = 37.4 bits (85), Expect = 0.69,   Method: Composition-based stats.
 Identities = 18/36 (50%), Positives = 23/36 (63%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           K+LL+DD+YTTG+T    A  LK+ G   V  LT S
Sbjct: 218 KVLLVDDIYTTGSTVDELARILKENGVQKVYFLTIS 253


>gi|119358139|ref|YP_912783.1| phosphoribosyltransferase [Chlorobium phaeobacteroides DSM 266]
 gi|119355488|gb|ABL66359.1| phosphoribosyltransferase [Chlorobium phaeobacteroides DSM 266]
          Length = 231

 Score = 37.4 bits (85), Expect = 0.69,   Method: Composition-based stats.
 Identities = 16/30 (53%), Positives = 23/30 (76%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           +++L+DD+ TTGAT   AA AL+K GA T+
Sbjct: 191 RVILVDDIVTTGATMVAAAQALQKGGAETI 220


>gi|330979909|gb|EGH78209.1| phosphoribosyltransferase [Pseudomonas syringae pv. aptata str. DSM
           50252]
          Length = 244

 Score = 37.4 bits (85), Expect = 0.69,   Method: Composition-based stats.
 Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 6/60 (10%)

Query: 1   MRNAFNV--PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +  P +V     G  + L+DDV TTG+TA   A  L  AGA  V +   +R+ K
Sbjct: 186 LRGAFTLIDPDWVQ----GRHLALVDDVLTTGSTADVIARLLSNAGARRVDVYCLARTPK 241


>gi|330938548|gb|EGH42131.1| phosphoribosyltransferase [Pseudomonas syringae pv. pisi str.
           1704B]
          Length = 244

 Score = 37.4 bits (85), Expect = 0.69,   Method: Composition-based stats.
 Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 6/60 (10%)

Query: 1   MRNAFNV--PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +  P +V     G  + L+DDV TTG+TA   A  L  AGA  V +   +R+ K
Sbjct: 186 LRGAFTLIDPDWVQ----GRHLALVDDVLTTGSTADVIARLLSNAGARRVDVYCLARTPK 241


>gi|330898835|gb|EGH30254.1| phosphoribosyltransferase [Pseudomonas syringae pv. japonica str.
           M301072PT]
          Length = 244

 Score = 37.4 bits (85), Expect = 0.69,   Method: Composition-based stats.
 Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 6/60 (10%)

Query: 1   MRNAFNV--PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +  P +V     G  + L+DDV TTG+TA   A  L  AGA  V +   +R+ K
Sbjct: 186 LRGAFTLIDPDWVQ----GRHLALVDDVLTTGSTADVIARLLSNAGARRVDVYCLARTPK 241


>gi|305676148|ref|YP_003867820.1| putative component of the DNA transport apparatus [Bacillus
           subtilis subsp. spizizenii str. W23]
 gi|305414392|gb|ADM39511.1| putative component of the DNA transport apparatus [Bacillus
           subtilis subsp. spizizenii str. W23]
          Length = 240

 Score = 37.4 bits (85), Expect = 0.69,   Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 27/41 (65%), Gaps = 1/41 (2%)

Query: 17  GLKILLIDDVYTTGATAKCAA-IALKKAGAMTVSILTFSRS 56
           G+ I+LIDD+YTTGAT   AA   L+K  A +V+  T  RS
Sbjct: 200 GMNIILIDDLYTTGATLHFAARCLLEKGRAASVASFTLIRS 240


>gi|282848837|ref|ZP_06258230.1| ComF family protein [Veillonella parvula ATCC 17745]
 gi|294791747|ref|ZP_06756895.1| putative ComF family protein [Veillonella sp. 6_1_27]
 gi|294793608|ref|ZP_06758745.1| putative ComF family protein [Veillonella sp. 3_1_44]
 gi|282581491|gb|EFB86881.1| ComF family protein [Veillonella parvula ATCC 17745]
 gi|294455178|gb|EFG23550.1| putative ComF family protein [Veillonella sp. 3_1_44]
 gi|294456977|gb|EFG25339.1| putative ComF family protein [Veillonella sp. 6_1_27]
          Length = 231

 Score = 37.4 bits (85), Expect = 0.69,   Method: Composition-based stats.
 Identities = 16/35 (45%), Positives = 24/35 (68%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           IL++DD+YTTGAT +  A  L+K  A+ +  LT +
Sbjct: 193 ILIVDDIYTTGATIEAVAKVLQKHKALRIDALTLA 227


>gi|256379590|ref|YP_003103250.1| phosphoribosyltransferase [Actinosynnema mirum DSM 43827]
 gi|255923893|gb|ACU39404.1| phosphoribosyltransferase [Actinosynnema mirum DSM 43827]
          Length = 247

 Score = 37.4 bits (85), Expect = 0.69,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 26/42 (61%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           V G  + ++DDV+TTG T    A  L++AGA  V  LT +R+
Sbjct: 203 VHGATVAVVDDVFTTGNTLNAVARRLREAGARAVRGLTLARA 244


>gi|228936478|ref|ZP_04099276.1| ComF operon protein 3 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228823310|gb|EEM69144.1| ComF operon protein 3 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
          Length = 164

 Score = 37.4 bits (85), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 8   PQYVSKH--VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           P Y  +     G  ILL+DDVYTTG T +     L   GA  V  LT  RS
Sbjct: 114 PFYFQREEMFHGQHILLVDDVYTTGITVRQIGSLLYDRGAREVFSLTLCRS 164


>gi|259418155|ref|ZP_05742074.1| competence protein F [Silicibacter sp. TrichCH4B]
 gi|259347061|gb|EEW58875.1| competence protein F [Silicibacter sp. TrichCH4B]
          Length = 243

 Score = 37.4 bits (85), Expect = 0.70,   Method: Composition-based stats.
 Identities = 18/45 (40%), Positives = 29/45 (64%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +S+ + G ++LL+DDV T+G+T    A A   AGA  VS++  +R
Sbjct: 195 MSERLTGRQVLLVDDVMTSGSTLSACARACIDAGADGVSVVVLAR 239


>gi|324991964|gb|EGC23886.1| competence protein FC [Streptococcus sanguinis SK405]
          Length = 163

 Score = 37.4 bits (85), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 20/36 (55%), Positives = 24/36 (66%), Gaps = 2/36 (5%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           KILL+DD+YTTG T + A   L +AG     ILTFS
Sbjct: 127 KILLVDDIYTTGKTLQLAKQILLEAGVK--EILTFS 160


>gi|58700140|ref|ZP_00374654.1| putative amidophosphoribosyltransferase [Wolbachia endosymbiont
          of Drosophila ananassae]
 gi|58533342|gb|EAL57827.1| putative amidophosphoribosyltransferase [Wolbachia endosymbiont
          of Drosophila ananassae]
          Length = 85

 Score = 37.4 bits (85), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 27/40 (67%)

Query: 20 ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
          ++L+DDV TTGAT +  +  +  +GA  V +L+ +R++ D
Sbjct: 39 VILVDDVVTTGATVRSCSQEILNSGAKEVRVLSLARTVND 78


>gi|324329137|gb|ADY24397.1| comF operon protein 3 [Bacillus thuringiensis serovar finitimus
           YBT-020]
          Length = 190

 Score = 37.4 bits (85), Expect = 0.72,   Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 22/40 (55%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           G  ILL+DDVYTTG T +         GA  VS LT  RS
Sbjct: 151 GQHILLVDDVYTTGITVRQIGSLFYDKGASEVSSLTLCRS 190


>gi|281424790|ref|ZP_06255703.1| competence protein F-related protein [Prevotella oris F0302]
 gi|281401160|gb|EFB31991.1| competence protein F-related protein [Prevotella oris F0302]
          Length = 231

 Score = 37.4 bits (85), Expect = 0.72,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           +++AF +     + + G  +LLIDDV TTG+T    +  L KAG + VS+L+ 
Sbjct: 176 VKDAFRLQH--PERIIGRHLLLIDDVITTGSTMLACSKELTKAGDIKVSVLSL 226


>gi|229199307|ref|ZP_04325974.1| ComF operon protein 3 [Bacillus cereus m1293]
 gi|228584167|gb|EEK42318.1| ComF operon protein 3 [Bacillus cereus m1293]
          Length = 234

 Score = 37.4 bits (85), Expect = 0.72,   Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 22/40 (55%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           G  ILL+DDVYTTG T +         GA  VS LT  RS
Sbjct: 195 GQHILLVDDVYTTGITVRQIGSLFYDKGASEVSSLTLCRS 234


>gi|229141919|ref|ZP_04270445.1| ComF operon protein 3 [Bacillus cereus BDRD-ST26]
 gi|228641534|gb|EEK97839.1| ComF operon protein 3 [Bacillus cereus BDRD-ST26]
          Length = 234

 Score = 37.4 bits (85), Expect = 0.72,   Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 22/40 (55%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           G  ILL+DDVYTTG T +         GA  VS LT  RS
Sbjct: 195 GQHILLVDDVYTTGITVRQIGSLFYDKGASEVSSLTLCRS 234


>gi|206976812|ref|ZP_03237715.1| comF operon protein 3 [Bacillus cereus H3081.97]
 gi|217962673|ref|YP_002341247.1| comF operon protein 3 [Bacillus cereus AH187]
 gi|222098644|ref|YP_002532702.1| comf operon protein 3 [Bacillus cereus Q1]
 gi|206744947|gb|EDZ56351.1| comF operon protein 3 [Bacillus cereus H3081.97]
 gi|217068181|gb|ACJ82431.1| comF operon protein 3 [Bacillus cereus AH187]
 gi|221242703|gb|ACM15413.1| comF operon protein 3 [Bacillus cereus Q1]
          Length = 190

 Score = 37.4 bits (85), Expect = 0.72,   Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 22/40 (55%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           G  ILL+DDVYTTG T +         GA  VS LT  RS
Sbjct: 151 GQHILLVDDVYTTGITVRQIGSLFYDKGASEVSSLTLCRS 190


>gi|42784344|ref|NP_981591.1| comF operon protein 3 [Bacillus cereus ATCC 10987]
 gi|42740275|gb|AAS44199.1| comF operon protein 3 [Bacillus cereus ATCC 10987]
          Length = 234

 Score = 37.4 bits (85), Expect = 0.72,   Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 22/40 (55%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           G  ILL+DDVYTTG T +         GA  VS LT  RS
Sbjct: 195 GQHILLVDDVYTTGITVRQIGSLFYDKGASEVSSLTLCRS 234


>gi|255282071|ref|ZP_05346626.1| competence protein F [Bryantella formatexigens DSM 14469]
 gi|255267390|gb|EET60595.1| competence protein F [Bryantella formatexigens DSM 14469]
          Length = 301

 Score = 37.4 bits (85), Expect = 0.73,   Method: Composition-based stats.
 Identities = 18/34 (52%), Positives = 23/34 (67%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
           +ILL+DDVYTTG+T   AA  L+ AG   V  +T
Sbjct: 263 RILLVDDVYTTGSTIHEAASVLRSAGVKYVYFVT 296


>gi|296116147|ref|ZP_06834765.1| competence protein F [Gluconacetobacter hansenii ATCC 23769]
 gi|295977253|gb|EFG84013.1| competence protein F [Gluconacetobacter hansenii ATCC 23769]
          Length = 282

 Score = 37.4 bits (85), Expect = 0.74,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 30/55 (54%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +  A  V  +    + G  ++L+DDV TTG+T     +AL+  GA  V +L+ +R
Sbjct: 214 LHGAITVRSHRMAALRGRHVILVDDVMTTGSTLAACTVALRDHGAARVDVLSATR 268


>gi|294055502|ref|YP_003549160.1| phosphoribosyltransferase [Coraliomargarita akajimensis DSM 45221]
 gi|293614835|gb|ADE54990.1| phosphoribosyltransferase [Coraliomargarita akajimensis DSM 45221]
          Length = 240

 Score = 37.4 bits (85), Expect = 0.77,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           ++NAF + +  ++ +  L  +L+DDV+TTG+T    A  L++AGA  + + T 
Sbjct: 186 VKNAFAMARD-ARVIPELTYILVDDVFTTGSTLNACASVLRQAGATQIKVATL 237


>gi|323693950|ref|ZP_08108136.1| amidophosphoribosyltransferase [Clostridium symbiosum WAL-14673]
 gi|323501996|gb|EGB17872.1| amidophosphoribosyltransferase [Clostridium symbiosum WAL-14673]
          Length = 242

 Score = 37.4 bits (85), Expect = 0.77,   Method: Composition-based stats.
 Identities = 15/30 (50%), Positives = 22/30 (73%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           +++L+DD+YTTG+TA+    ALK AG   V
Sbjct: 202 RVILVDDIYTTGSTAEACTRALKAAGVKNV 231


>gi|323486258|ref|ZP_08091586.1| amidophosphoribosyltransferase [Clostridium symbiosum WAL-14163]
 gi|323400476|gb|EGA92846.1| amidophosphoribosyltransferase [Clostridium symbiosum WAL-14163]
          Length = 242

 Score = 37.4 bits (85), Expect = 0.77,   Method: Composition-based stats.
 Identities = 15/30 (50%), Positives = 22/30 (73%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           +++L+DD+YTTG+TA+    ALK AG   V
Sbjct: 202 RVILVDDIYTTGSTAEACTRALKAAGVKNV 231


>gi|307824520|ref|ZP_07654745.1| phosphoribosyltransferase [Methylobacter tundripaludum SV96]
 gi|307734504|gb|EFO05356.1| phosphoribosyltransferase [Methylobacter tundripaludum SV96]
          Length = 235

 Score = 37.4 bits (85), Expect = 0.77,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 35/57 (61%), Gaps = 6/57 (10%)

Query: 1   MRNAFNVPQYV-SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF++   + ++H+A     ++DDV TTG+T    A  LKKAGA  V +   +R+
Sbjct: 184 LKNAFSIINPIHARHIA-----ILDDVMTTGSTTHELAYLLKKAGASRVDVWVCARA 235


>gi|227510664|ref|ZP_03940713.1| late competence protein [Lactobacillus brevis subsp. gravesensis
           ATCC 27305]
 gi|227190316|gb|EEI70383.1| late competence protein [Lactobacillus brevis subsp. gravesensis
           ATCC 27305]
          Length = 229

 Score = 37.4 bits (85), Expect = 0.77,   Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 30/51 (58%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           F +  + S+ +    I+++DDVYTTG T + AA  L +AGA  V   T +R
Sbjct: 179 FELIDHESELIREKTIVVVDDVYTTGTTIRHAAGLLYRAGARCVKGFTLAR 229


>gi|149377512|ref|ZP_01895253.1| competence protein F [Marinobacter algicola DG893]
 gi|149358204|gb|EDM46685.1| competence protein F [Marinobacter algicola DG893]
          Length = 151

 Score = 37.4 bits (85), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 24/37 (64%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           I ++DDV TTGATA+    AL +AGA  V I   +R+
Sbjct: 113 IAIVDDVITTGATARSLTEALLEAGAREVQIWALART 149


>gi|290890866|ref|ZP_06553932.1| hypothetical protein AWRIB429_1322 [Oenococcus oeni AWRIB429]
 gi|290479517|gb|EFD88175.1| hypothetical protein AWRIB429_1322 [Oenococcus oeni AWRIB429]
          Length = 138

 Score = 37.4 bits (85), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 24/36 (66%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +LL+DDVYTTG T    A  L +AGA  V+ +T +R
Sbjct: 103 VLLLDDVYTTGTTLHQTAAVLYEAGAKKVNSITLAR 138


>gi|58699163|ref|ZP_00373983.1| putative amidophosphoribosyltransferase [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|58534319|gb|EAL58498.1| putative amidophosphoribosyltransferase [Wolbachia endosymbiont of
           Drosophila ananassae]
          Length = 194

 Score = 37.4 bits (85), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 27/40 (67%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++L+DDV TTGAT +  +  +  +GA  V +L+ +R++ D
Sbjct: 148 VILVDDVVTTGATVRSCSQEILNSGAKEVRVLSLARTVND 187


>gi|227873146|ref|ZP_03991437.1| possible competence protein F [Oribacterium sinus F0268]
 gi|227840977|gb|EEJ51316.1| possible competence protein F [Oribacterium sinus F0268]
          Length = 252

 Score = 37.0 bits (84), Expect = 0.81,   Method: Composition-based stats.
 Identities = 16/36 (44%), Positives = 26/36 (72%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++LL+DD++TTGAT +  +  L +AGA  V IL+ +
Sbjct: 212 RVLLVDDIFTTGATMEACSRKLLEAGAEEVHILSIA 247


>gi|213023195|ref|ZP_03337642.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhi str. 404ty]
          Length = 134

 Score = 37.0 bits (84), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 82  LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 134


>gi|206900712|ref|YP_002251126.1| hypothetical protein DICTH_1306 [Dictyoglomus thermophilum H-6-12]
 gi|206739815|gb|ACI18873.1| conserved hypothetical protein [Dictyoglomus thermophilum H-6-12]
          Length = 231

 Score = 37.0 bits (84), Expect = 0.81,   Method: Composition-based stats.
 Identities = 25/56 (44%), Positives = 32/56 (57%), Gaps = 4/56 (7%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAK-CAAIALKKAGAMTVSILTFSRSL 57
           NAF V +   K V+G  ILL+DDVYTTGAT K CA    +      + + T  R+L
Sbjct: 178 NAFGVIE--DKKVSG-NILLVDDVYTTGATLKECAKTLRENLSLNKIYVFTAVRAL 230


>gi|170017879|ref|YP_001728798.1| amidophosphoribosyltransferase [Leuconostoc citreum KM20]
 gi|169804736|gb|ACA83354.1| Predicted amidophosphoribosyltransferase [Leuconostoc citreum KM20]
          Length = 222

 Score = 37.0 bits (84), Expect = 0.81,   Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 8   PQYVSKH--VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           P  ++ H  ++G  +LLIDDVYTTG T   AA  +   GA  V  L+ +R
Sbjct: 173 PFVIANHTSLSGKSVLLIDDVYTTGRTLYYAAELIYTLGAKNVKSLSLAR 222


>gi|254512068|ref|ZP_05124135.1| competence protein F [Rhodobacteraceae bacterium KLH11]
 gi|221535779|gb|EEE38767.1| competence protein F [Rhodobacteraceae bacterium KLH11]
          Length = 192

 Score = 37.0 bits (84), Expect = 0.82,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 31/59 (52%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           + NA +V       + G  +LL+DDV T+GAT    A   + +GA  + +L  +R  KD
Sbjct: 133 LANAISVHPKRRHRMQGRDVLLVDDVMTSGATLAACARVCRASGANHIFVLALARVAKD 191


>gi|326336345|ref|ZP_08202516.1| amidophosphoribosyl-transferase [Capnocytophaga sp. oral taxon 338
           str. F0234]
 gi|325691519|gb|EGD33487.1| amidophosphoribosyl-transferase [Capnocytophaga sp. oral taxon 338
           str. F0234]
          Length = 241

 Score = 37.0 bits (84), Expect = 0.83,   Method: Composition-based stats.
 Identities = 21/46 (45%), Positives = 31/46 (67%), Gaps = 2/46 (4%)

Query: 12  SKHVAGLKILLIDDVYTTGAT-AKCAAIALKKAGAMTVSILTFSRS 56
           S  + G  IL++DD+ TTGAT A+CA++ ++KA A TVS    + S
Sbjct: 194 SSAIKGKHILMVDDIITTGATLARCASLLIEKAEA-TVSFACMAYS 238


>gi|289812183|ref|ZP_06542812.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhi str. AG3]
          Length = 146

 Score = 37.0 bits (84), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 94  LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 146


>gi|182420281|ref|ZP_02951510.1| ComF protein [Clostridium butyricum 5521]
 gi|237666884|ref|ZP_04526869.1| ComF protein [Clostridium butyricum E4 str. BoNT E BL5262]
 gi|182375876|gb|EDT73468.1| ComF protein [Clostridium butyricum 5521]
 gi|237658083|gb|EEP55638.1| ComF protein [Clostridium butyricum E4 str. BoNT E BL5262]
          Length = 221

 Score = 37.0 bits (84), Expect = 0.83,   Method: Composition-based stats.
 Identities = 18/43 (41%), Positives = 28/43 (65%)

Query: 14  HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++  LK ++IDDV T+GAT + A   LKK G   + +LT ++S
Sbjct: 177 NIKDLKFIIIDDVTTSGATIEEACRILKKYGVKHIKLLTLAKS 219


>gi|220921700|ref|YP_002497001.1| phosphoribosyltransferase [Methylobacterium nodulans ORS 2060]
 gi|219946306|gb|ACL56698.1| phosphoribosyltransferase [Methylobacterium nodulans ORS 2060]
          Length = 264

 Score = 37.0 bits (84), Expect = 0.83,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 37/59 (62%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ AF VP      + G ++LL+DDV TTGATA  AA AL + GA  V +LTF+  + D
Sbjct: 190 LQGAFRVPPAAKPRLQGRRVLLVDDVMTTGATANAAARALLRGGAAAVDVLTFACVVHD 248


>gi|291086353|ref|ZP_06355549.2| hypothetical protein CIT292_10203 [Citrobacter youngae ATCC 29220]
 gi|291067974|gb|EFE06083.1| putative competence protein ComF [Citrobacter youngae ATCC 29220]
          Length = 139

 Score = 37.0 bits (84), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 87  LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 139


>gi|254431071|ref|ZP_05044774.1| conserved hypothetical protein [Cyanobium sp. PCC 7001]
 gi|197625524|gb|EDY38083.1| conserved hypothetical protein [Cyanobium sp. PCC 7001]
          Length = 214

 Score = 37.0 bits (84), Expect = 0.88,   Method: Composition-based stats.
 Identities = 17/37 (45%), Positives = 27/37 (72%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +LL+DD+ TTGATA  AA +L++AG  T+ +   +R+
Sbjct: 172 VLLLDDILTTGATACNAAASLEEAGWRTLGMACLART 208


>gi|296330247|ref|ZP_06872728.1| putative component of the DNA transport apparatus [Bacillus
           subtilis subsp. spizizenii ATCC 6633]
 gi|296152515|gb|EFG93383.1| putative component of the DNA transport apparatus [Bacillus
           subtilis subsp. spizizenii ATCC 6633]
          Length = 159

 Score = 37.0 bits (84), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query: 16  AGLKILLIDDVYTTGATAKCAA-IALKKAGAMTVSILTFSRS 56
            G+ I+LIDD+YTTGAT   AA   L+K  A +V+  T  RS
Sbjct: 118 EGMNIILIDDLYTTGATLHFAARCLLEKGRAASVASFTLIRS 159


>gi|254418197|ref|ZP_05031921.1| Phosphoribosyl transferase domain protein [Brevundimonas sp. BAL3]
 gi|196184374|gb|EDX79350.1| Phosphoribosyl transferase domain protein [Brevundimonas sp. BAL3]
          Length = 264

 Score = 37.0 bits (84), Expect = 0.88,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 33/55 (60%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++ AF V +   + + G +ILLIDDV TTGAT +  A AL  AGA  V +   +R
Sbjct: 201 VKKAFIVSEIGRRRIKGRRILLIDDVLTTGATGEACARALIDAGARAVDLAVIAR 255


>gi|315128006|ref|YP_004070009.1| hypothetical protein PSM_A2945 [Pseudoalteromonas sp. SM9913]
 gi|315016520|gb|ADT69858.1| conserved hypothetical protein [Pseudoalteromonas sp. SM9913]
          Length = 225

 Score = 37.0 bits (84), Expect = 0.89,   Method: Composition-based stats.
 Identities = 17/41 (41%), Positives = 27/41 (65%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
           + ++ G  +++IDD+ TTGAT   A ++LK+AGA  V   T
Sbjct: 179 TANLEGKTVVIIDDIMTTGATLNAATLSLKEAGAKQVWAFT 219


>gi|121535562|ref|ZP_01667370.1| competence protein F, putative [Thermosinus carboxydivorans Nor1]
 gi|121305890|gb|EAX46824.1| competence protein F, putative [Thermosinus carboxydivorans Nor1]
          Length = 219

 Score = 37.0 bits (84), Expect = 0.89,   Method: Composition-based stats.
 Identities = 19/40 (47%), Positives = 26/40 (65%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           VAG  +LL+DD++TTG T +  A  LK AGA  V+ L  +
Sbjct: 176 VAGKTLLLVDDIFTTGVTMEECARVLKAAGAKRVAGLAVA 215


>gi|293402455|ref|ZP_06646591.1| putative competence protein [Erysipelotrichaceae bacterium
           5_2_54FAA]
 gi|291304118|gb|EFE45371.1| putative competence protein [Erysipelotrichaceae bacterium
           5_2_54FAA]
          Length = 410

 Score = 37.0 bits (84), Expect = 0.90,   Method: Composition-based stats.
 Identities = 19/39 (48%), Positives = 27/39 (69%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVS 49
           V++++AG  ILL+DDVY++G+T    A  L  AGA  VS
Sbjct: 288 VTENIAGKSILLMDDVYSSGSTFLEVAKTLYAAGAKNVS 326


>gi|222150750|ref|YP_002559903.1| hypothetical protein MCCL_0500 [Macrococcus caseolyticus JCSC5402]
 gi|222119872|dbj|BAH17207.1| conserved hypothetical protein [Macrococcus caseolyticus JCSC5402]
          Length = 226

 Score = 37.0 bits (84), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           N F + Q +     G +ILLIDD+YTTG T   AA  L       V +L F+R+
Sbjct: 176 NVFYMKQPLK---TGARILLIDDIYTTGLTVHQAASVLLSNKDCRVEVLAFARA 226


>gi|224534491|ref|ZP_03675067.1| adenine phosphoribosyltransferase [Borrelia spielmanii A14S]
 gi|224514168|gb|EEF84486.1| adenine phosphoribosyltransferase [Borrelia spielmanii A14S]
          Length = 176

 Score = 37.0 bits (84), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 21/34 (61%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           ILLIDD+  TG T K +AI L+KAG     I  F
Sbjct: 119 ILLIDDILATGGTLKSSAILLEKAGGKVKDIFCF 152


>gi|125624818|ref|YP_001033301.1| ribose-phosphate pyrophosphokinase [Lactococcus lactis subsp.
           cremoris MG1363]
 gi|124493626|emb|CAL98613.1| ribose-phosphate pyrophosphokinase [Lactococcus lactis subsp.
           cremoris MG1363]
 gi|300071617|gb|ADJ61017.1| ribose-phosphate pyrophosphokinase [Lactococcus lactis subsp.
           cremoris NZ9000]
          Length = 321

 Score = 37.0 bits (84), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 26/39 (66%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           YV  +VAG K++LIDD+  TG T   AA  +++AGA  +
Sbjct: 209 YVIGNVAGKKVILIDDILNTGVTFANAANVVREAGASEI 247


>gi|113866369|ref|YP_724858.1| amidophosphoribosyltransferase [Ralstonia eutropha H16]
 gi|113525145|emb|CAJ91490.1| predicted amidophosphoribosyltransferase [Ralstonia eutropha H16]
          Length = 285

 Score = 37.0 bits (84), Expect = 0.91,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF + +  +  + G+ + L+DDV T+GAT   AA  LK  GA  VS++   R+
Sbjct: 231 LRGAFRLAR--AARLDGMHVALVDDVMTSGATLHEAAGVLKAHGAARVSVIVALRT 284


>gi|83942062|ref|ZP_00954524.1| Competence protein F [Sulfitobacter sp. EE-36]
 gi|83847882|gb|EAP85757.1| Competence protein F [Sulfitobacter sp. EE-36]
          Length = 242

 Score = 37.0 bits (84), Expect = 0.91,   Method: Composition-based stats.
 Identities = 18/43 (41%), Positives = 28/43 (65%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           G  +LL+DDV T+GAT + +A A  +A A  + ++T +R  KD
Sbjct: 199 GRPVLLVDDVMTSGATLQASARACLEARAGPICVVTLARVAKD 241


>gi|295688314|ref|YP_003592007.1| phosphoribosyltransferase [Caulobacter segnis ATCC 21756]
 gi|295430217|gb|ADG09389.1| phosphoribosyltransferase [Caulobacter segnis ATCC 21756]
          Length = 256

 Score = 37.0 bits (84), Expect = 0.92,   Method: Composition-based stats.
 Identities = 27/52 (51%), Positives = 34/52 (65%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           AF VP    K V G +I+L+DDV TTGATA+  A AL  AGA +VS+   +R
Sbjct: 196 AFAVPPSKRKLVEGRRIVLVDDVLTTGATAEGCARALLAAGAASVSLSVVAR 247


>gi|237747426|ref|ZP_04577906.1| gntX protein [Oxalobacter formigenes HOxBLS]
 gi|229378777|gb|EEO28868.1| gntX protein [Oxalobacter formigenes HOxBLS]
          Length = 199

 Score = 37.0 bits (84), Expect = 0.92,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 33/57 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           + NAF++ +     +    I ++DDV TTG T +  A  LKK+GA  V+   F+R+L
Sbjct: 136 VHNAFDLAETGRFSIKEKHIGIVDDVMTTGHTLEEIARLLKKSGAKRVTNFVFARTL 192


>gi|213865553|ref|ZP_03387672.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
          enterica serovar Typhi str. M223]
          Length = 72

 Score = 37.0 bits (84), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1  MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
          ++NAF +   V     GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 20 LKNAFRLELPVQ----GLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 72


>gi|330012477|ref|ZP_08307391.1| comF family protein [Klebsiella sp. MS 92-3]
 gi|328533828|gb|EGF60507.1| comF family protein [Klebsiella sp. MS 92-3]
          Length = 212

 Score = 37.0 bits (84), Expect = 0.93,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL I L+DDV TTG+T    +  L + GA TV +    R+L
Sbjct: 160 LKNAFQL----EFAVQGLHIALVDDVVTTGSTVAEISRLLLRNGAATVQVWCLCRTL 212


>gi|262045249|ref|ZP_06018275.1| GNTI system gluconate periplasmic binding protein with
           phosphoribosyltransferase domain [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
 gi|259037459|gb|EEW38704.1| GNTI system gluconate periplasmic binding protein with
           phosphoribosyltransferase domain [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
          Length = 212

 Score = 37.0 bits (84), Expect = 0.93,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL I L+DDV TTG+T    +  L + GA TV +    R+L
Sbjct: 160 LKNAFQL----EFAVQGLHIALVDDVVTTGSTVAEISRLLLRNGAATVQVWCLCRTL 212


>gi|238896880|ref|YP_002921625.1| putative periplasmic gluconate-binding protein in GNT I transport
           system [Klebsiella pneumoniae NTUH-K2044]
 gi|238549207|dbj|BAH65558.1| putative periplasmic gluconate-binding protein in GNT I transport
           system [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
          Length = 224

 Score = 37.0 bits (84), Expect = 0.93,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL I L+DDV TTG+T    +  L + GA TV +    R+L
Sbjct: 172 LKNAFQL----EFAVQGLHIALVDDVVTTGSTVAEISRLLLRNGAATVQVWCLCRTL 224


>gi|152972291|ref|YP_001337437.1| putative periplasmic gluconate-binding protein in GNT I transport
           system [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|150957140|gb|ABR79170.1| putative periplasmic gluconate-binding protein in GNT I transport
           system [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
          Length = 212

 Score = 37.0 bits (84), Expect = 0.93,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL I L+DDV TTG+T    +  L + GA TV +    R+L
Sbjct: 160 LKNAFQL----EFAVQGLHIALVDDVVTTGSTVAEISRLLLRNGAATVQVWCLCRTL 212


>gi|146329020|ref|YP_001209376.1| hypothetical protein DNO_0464 [Dichelobacter nodosus VCS1703A]
 gi|146232490|gb|ABQ13468.1| conserved hypothetical protein [Dichelobacter nodosus VCS1703A]
          Length = 233

 Score = 37.0 bits (84), Expect = 0.93,   Method: Composition-based stats.
 Identities = 21/45 (46%), Positives = 28/45 (62%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +V+K     +ILL+DDV T+GAT   AA  LK+AGA  V    F+
Sbjct: 181 FVAKQNISGRILLVDDVMTSGATLSEAARCLKQAGADWVGASVFA 225


>gi|312892346|ref|ZP_07751841.1| phosphoribosyltransferase [Mucilaginibacter paludis DSM 18603]
 gi|311295130|gb|EFQ72304.1| phosphoribosyltransferase [Mucilaginibacter paludis DSM 18603]
          Length = 231

 Score = 37.0 bits (84), Expect = 0.95,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
           M+  F+V +   + +AG  +LL+DD+ TTG+T +   I L K   +T+SI
Sbjct: 177 MKEVFSVKK--PEKLAGKHVLLVDDIVTTGSTLEACGIELLKIPGLTLSI 224


>gi|149912918|ref|ZP_01901452.1| competence protein F, putative [Roseobacter sp. AzwK-3b]
 gi|149813324|gb|EDM73150.1| competence protein F, putative [Roseobacter sp. AzwK-3b]
          Length = 190

 Score = 37.0 bits (84), Expect = 0.95,   Method: Composition-based stats.
 Identities = 19/48 (39%), Positives = 25/48 (52%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           + H+ G  ILL+DDV T+GAT           GA  V +L  +R  KD
Sbjct: 142 AHHLKGRTILLVDDVMTSGATLSALTQICLAGGATDVRVLVLARVSKD 189


>gi|75907199|ref|YP_321495.1| hypothetical protein Ava_0976 [Anabaena variabilis ATCC 29413]
 gi|75700924|gb|ABA20600.1| conserved hypothetical protein [Anabaena variabilis ATCC 29413]
          Length = 229

 Score = 37.0 bits (84), Expect = 0.95,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 30/59 (50%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF + Q          +LLIDD+YTTGAT K A   L++     + +   + ++KD
Sbjct: 166 LAEAFAIGQDFRHSCPKTPVLLIDDIYTTGATVKSAVQILRQNEITVLGLAATASTVKD 224


>gi|56694999|ref|YP_165345.1| competence protein F, putative [Ruegeria pomeroyi DSS-3]
 gi|56676736|gb|AAV93402.1| competence protein F, putative [Ruegeria pomeroyi DSS-3]
          Length = 242

 Score = 37.0 bits (84), Expect = 0.96,   Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 26/41 (63%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           K+LLIDDV T+GAT   +A A   AGA  V +L  +R  ++
Sbjct: 201 KLLLIDDVMTSGATLAASAQACLNAGADQVFVLVLARVTRE 241


>gi|296160422|ref|ZP_06843239.1| phosphoribosyltransferase [Burkholderia sp. Ch1-1]
 gi|295889403|gb|EFG69204.1| phosphoribosyltransferase [Burkholderia sp. Ch1-1]
          Length = 261

 Score = 37.0 bits (84), Expect = 0.98,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 32/56 (57%), Gaps = 4/56 (7%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           AFNV    +  V GL + ++DDV TTGAT +  A  LK AGA  V+     R+ K+
Sbjct: 210 AFNV----AGSVQGLHVGIVDDVMTTGATLEALARTLKAAGARRVTNFVALRTPKN 261


>gi|88801440|ref|ZP_01116968.1| putative amidophosphoribosyl-transferase [Polaribacter irgensii
           23-P]
 gi|88782098|gb|EAR13275.1| putative amidophosphoribosyl-transferase [Polaribacter irgensii
           23-P]
          Length = 245

 Score = 37.0 bits (84), Expect = 0.98,   Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 5/50 (10%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
            N   +  KHV     L+IDDV TTGAT +  A+ L K   + +SILT +
Sbjct: 198 LNFTIFKDKHV-----LIIDDVVTTGATLEACALELLKTSGIRISILTMA 242


>gi|18266392|gb|AAL67548.1|AF459920_4 late competence protein ComFC [Bacillus licheniformis]
          Length = 229

 Score = 37.0 bits (84), Expect = 0.99,   Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAG-AMTVSILTFSRS 56
           V  L ++LIDD+YTTGAT   AA  L  +G A +VS  T  RS
Sbjct: 187 VKNLDVILIDDLYTTGATLHHAADCLMTSGEAKSVSSYTLIRS 229


>gi|52082080|ref|YP_080871.1| competence protein [Bacillus licheniformis ATCC 14580]
 gi|52787469|ref|YP_093298.1| hypothetical protein BLi03789 [Bacillus licheniformis ATCC 14580]
 gi|52005291|gb|AAU25233.1| competence protein [Bacillus licheniformis ATCC 14580]
 gi|52349971|gb|AAU42605.1| ComFC [Bacillus licheniformis ATCC 14580]
          Length = 244

 Score = 37.0 bits (84), Expect = 0.99,   Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAG-AMTVSILTFSRS 56
           V  L ++LIDD+YTTGAT   AA  L  +G A +VS  T  RS
Sbjct: 202 VKNLDVILIDDLYTTGATLHHAADCLMTSGEAKSVSSYTLIRS 244


>gi|326625251|gb|EGE31596.1| protein GntX [Salmonella enterica subsp. enterica serovar Dublin
           str. 3246]
          Length = 215

 Score = 37.0 bits (84), Expect = 0.99,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|237728732|ref|ZP_04559213.1| gluconate periplasmic binding protein [Citrobacter sp. 30_2]
 gi|226909354|gb|EEH95272.1| gluconate periplasmic binding protein [Citrobacter sp. 30_2]
          Length = 227

 Score = 37.0 bits (84), Expect = 0.99,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|224585305|ref|YP_002639104.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|224469833|gb|ACN47663.1| putative competence protein [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
          Length = 215

 Score = 37.0 bits (84), Expect = 0.99,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|254494988|ref|ZP_01053158.2| predicted amidophosphoribosyl-transferase [Polaribacter sp. MED152]
 gi|213690570|gb|EAQ42586.2| predicted amidophosphoribosyl-transferase [Polaribacter sp. MED152]
          Length = 228

 Score = 37.0 bits (84), Expect = 0.99,   Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 23/35 (65%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ILLIDDV TTGAT +  A   + A   T+SILT +
Sbjct: 191 ILLIDDVITTGATLEACANEFQNAENATISILTMA 225


>gi|213581450|ref|ZP_03363276.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
          Length = 201

 Score = 37.0 bits (84), Expect = 0.99,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 149 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 201


>gi|170766640|ref|ZP_02901093.1| protein GntX [Escherichia albertii TW07627]
 gi|170124078|gb|EDS93009.1| protein GntX [Escherichia albertii TW07627]
          Length = 227

 Score = 37.0 bits (84), Expect = 0.99,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|168465219|ref|ZP_02699111.1| protein GntX [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|195632168|gb|EDX50652.1| protein GntX [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
          Length = 227

 Score = 37.0 bits (84), Expect = 0.99,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|194445852|ref|YP_002042762.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194404515|gb|ACF64737.1| protein GntX [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
          Length = 227

 Score = 37.0 bits (84), Expect = 0.99,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|168260763|ref|ZP_02682736.1| protein GntX [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|168818675|ref|ZP_02830675.1| protein GntX [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|197251427|ref|YP_002148434.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|204928749|ref|ZP_03219948.1| protein GntX [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|238910485|ref|ZP_04654322.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|197215130|gb|ACH52527.1| protein GntX [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
 gi|204322182|gb|EDZ07380.1| protein GntX [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|205344315|gb|EDZ31079.1| protein GntX [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|205350305|gb|EDZ36936.1| protein GntX [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|320087926|emb|CBY97688.1| Protein gntX [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
 gi|322614116|gb|EFY11052.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322618008|gb|EFY14901.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625378|gb|EFY22204.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322629843|gb|EFY26616.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322632268|gb|EFY29019.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322636381|gb|EFY33088.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322643237|gb|EFY39806.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322644761|gb|EFY41297.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322651214|gb|EFY47598.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322654918|gb|EFY51233.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322659175|gb|EFY55427.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322663124|gb|EFY59328.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322668610|gb|EFY64763.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674586|gb|EFY70679.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322678208|gb|EFY74269.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322682535|gb|EFY78556.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322684248|gb|EFY80254.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323192197|gb|EFZ77429.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323196377|gb|EFZ81529.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323201822|gb|EFZ86885.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323206364|gb|EFZ91325.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323211957|gb|EFZ96784.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323216863|gb|EGA01586.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323222262|gb|EGA06645.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323224277|gb|EGA08566.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323228205|gb|EGA12336.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323233528|gb|EGA17621.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323237010|gb|EGA21077.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323243775|gb|EGA27791.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323245983|gb|EGA29970.1| DNA utilization protein GntX [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323250759|gb|EGA34637.1| DNA utilization protein GntX [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323255770|gb|EGA39520.1| DNA utilization protein GntX [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323261372|gb|EGA44958.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323267655|gb|EGA51137.1| DNA utilization protein GntX [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323268535|gb|EGA52002.1| DNA utilization protein GntX [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 227

 Score = 37.0 bits (84), Expect = 0.99,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|168235105|ref|ZP_02660163.1| protein GntX [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|194736680|ref|YP_002116453.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|194712182|gb|ACF91403.1| protein GntX [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197291553|gb|EDY30905.1| protein GntX [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
          Length = 227

 Score = 37.0 bits (84), Expect = 0.99,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|168232649|ref|ZP_02657707.1| protein GntX [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|194469779|ref|ZP_03075763.1| protein GntX [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194456143|gb|EDX44982.1| protein GntX [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|205333040|gb|EDZ19804.1| protein GntX [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
          Length = 227

 Score = 37.0 bits (84), Expect = 0.99,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|198244770|ref|YP_002217470.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|197939286|gb|ACH76619.1| protein GntX [Salmonella enterica subsp. enterica serovar Dublin
           str. CT_02021853]
          Length = 227

 Score = 37.0 bits (84), Expect = 0.99,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|197265899|ref|ZP_03165973.1| protein GntX [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197244154|gb|EDY26774.1| protein GntX [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
          Length = 227

 Score = 37.0 bits (84), Expect = 0.99,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|157148995|ref|YP_001456315.1| gluconate periplasmic binding protein [Citrobacter koseri ATCC
           BAA-895]
 gi|157086200|gb|ABV15878.1| hypothetical protein CKO_04833 [Citrobacter koseri ATCC BAA-895]
          Length = 243

 Score = 37.0 bits (84), Expect = 0.99,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 191 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 243


>gi|62182012|ref|YP_218429.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161616553|ref|YP_001590518.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|205354866|ref|YP_002228667.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|207858750|ref|YP_002245401.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|62129645|gb|AAX67348.1| putative amidophosphoribosyltransferase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161365917|gb|ABX69685.1| hypothetical protein SPAB_04369 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|205274647|emb|CAR39701.1| putative competence protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|206710553|emb|CAR34911.1| putative competence protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|322716500|gb|EFZ08071.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|326630012|gb|EGE36355.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 227

 Score = 37.0 bits (84), Expect = 0.99,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|16766798|ref|NP_462413.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|167549283|ref|ZP_02343042.1| protein GntX [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|167990715|ref|ZP_02571814.1| protein GntX [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|168241652|ref|ZP_02666584.1| protein GntX [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|194449324|ref|YP_002047535.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|200388063|ref|ZP_03214675.1| protein GntX [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|51701442|sp|Q8ZLI8|GNTX_SALTY RecName: Full=Protein GntX
 gi|16422069|gb|AAL22372.1| putative amidophosphoribosyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|194407628|gb|ACF67847.1| protein GntX [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|199605161|gb|EDZ03706.1| protein GntX [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|205325670|gb|EDZ13509.1| protein GntX [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|205330741|gb|EDZ17505.1| protein GntX [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205339021|gb|EDZ25785.1| protein GntX [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|261248665|emb|CBG26503.1| putative competence protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267995732|gb|ACY90617.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301160053|emb|CBW19572.1| putative competence protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312914534|dbj|BAJ38508.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321226561|gb|EFX51611.1| protein GntX [Salmonella enterica subsp. enterica serovar
           Typhimurium str. TN061786]
 gi|323131870|gb|ADX19300.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|332990362|gb|AEF09345.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 227

 Score = 37.0 bits (84), Expect = 0.99,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|16762777|ref|NP_458394.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29144264|ref|NP_807606.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56415425|ref|YP_152500.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197364355|ref|YP_002143992.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|213161412|ref|ZP_03347122.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213420970|ref|ZP_03354036.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E01-6750]
 gi|213426879|ref|ZP_03359629.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213647817|ref|ZP_03377870.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|289824842|ref|ZP_06544285.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|51701439|sp|Q8Z222|GNTX_SALTI RecName: Full=Protein GntX
 gi|25321978|pir||AD0997 probable competence protein STY4286 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16505083|emb|CAD08104.1| putative competence protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29139901|gb|AAO71466.1| putative competence protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56129682|gb|AAV79188.1| putative competence protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197095832|emb|CAR61405.1| putative competence protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 227

 Score = 37.0 bits (84), Expect = 0.99,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|304310059|ref|YP_003809657.1| competence protein ComF [gamma proteobacterium HdN1]
 gi|301795792|emb|CBL43991.1| competence protein ComF [gamma proteobacterium HdN1]
          Length = 256

 Score = 37.0 bits (84), Expect = 1.0,   Method: Composition-based stats.
 Identities = 18/43 (41%), Positives = 28/43 (65%)

Query: 14  HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
            ++   ++LIDDV TTGAT+   A  L KAGA +VS+   +++
Sbjct: 211 QISSANVILIDDVVTTGATSAELAHCLLKAGANSVSLWALAKT 253


>gi|216263698|ref|ZP_03435693.1| adenine phosphoribosyltransferase [Borrelia afzelii ACA-1]
 gi|215980542|gb|EEC21363.1| adenine phosphoribosyltransferase [Borrelia afzelii ACA-1]
          Length = 176

 Score = 37.0 bits (84), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 22/34 (64%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           ILLIDD+  TG T K +AI L++AG    +I  F
Sbjct: 119 ILLIDDILATGGTLKSSAILLERAGGRVKNIFCF 152


>gi|296168964|ref|ZP_06850632.1| conserved hypothetical protein [Mycobacterium parascrofulaceum
          ATCC BAA-614]
 gi|295896363|gb|EFG76017.1| conserved hypothetical protein [Mycobacterium parascrofulaceum
          ATCC BAA-614]
          Length = 91

 Score = 37.0 bits (84), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 26/38 (68%)

Query: 17 GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
          G ++L++DD+ TTGATA+ +   L+ AG    ++LT +
Sbjct: 52 GTEVLVVDDIVTTGATARESVRVLRAAGVRVTAVLTLA 89


>gi|111115609|ref|YP_710227.1| adenine phosphoribosyltransferase [Borrelia afzelii PKo]
 gi|123046906|sp|Q0SM77|APT_BORAP RecName: Full=Adenine phosphoribosyltransferase; Short=APRT
 gi|110890883|gb|ABH02051.1| adenine phosphoribosyltransferase [Borrelia afzelii PKo]
          Length = 176

 Score = 37.0 bits (84), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 22/34 (64%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           ILLIDD+  TG T K +AI L++AG    +I  F
Sbjct: 119 ILLIDDILATGGTLKSSAILLERAGGRVKNIFCF 152


>gi|300867763|ref|ZP_07112407.1| conserved hypothetical protein [Oscillatoria sp. PCC 6506]
 gi|300334230|emb|CBN57579.1| conserved hypothetical protein [Oscillatoria sp. PCC 6506]
          Length = 227

 Score = 36.6 bits (83), Expect = 1.0,   Method: Composition-based stats.
 Identities = 15/40 (37%), Positives = 25/40 (62%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +LL+DD+YT+G T K A  ALK+ G     ++  + + K+
Sbjct: 188 VLLVDDIYTSGTTVKSATEALKREGIKVYGVVAIATTRKN 227


>gi|323524636|ref|YP_004226789.1| phosphoribosyltransferase [Burkholderia sp. CCGE1001]
 gi|323381638|gb|ADX53729.1| phosphoribosyltransferase [Burkholderia sp. CCGE1001]
          Length = 261

 Score = 36.6 bits (83), Expect = 1.0,   Method: Composition-based stats.
 Identities = 21/49 (42%), Positives = 29/49 (59%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           V++ V G  I ++DDV TTGAT +  A  LK AGA  V+     R+ K+
Sbjct: 213 VARRVEGQHIGIVDDVMTTGATLEALARTLKAAGARRVTNFVALRTPKN 261


>gi|322386966|ref|ZP_08060590.1| comFC family protein [Streptococcus cristatus ATCC 51100]
 gi|321269248|gb|EFX52184.1| comFC family protein [Streptococcus cristatus ATCC 51100]
          Length = 221

 Score = 36.6 bits (83), Expect = 1.0,   Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 24/36 (66%), Gaps = 2/36 (5%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           KILLIDDVYTTG T + A   L +AG   V  LTFS
Sbjct: 185 KILLIDDVYTTGKTLQLARELLLEAGVKEV--LTFS 218


>gi|295094194|emb|CBK83285.1| Predicted amidophosphoribosyltransferases [Coprococcus sp. ART55/1]
          Length = 243

 Score = 36.6 bits (83), Expect = 1.0,   Method: Composition-based stats.
 Identities = 18/29 (62%), Positives = 20/29 (68%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           ILL+DD+YTTG T    A  LKKAGA  V
Sbjct: 204 ILLVDDIYTTGVTIDVCAGLLKKAGARHV 232


>gi|24378983|ref|NP_720938.1| putative late competence protein [Streptococcus mutans UA159]
 gi|24376873|gb|AAN58244.1|AE014895_9 putative late competence protein [Streptococcus mutans UA159]
          Length = 221

 Score = 36.6 bits (83), Expect = 1.0,   Method: Composition-based stats.
 Identities = 14/37 (37%), Positives = 25/37 (67%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           K++L+DD+YTTG T + A+  L++ G  T+   + +R
Sbjct: 185 KVMLVDDIYTTGMTIQLASQLLRENGVKTIKSFSLAR 221


>gi|66047912|ref|YP_237753.1| phosphoribosyltransferase [Pseudomonas syringae pv. syringae B728a]
 gi|63258619|gb|AAY39715.1| Phosphoribosyltransferase [Pseudomonas syringae pv. syringae B728a]
 gi|330970893|gb|EGH70959.1| phosphoribosyltransferase [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 244

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 6/58 (10%)

Query: 1   MRNAFNV--PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF +  P +V     G  + L+DDV TTG+TA+  A  L  AGA  V +   +R+
Sbjct: 186 LRGAFTLIDPDWVK----GRHLALVDDVLTTGSTAEVIAGLLNTAGARRVDVYCLART 239


>gi|125624290|ref|YP_001032773.1| putative late competence protein [Lactococcus lactis subsp.
           cremoris MG1363]
 gi|124493098|emb|CAL98062.1| putative late competence protein [Lactococcus lactis subsp.
           cremoris MG1363]
 gi|300071072|gb|ADJ60472.1| putative late competence protein [Lactococcus lactis subsp.
           cremoris NZ9000]
          Length = 216

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 17/37 (45%), Positives = 23/37 (62%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           KI+LIDD+YTTG T   A   LKKA  + ++  +  R
Sbjct: 180 KIILIDDIYTTGTTFYHAIKTLKKANPIEITTFSLCR 216


>gi|116511929|ref|YP_809145.1| amidophosphoribosyltransferase [Lactococcus lactis subsp. cremoris
           SK11]
 gi|116107583|gb|ABJ72723.1| Predicted amidophosphoribosyltransferase [Lactococcus lactis subsp.
           cremoris SK11]
          Length = 216

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 17/37 (45%), Positives = 23/37 (62%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           KI+LIDD+YTTG T   A   LKKA  + ++  +  R
Sbjct: 180 KIILIDDIYTTGTTFYHAIKTLKKANPIEITTFSLCR 216


>gi|91781672|ref|YP_556878.1| putative competence protein f-related protein [Burkholderia
           xenovorans LB400]
 gi|91685626|gb|ABE28826.1| Putative competence protein f-related protein [Burkholderia
           xenovorans LB400]
          Length = 261

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 21/49 (42%), Positives = 29/49 (59%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           V+  V GL + ++DDV TTGAT +  A  LK AGA  V+     R+ K+
Sbjct: 213 VAGSVQGLHVGIVDDVMTTGATLEALARTLKAAGARQVTNFVALRTPKN 261


>gi|288921130|ref|ZP_06415419.1| helicase domain protein [Frankia sp. EUN1f]
 gi|288347506|gb|EFC81794.1| helicase domain protein [Frankia sp. EUN1f]
          Length = 742

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 3   NAFNVPQYVSKHVAGLK--ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +AF+VP  +++ + GL   +LL+DD+  TG T   AA  L+ AGA  V  L  +
Sbjct: 685 SAFDVPPPLAETLGGLAGPVLLVDDLVVTGWTMTAAARVLRAAGAPAVMPLALA 738


>gi|213612532|ref|ZP_03370358.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
          enterica serovar Typhi str. E98-2068]
          Length = 60

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1  MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
          ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 8  LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 60


>gi|188591075|ref|YP_001795675.1| amidophosphoribosyltransferase, comf/gntx family [Cupriavidus
           taiwanensis LMG 19424]
 gi|170937969|emb|CAP62953.1| putative amidophosphoribosyltransferase, comF/gntX family
           [Cupriavidus taiwanensis LMG 19424]
          Length = 285

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 19/40 (47%), Positives = 25/40 (62%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           GL + L+DDV T+GAT   AA  LK  GA  VS++   R+
Sbjct: 245 GLHVALVDDVMTSGATLHEAAAVLKARGASRVSVIVALRT 284


>gi|25027328|ref|NP_737382.1| hypothetical protein CE0772 [Corynebacterium efficiens YS-314]
 gi|259506534|ref|ZP_05749436.1| purine/pyrimidine phosphoribosyl transferase [Corynebacterium
           efficiens YS-314]
 gi|23492609|dbj|BAC17582.1| conserved hypothetical protein [Corynebacterium efficiens YS-314]
 gi|259165954|gb|EEW50508.1| purine/pyrimidine phosphoribosyl transferase [Corynebacterium
           efficiens YS-314]
          Length = 196

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 24/34 (70%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           +LLIDDV TTGAT + +A +L+ AG +    LT+
Sbjct: 160 VLLIDDVVTTGATLQASANSLRTAGVLVRGALTY 193


>gi|326498087|dbj|BAJ94906.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 195

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 26/39 (66%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           VAG  +++++D+  TG T  C    L+K GA+++S+ TF
Sbjct: 96  VAGKHVVVVEDIVDTGNTVSCLIAHLQKKGALSISVCTF 134


>gi|163840384|ref|YP_001624789.1| amidophosphoribosyltransferase [Renibacterium salmoninarum ATCC
           33209]
 gi|162953860|gb|ABY23375.1| Predicted amidophosphoribosyltransferase [Renibacterium
           salmoninarum ATCC 33209]
          Length = 281

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 21/32 (65%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGAT 32
           +R +  VP+    HV GL  LL+DDV TTGAT
Sbjct: 216 LRGSLMVPKRKLNHVQGLNCLLVDDVLTTGAT 247


>gi|182413075|ref|YP_001818141.1| ribose-phosphate pyrophosphokinase [Opitutus terrae PB90-1]
 gi|177840289|gb|ACB74541.1| ribose-phosphate pyrophosphokinase [Opitutus terrae PB90-1]
          Length = 316

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 24/36 (66%)

Query: 14  HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVS 49
            VAG  +L++DD+  T  T   AA  LKK+GAMT++
Sbjct: 211 EVAGCDVLIVDDMTETAGTITAAADKLKKSGAMTIT 246


>gi|325981843|ref|YP_004294245.1| phosphoribosyltransferase [Nitrosomonas sp. AL212]
 gi|325531362|gb|ADZ26083.1| phosphoribosyltransferase [Nitrosomonas sp. AL212]
          Length = 228

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 6/60 (10%)

Query: 1   MRNAFNVPQYVS-KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R+AF+    +S KHVA     L+DDV TTGAT    A  L+K G + +S    +R+L +
Sbjct: 165 IRSAFDCTIDLSGKHVA-----LVDDVMTTGATLNEVAKTLRKRGVIEISNWIIARALSE 219


>gi|310287283|ref|YP_003938541.1| the phosphoribosyl transferase domain [Bifidobacterium bifidum S17]
 gi|309251219|gb|ADO52967.1| conserved hypothetical protein with the phosphoribosyl transferase
           domain [Bifidobacterium bifidum S17]
          Length = 238

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 26/39 (66%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++L+DD+ TTG TA+  A AL  AG    +++  +R+L+
Sbjct: 193 VILVDDIVTTGTTARQCAQALNAAGIHVTTVICLARTLR 231


>gi|330718320|ref|ZP_08312920.1| amidophosphoribosyltransferase [Leuconostoc fallax KCTC 3537]
          Length = 226

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 25/42 (59%)

Query: 14  HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++ G  ILLIDD+YTTG T   AA  L   GA  V  ++ +R
Sbjct: 185 NLQGKSILLIDDIYTTGNTMYYAADLLYSVGAQAVRSVSLAR 226


>gi|227545124|ref|ZP_03975173.1| competence protein FC [Lactobacillus reuteri CF48-3A]
 gi|300909205|ref|ZP_07126666.1| competence protein FC [Lactobacillus reuteri SD2112]
 gi|227184912|gb|EEI64983.1| competence protein FC [Lactobacillus reuteri CF48-3A]
 gi|300893070|gb|EFK86429.1| competence protein FC [Lactobacillus reuteri SD2112]
          Length = 226

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 17/37 (45%), Positives = 24/37 (64%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           K+LL+DDVYTTG T   AA   K+AG   +  ++ +R
Sbjct: 190 KVLLVDDVYTTGRTLYHAANLFKQAGCKEIGSVSLAR 226


>gi|33866523|ref|NP_898082.1| hypothetical protein SYNW1991 [Synechococcus sp. WH 8102]
 gi|33633301|emb|CAE08506.1| conserved hypothetical protein [Synechococcus sp. WH 8102]
          Length = 211

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 25/46 (54%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           VS H+  ++I L+DD  TTG TA  A  AL  AG     ++   R+
Sbjct: 159 VSAHLQAMEIWLVDDFLTTGGTALAARQALLDAGHQVCGLICLGRT 204


>gi|298242607|ref|ZP_06966414.1| amidophosphoribosyltransferase [Ktedonobacter racemifer DSM 44963]
 gi|297555661|gb|EFH89525.1| amidophosphoribosyltransferase [Ktedonobacter racemifer DSM 44963]
          Length = 194

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 26/42 (61%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           VA  KIL+IDDV TTGAT    A  L  AGA +V+ L  + +
Sbjct: 149 VANRKILIIDDVCTTGATLDACARPLFAAGARSVTGLVLASA 190


>gi|91215383|ref|ZP_01252354.1| putative amidophosphoribosyl-transferase [Psychroflexus torquis
           ATCC 700755]
 gi|91186335|gb|EAS72707.1| putative amidophosphoribosyl-transferase [Psychroflexus torquis
           ATCC 700755]
          Length = 226

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 28/42 (66%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           + V+G  ILL+DD+ TTGAT +   +AL +A  + ++I T +
Sbjct: 182 QEVSGQHILLVDDLVTTGATLEACYLALNEAEGIKLNIATMA 223


>gi|332364562|gb|EGJ42331.1| ComFC family protein [Streptococcus sanguinis SK1059]
          Length = 221

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 20/36 (55%), Positives = 24/36 (66%), Gaps = 2/36 (5%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           KILL+DD+YTTG T + A   L +AG     ILTFS
Sbjct: 185 KILLVDDIYTTGKTLQLAKQILLEAGVK--EILTFS 218


>gi|332362998|gb|EGJ40787.1| competence protein ComFC [Streptococcus sanguinis SK49]
          Length = 221

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 20/36 (55%), Positives = 24/36 (66%), Gaps = 2/36 (5%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           KILL+DD+YTTG T + A   L +AG     ILTFS
Sbjct: 185 KILLVDDIYTTGKTLQLAKQILLEAGVK--EILTFS 218


>gi|332358070|gb|EGJ35903.1| competence protein FC [Streptococcus sanguinis SK1056]
          Length = 221

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 20/36 (55%), Positives = 24/36 (66%), Gaps = 2/36 (5%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           KILL+DD+YTTG T + A   L +AG     ILTFS
Sbjct: 185 KILLVDDIYTTGKTLQLAKQILLEAGVK--EILTFS 218


>gi|328945019|gb|EGG39175.1| ComFC family protein [Streptococcus sanguinis SK1087]
          Length = 221

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 20/36 (55%), Positives = 24/36 (66%), Gaps = 2/36 (5%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           KILL+DD+YTTG T + A   L +AG     ILTFS
Sbjct: 185 KILLVDDIYTTGKTLQLAKQILLEAGVK--EILTFS 218


>gi|327467200|gb|EGF12704.1| ComFC family protein [Streptococcus sanguinis SK330]
          Length = 221

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 20/36 (55%), Positives = 24/36 (66%), Gaps = 2/36 (5%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           KILL+DD+YTTG T + A   L +AG     ILTFS
Sbjct: 185 KILLVDDIYTTGKTLQLAKQILLEAGVK--EILTFS 218


>gi|327462464|gb|EGF08789.1| ComFC family protein [Streptococcus sanguinis SK1057]
          Length = 221

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 20/36 (55%), Positives = 24/36 (66%), Gaps = 2/36 (5%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           KILL+DD+YTTG T + A   L +AG     ILTFS
Sbjct: 185 KILLVDDIYTTGKTLQLAKQILLEAGVK--EILTFS 218


>gi|325697721|gb|EGD39606.1| ComFC family protein [Streptococcus sanguinis SK160]
          Length = 221

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 20/36 (55%), Positives = 24/36 (66%), Gaps = 2/36 (5%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           KILL+DD+YTTG T + A   L +AG     ILTFS
Sbjct: 185 KILLVDDIYTTGKTLQLAKQILLEAGVK--EILTFS 218


>gi|325695234|gb|EGD37135.1| ComFC family protein [Streptococcus sanguinis SK150]
          Length = 221

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 20/36 (55%), Positives = 24/36 (66%), Gaps = 2/36 (5%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           KILL+DD+YTTG T + A   L +AG     ILTFS
Sbjct: 185 KILLVDDIYTTGKTLQLAKQILLEAGVK--EILTFS 218


>gi|325686906|gb|EGD28930.1| ComFC family protein [Streptococcus sanguinis SK72]
          Length = 221

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 20/36 (55%), Positives = 24/36 (66%), Gaps = 2/36 (5%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           KILL+DD+YTTG T + A   L +AG     ILTFS
Sbjct: 185 KILLVDDIYTTGKTLQLAKQILLEAGVK--EILTFS 218


>gi|324994061|gb|EGC25975.1| ComFC family protein [Streptococcus sanguinis SK678]
 gi|327459267|gb|EGF05613.1| ComFC family protein [Streptococcus sanguinis SK1]
 gi|327472693|gb|EGF18120.1| ComFC family protein [Streptococcus sanguinis SK408]
 gi|327490485|gb|EGF22266.1| ComFC family protein [Streptococcus sanguinis SK1058]
          Length = 221

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 20/36 (55%), Positives = 24/36 (66%), Gaps = 2/36 (5%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           KILL+DD+YTTG T + A   L +AG     ILTFS
Sbjct: 185 KILLVDDIYTTGKTLQLAKQILLEAGVK--EILTFS 218


>gi|324991782|gb|EGC23714.1| competence protein FC [Streptococcus sanguinis SK353]
 gi|325688792|gb|EGD30801.1| competence protein FC [Streptococcus sanguinis SK115]
          Length = 221

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 20/36 (55%), Positives = 24/36 (66%), Gaps = 2/36 (5%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           KILL+DD+YTTG T + A   L +AG     ILTFS
Sbjct: 185 KILLVDDIYTTGKTLQLAKQILLEAGVK--EILTFS 218


>gi|323350290|ref|ZP_08085955.1| ComFC family protein [Streptococcus sanguinis VMC66]
 gi|322123475|gb|EFX95146.1| ComFC family protein [Streptococcus sanguinis VMC66]
          Length = 221

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 20/36 (55%), Positives = 24/36 (66%), Gaps = 2/36 (5%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           KILL+DD+YTTG T + A   L +AG     ILTFS
Sbjct: 185 KILLVDDIYTTGKTLQLAKQILLEAGVK--EILTFS 218


>gi|125718634|ref|YP_001035767.1| late competence protein [Streptococcus sanguinis SK36]
 gi|125498551|gb|ABN45217.1| Late competence protein, putative [Streptococcus sanguinis SK36]
          Length = 221

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 20/36 (55%), Positives = 24/36 (66%), Gaps = 2/36 (5%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           KILL+DD+YTTG T + A   L +AG     ILTFS
Sbjct: 185 KILLVDDIYTTGKTLQLAKQILLEAGVK--EILTFS 218


>gi|50954328|ref|YP_061616.1| competence protein F [Leifsonia xyli subsp. xyli str. CTCB07]
 gi|50950810|gb|AAT88511.1| competence protein F [Leifsonia xyli subsp. xyli str. CTCB07]
          Length = 249

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 18/45 (40%), Positives = 28/45 (62%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           S  +AG + L++DD+ TTGAT   AA A+ +AG   V  +T + +
Sbjct: 186 SPRLAGRRCLIVDDILTTGATVTEAARAIAEAGGEVVGAVTLAHT 230


>gi|302023439|ref|ZP_07248650.1| late competence protein [Streptococcus suis 05HAS68]
          Length = 221

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 17/37 (45%), Positives = 22/37 (59%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           KILL DD+YTTGAT + A     K G   +  L+ +R
Sbjct: 185 KILLFDDIYTTGATIQLAVELFMKIGRKEIKTLSLTR 221


>gi|187934143|ref|YP_001884724.1| competence protein F [Clostridium botulinum B str. Eklund 17B]
 gi|187722296|gb|ACD23517.1| competence protein F [Clostridium botulinum B str. Eklund 17B]
          Length = 217

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 25/38 (65%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           KI+LIDDV TTG T +     LKK GA  + +LT ++S
Sbjct: 178 KIILIDDVTTTGFTIREGHKILKKYGAKEIKLLTLAKS 215


>gi|83721230|ref|YP_440981.1| ComF family protein [Burkholderia thailandensis E264]
 gi|167617774|ref|ZP_02386405.1| ComF family protein [Burkholderia thailandensis Bt4]
 gi|257140365|ref|ZP_05588627.1| ComF family protein [Burkholderia thailandensis E264]
 gi|83655055|gb|ABC39118.1| ComF family protein [Burkholderia thailandensis E264]
          Length = 255

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 22/49 (44%), Positives = 29/49 (59%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           V++ VAG  I ++DDV T+GAT    A  LK AGA  V+     R+ KD
Sbjct: 207 VARPVAGWHIGVVDDVMTSGATLDALARKLKDAGARRVTNFVALRTAKD 255


>gi|238063220|ref|ZP_04607929.1| hypothetical protein MCAG_04186 [Micromonospora sp. ATCC 39149]
 gi|237885031|gb|EEP73859.1| hypothetical protein MCAG_04186 [Micromonospora sp. ATCC 39149]
          Length = 186

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 18/43 (41%), Positives = 29/43 (67%), Gaps = 1/43 (2%)

Query: 14  HVAG-LKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           H AG ++ L++DD +TTG+ A+  A AL+ AGA +V ++   R
Sbjct: 114 HPAGPVRPLILDDTWTTGSRAQSLAHALRVAGASSVGVVVLGR 156


>gi|17545078|ref|NP_518480.1| competence protein F-related protein [Ralstonia solanacearum
           GMI1000]
 gi|17427368|emb|CAD13887.1| putative competence protein f-related protein [Ralstonia
           solanacearum GMI1000]
          Length = 240

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 21/49 (42%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVS 49
           ++ AF+VP      + G  I ++DDV TTGAT    A  LK+AGA  V+
Sbjct: 186 LQGAFDVPDPAC--ITGRHIGVVDDVMTTGATLSEIATQLKRAGAARVT 232


>gi|326512602|dbj|BAJ99656.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 195

 Score = 36.6 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 26/39 (66%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           VAG  +++++D+  TG T  C    L+K GA+++S+ TF
Sbjct: 96  VAGKHVVVVEDIVDTGNTVSCLIAHLQKKGALSISVCTF 134


>gi|119639010|gb|ABL85240.1| putative hypoxanthine-guanine phosphoribosyltransferase [Triticum
           aestivum]
          Length = 186

 Score = 36.6 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 26/39 (66%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           VAG  +++++D+  TG T  C    L+K GA+++S+ TF
Sbjct: 96  VAGKHVVVVEDIVDTGNTVSCLIAHLQKKGALSISVCTF 134


>gi|58697413|ref|ZP_00372723.1| competence protein F, interruption-N [Wolbachia endosymbiont of
           Drosophila simulans]
 gi|225630605|ref|YP_002727396.1| putative competence protein F [Wolbachia sp. wRi]
 gi|58536171|gb|EAL59759.1| competence protein F, interruption-N [Wolbachia endosymbiont of
           Drosophila simulans]
 gi|225592586|gb|ACN95605.1| putative competence protein F [Wolbachia sp. wRi]
          Length = 243

 Score = 36.6 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 15/40 (37%), Positives = 27/40 (67%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++L+DDV TTGAT +  +  +  +GA  V +L+ +R++ D
Sbjct: 197 VILVDDVVTTGATVRSCSQEILNSGAKEVRVLSLARTVND 236


>gi|325860372|ref|ZP_08173484.1| comF family protein [Prevotella denticola CRIS 18C-A]
 gi|325482030|gb|EGC85051.1| comF family protein [Prevotella denticola CRIS 18C-A]
          Length = 229

 Score = 36.6 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           +LL+DDV TTGAT   AA  + KAG + VS+L+ 
Sbjct: 190 VLLVDDVITTGATLVAAAREILKAGNVKVSVLSL 223


>gi|313636336|gb|EFS02124.1| comFC family protein [Listeria seeligeri FSL S4-171]
          Length = 61

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 27/44 (61%)

Query: 12 SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
          ++     +I+L DD+YTTG+T   AA  LK++G   V+ +T  R
Sbjct: 18 TEECCQTEIILFDDIYTTGSTLNLAAQKLKESGVKKVTSVTLFR 61


>gi|326772050|ref|ZP_08231335.1| ComF family protein [Actinomyces viscosus C505]
 gi|326638183|gb|EGE39084.1| ComF family protein [Actinomyces viscosus C505]
          Length = 72

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 3  NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGA 45
          N    P+ ++  V GL ILL+DDV TTGAT    A AL+  G 
Sbjct: 29 NRAQAPRLLAA-VTGLPILLVDDVVTTGATLGACARALRAGGG 70


>gi|291544879|emb|CBL17988.1| Predicted amidophosphoribosyltransferases [Ruminococcus sp. 18P13]
          Length = 237

 Score = 36.6 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 28/46 (60%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           + + GL+ILL DDV TTG+TA+  A  L++ GA  V       S++
Sbjct: 177 QRLDGLRILLCDDVLTTGSTAQRCAQLLRQMGAADVGFAAGCTSIR 222


>gi|299132843|ref|ZP_07026038.1| phosphoribosyltransferase [Afipia sp. 1NLS2]
 gi|298592980|gb|EFI53180.1| phosphoribosyltransferase [Afipia sp. 1NLS2]
          Length = 266

 Score = 36.6 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 33/55 (60%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           M+ AF V       VAG  ++L+DDV T+GAT    A AL +A A +V +L F+R
Sbjct: 203 MQGAFAVGDDQRASVAGRHLILVDDVLTSGATVDACARALLRAKAASVDVLVFAR 257


>gi|327441348|dbj|BAK17713.1| predicted amidophosphoribosyltransferase [Solibacillus silvestris
           StLB046]
          Length = 201

 Score = 36.2 bits (82), Expect = 1.3,   Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 23/35 (65%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           K+L++DD+YTTG T   A  AL +AGA TV   T 
Sbjct: 164 KLLVVDDIYTTGITLNHAKKALLEAGAKTVDGFTL 198


>gi|306828627|ref|ZP_07461821.1| competence protein FC [Streptococcus mitis ATCC 6249]
 gi|304429235|gb|EFM32321.1| competence protein FC [Streptococcus mitis ATCC 6249]
          Length = 220

 Score = 36.2 bits (82), Expect = 1.3,   Method: Composition-based stats.
 Identities = 16/37 (43%), Positives = 23/37 (62%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           KIL++DD+YTTGAT        ++AGA+ V   +  R
Sbjct: 184 KILVVDDIYTTGATVNRVKRLFEEAGALDVKTFSLVR 220


>gi|224531988|ref|ZP_03672620.1| adenine phosphoribosyltransferase [Borrelia valaisiana VS116]
 gi|224511453|gb|EEF81859.1| adenine phosphoribosyltransferase [Borrelia valaisiana VS116]
          Length = 176

 Score = 36.2 bits (82), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 21/34 (61%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           ILLIDD+  TG T K +AI L++AG     I  F
Sbjct: 119 ILLIDDILATGGTLKSSAILLERAGGRVKDIFCF 152


>gi|260584685|ref|ZP_05852431.1| competence protein ComFC [Granulicatella elegans ATCC 700633]
 gi|260157708|gb|EEW92778.1| competence protein ComFC [Granulicatella elegans ATCC 700633]
          Length = 224

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 18/37 (48%), Positives = 22/37 (59%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           KILL DD+YTTG T + AA  L+  G   V + T  R
Sbjct: 188 KILLFDDIYTTGKTIRLAAKLLQDKGIEDVKLFTVFR 224


>gi|160878406|ref|YP_001557374.1| amidophosphoribosyltransferase [Clostridium phytofermentans ISDg]
 gi|160427072|gb|ABX40635.1| amidophosphoribosyltransferase [Clostridium phytofermentans ISDg]
          Length = 245

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 1   MRNAFNVPQYVSKHVAGL---KILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
           +  AF+V   V K        +++L+DD+YTTG+T +     L+KAG + V  +T
Sbjct: 184 LEKAFSVSTNVKKSEELFPYKRVILVDDIYTTGSTIEACTNVLQKAGCLEVFFVT 238


>gi|258542216|ref|YP_003187649.1| competence protein F [Acetobacter pasteurianus IFO 3283-01]
 gi|256633294|dbj|BAH99269.1| competence protein F [Acetobacter pasteurianus IFO 3283-01]
 gi|256636353|dbj|BAI02322.1| competence protein F [Acetobacter pasteurianus IFO 3283-03]
 gi|256639406|dbj|BAI05368.1| competence protein F [Acetobacter pasteurianus IFO 3283-07]
 gi|256642462|dbj|BAI08417.1| competence protein F [Acetobacter pasteurianus IFO 3283-22]
 gi|256645517|dbj|BAI11465.1| competence protein F [Acetobacter pasteurianus IFO 3283-26]
 gi|256648570|dbj|BAI14511.1| competence protein F [Acetobacter pasteurianus IFO 3283-32]
 gi|256651623|dbj|BAI17557.1| competence protein F [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654614|dbj|BAI20541.1| competence protein F [Acetobacter pasteurianus IFO 3283-12]
          Length = 255

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 18/44 (40%), Positives = 29/44 (65%), Gaps = 1/44 (2%)

Query: 8   PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51
           P++  K + G  ++L+DD+ TTGATA     AL++AG  +V +L
Sbjct: 196 PKWQQK-LQGRSVVLVDDMLTTGATATACVQALRQAGVRSVRLL 238


>gi|218249429|ref|YP_002375276.1| adenine phosphoribosyltransferase [Borrelia burgdorferi ZS7]
 gi|226722162|sp|B7J0M3|APT_BORBZ RecName: Full=Adenine phosphoribosyltransferase; Short=APRT
 gi|218164617|gb|ACK74678.1| adenine phosphoribosyltransferase [Borrelia burgdorferi ZS7]
          Length = 176

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 21/34 (61%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           ILLIDD+  TG T K +AI L++AG     I  F
Sbjct: 119 ILLIDDILATGGTLKSSAILLERAGGKVKDIFCF 152


>gi|227486947|ref|ZP_03917263.1| possible competence protein F [Corynebacterium glucuronolyticum
           ATCC 51867]
 gi|227093021|gb|EEI28333.1| possible competence protein F [Corynebacterium glucuronolyticum
           ATCC 51867]
          Length = 201

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 19/48 (39%), Positives = 27/48 (56%)

Query: 7   VPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           V + V + V    ILL+DD+ TTG+T +  A+AL   G   V  LT +
Sbjct: 152 VGKVVVEAVPAGPILLVDDIVTTGSTIEATALALTARGGTVVGALTLA 199


>gi|219684134|ref|ZP_03539078.1| adenine phosphoribosyltransferase [Borrelia garinii PBr]
 gi|219672123|gb|EED29176.1| adenine phosphoribosyltransferase [Borrelia garinii PBr]
          Length = 176

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 21/34 (61%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           ILLIDD+  TG T K +AI L++AG     I  F
Sbjct: 119 ILLIDDILATGGTLKSSAILLERAGGRVKDIFCF 152


>gi|171186353|ref|YP_001795272.1| amidophosphoribosyltransferase [Thermoproteus neutrophilus V24Sta]
 gi|170935565|gb|ACB40826.1| Amidophosphoribosyltransferase [Thermoproteus neutrophilus V24Sta]
          Length = 421

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 19/49 (38%), Positives = 26/49 (53%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
           R A  V Q V ++VAG +I L+DD    G   +     LK+AGA  V +
Sbjct: 289 RKAEEVFQVVKEYVAGRRIFLVDDSLIRGTNIRAIVWMLKRAGAAEVHV 337


>gi|218668080|ref|YP_002424749.1| competence protein [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|218520293|gb|ACK80879.1| competence protein [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 263

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 5/54 (9%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           AF + + V  HVA     ++DDV TTG TA   A  L+ AG   + +   +R+L
Sbjct: 215 AFALRERVPDHVA-----VVDDVLTTGTTAAQIASTLRAAGVQRIDVWVLARAL 263


>gi|198282558|ref|YP_002218879.1| competence protein F [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|198247079|gb|ACH82672.1| competence protein F [Acidithiobacillus ferrooxidans ATCC 53993]
          Length = 237

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 5/54 (9%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           AF + + V  HVA     ++DDV TTG TA   A  L+ AG   + +   +R+L
Sbjct: 189 AFALRERVPDHVA-----VVDDVLTTGTTAAQIASTLRAAGVQRIDVWVLARAL 237


>gi|51599028|ref|YP_073216.1| adenine phosphoribosyltransferase [Borrelia garinii PBi]
 gi|61211332|sp|Q65ZZ7|APT_BORGA RecName: Full=Adenine phosphoribosyltransferase; Short=APRT
 gi|51573599|gb|AAU07624.1| adenine phosphoribosyltransferase [Borrelia garinii PBi]
          Length = 176

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 21/34 (61%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           ILLIDD+  TG T K +AI L++AG     I  F
Sbjct: 119 ILLIDDILATGGTLKSSAILLERAGGRVKDIFCF 152


>gi|313139987|ref|ZP_07802180.1| conserved hypothetical protein [Bifidobacterium bifidum NCIMB
           41171]
 gi|313132497|gb|EFR50114.1| conserved hypothetical protein [Bifidobacterium bifidum NCIMB
           41171]
          Length = 219

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 26/39 (66%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++L+DD+ TTG TA+  A AL  AG    +++  +R+L+
Sbjct: 174 VILVDDIVTTGTTARQCAQALNAAGIHVTTVICLARTLR 212


>gi|224282828|ref|ZP_03646150.1| hypothetical protein BbifN4_03269 [Bifidobacterium bifidum NCIMB
           41171]
          Length = 230

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 26/39 (66%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++L+DD+ TTG TA+  A AL  AG    +++  +R+L+
Sbjct: 185 VILVDDIVTTGTTARQCAQALNAAGIHVTTVICLARTLR 223


>gi|219685610|ref|ZP_03540426.1| adenine phosphoribosyltransferase [Borrelia garinii Far04]
 gi|219672888|gb|EED29911.1| adenine phosphoribosyltransferase [Borrelia garinii Far04]
          Length = 176

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 21/34 (61%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           ILLIDD+  TG T K +AI L++AG     I  F
Sbjct: 119 ILLIDDILATGGTLKSSAILLERAGGRVKDIFCF 152


>gi|254995474|ref|ZP_05277664.1| Competence protein F (comF) [Anaplasma marginale str. Mississippi]
 gi|255003665|ref|ZP_05278629.1| Competence protein F (comF) [Anaplasma marginale str. Puerto Rico]
 gi|269959168|ref|YP_003328957.1| putative amidophosphoribosyltransferase [Anaplasma centrale str.
           Israel]
 gi|269848999|gb|ACZ49643.1| putative amidophosphoribosyltransferase [Anaplasma centrale str.
           Israel]
          Length = 235

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/43 (48%), Positives = 25/43 (58%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           V G  I+LIDDV TTGAT    A AL   GA  +  +T  R+L
Sbjct: 192 VRGKVIVLIDDVITTGATIAACASALADTGAREIRAVTLCRTL 234


>gi|15595122|ref|NP_212911.1| adenine phosphoribosyltransferase [Borrelia burgdorferi B31]
 gi|195941598|ref|ZP_03086980.1| adenine phosphoribosyltransferase [Borrelia burgdorferi 80a]
 gi|216264382|ref|ZP_03436374.1| adenine phosphoribosyltransferase [Borrelia burgdorferi 156a]
 gi|221217880|ref|ZP_03589347.1| adenine phosphoribosyltransferase [Borrelia burgdorferi 72a]
 gi|223889356|ref|ZP_03623942.1| adenine phosphoribosyltransferase [Borrelia burgdorferi 64b]
 gi|224532956|ref|ZP_03673565.1| adenine phosphoribosyltransferase [Borrelia burgdorferi WI91-23]
 gi|224533383|ref|ZP_03673977.1| adenine phosphoribosyltransferase [Borrelia burgdorferi CA-11.2a]
 gi|225548974|ref|ZP_03769951.1| adenine phosphoribosyltransferase [Borrelia burgdorferi 94a]
 gi|225549938|ref|ZP_03770899.1| adenine phosphoribosyltransferase [Borrelia burgdorferi 118a]
 gi|226320633|ref|ZP_03796192.1| adenine phosphoribosyltransferase [Borrelia burgdorferi 29805]
 gi|226321477|ref|ZP_03797004.1| adenine phosphoribosyltransferase [Borrelia burgdorferi Bol26]
 gi|3913076|sp|O51718|APT_BORBU RecName: Full=Adenine phosphoribosyltransferase; Short=APRT
 gi|2688722|gb|AAC67130.1| adenine phosphoribosyltransferase (apt) [Borrelia burgdorferi B31]
 gi|215980855|gb|EEC21662.1| adenine phosphoribosyltransferase [Borrelia burgdorferi 156a]
 gi|221192186|gb|EEE18406.1| adenine phosphoribosyltransferase [Borrelia burgdorferi 72a]
 gi|223885042|gb|EEF56146.1| adenine phosphoribosyltransferase [Borrelia burgdorferi 64b]
 gi|224512120|gb|EEF82512.1| adenine phosphoribosyltransferase [Borrelia burgdorferi WI91-23]
 gi|224513548|gb|EEF83905.1| adenine phosphoribosyltransferase [Borrelia burgdorferi CA-11.2a]
 gi|225369397|gb|EEG98849.1| adenine phosphoribosyltransferase [Borrelia burgdorferi 118a]
 gi|225370577|gb|EEH00014.1| adenine phosphoribosyltransferase [Borrelia burgdorferi 94a]
 gi|226233273|gb|EEH32025.1| adenine phosphoribosyltransferase [Borrelia burgdorferi Bol26]
 gi|226233956|gb|EEH32678.1| adenine phosphoribosyltransferase [Borrelia burgdorferi 29805]
 gi|312148098|gb|ADQ30757.1| adenine phosphoribosyltransferase [Borrelia burgdorferi JD1]
 gi|312149676|gb|ADQ29747.1| adenine phosphoribosyltransferase [Borrelia burgdorferi N40]
          Length = 176

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 21/34 (61%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           ILLIDD+  TG T K +AI L++AG     I  F
Sbjct: 119 ILLIDDILATGGTLKSSAILLERAGGKVKDIFCF 152


>gi|302384834|ref|YP_003820656.1| phosphoribosyltransferase [Clostridium saccharolyticum WM1]
 gi|302195462|gb|ADL03033.1| phosphoribosyltransferase [Clostridium saccharolyticum WM1]
          Length = 236

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 16/32 (50%), Positives = 22/32 (68%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51
           ++L+DD+YTTG+T +    ALKKAG   V  L
Sbjct: 197 VILVDDIYTTGSTIEACTRALKKAGIKRVYFL 228


>gi|251799729|ref|YP_003014460.1| amidophosphoribosyltransferase-like protein [Paenibacillus sp.
           JDR-2]
 gi|247547355|gb|ACT04374.1| amidophosphoribosyltransferase-like protein [Paenibacillus sp.
           JDR-2]
          Length = 294

 Score = 36.2 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 18/41 (43%), Positives = 28/41 (68%), Gaps = 2/41 (4%)

Query: 18  LKILLIDDVYTTGATAKCAAIALKKAGAMTVSI--LTFSRS 56
           ++ILL+DD+YTTG+T    A AL +   + + I  LT++RS
Sbjct: 254 IRILLVDDIYTTGSTIGACAAALHQHSEVPLDIYALTWARS 294


>gi|225551763|ref|ZP_03772706.1| adenine phosphoribosyltransferase [Borrelia sp. SV1]
 gi|225371558|gb|EEH00985.1| adenine phosphoribosyltransferase [Borrelia sp. SV1]
          Length = 176

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 21/34 (61%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           ILLIDD+  TG T K +AI L++AG     I  F
Sbjct: 119 ILLIDDILATGGTLKSSAILLERAGGKVKDIFCF 152


>gi|217979097|ref|YP_002363244.1| phosphoribosyltransferase [Methylocella silvestris BL2]
 gi|217504473|gb|ACK51882.1| phosphoribosyltransferase [Methylocella silvestris BL2]
          Length = 268

 Score = 36.2 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 33/55 (60%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           M+ AF V +     V G  I+L+DDV T+GAT   AA AL +A A  V +L F+R
Sbjct: 212 MQGAFRVKEETIAQVEGRAIVLVDDVMTSGATVNAAARALLRAKAERVDVLVFAR 266


>gi|319939645|ref|ZP_08014004.1| competence protein ComFC [Streptococcus anginosus 1_2_62CV]
 gi|319811234|gb|EFW07540.1| competence protein ComFC [Streptococcus anginosus 1_2_62CV]
          Length = 221

 Score = 36.2 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 16/37 (43%), Positives = 24/37 (64%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           K+LLIDD+YTTG+T + A   L +AG   +   + +R
Sbjct: 185 KVLLIDDIYTTGSTLQLAKEILVEAGVKEIVTFSLAR 221


>gi|315221976|ref|ZP_07863887.1| ComF family protein [Streptococcus anginosus F0211]
 gi|315188942|gb|EFU22646.1| ComF family protein [Streptococcus anginosus F0211]
          Length = 221

 Score = 36.2 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 19/36 (52%), Positives = 25/36 (69%), Gaps = 2/36 (5%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           K+LLIDD+YTTG+T + A   L +AG     I+TFS
Sbjct: 185 KVLLIDDIYTTGSTLQLAKEMLVEAGVK--EIMTFS 218


>gi|153854474|ref|ZP_01995752.1| hypothetical protein DORLON_01747 [Dorea longicatena DSM 13814]
 gi|149753000|gb|EDM62931.1| hypothetical protein DORLON_01747 [Dorea longicatena DSM 13814]
          Length = 242

 Score = 36.2 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 7/56 (12%)

Query: 1   MRNAFNVPQYVSKHV--AGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +++AF V     KH   A  ++LL+DD+YTTG T    +  LK+ G   V  LT S
Sbjct: 187 LKHAFAV-----KHTFQAVKRVLLVDDIYTTGNTIDAVSNVLKQKGVENVYFLTIS 237


>gi|256848108|ref|ZP_05553552.1| competence protein [Lactobacillus coleohominis 101-4-CHN]
 gi|256715168|gb|EEU30145.1| competence protein [Lactobacillus coleohominis 101-4-CHN]
          Length = 224

 Score = 36.2 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 18/40 (45%), Positives = 26/40 (65%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           V+G +I+L+DDVYTTG T   AA   ++AG   V  +T +
Sbjct: 184 VSGKRIVLVDDVYTTGRTLYHAATLCRQAGCRQVWSVTLA 223


>gi|255004790|ref|ZP_05279591.1| Competence protein F (comF) [Anaplasma marginale str. Virginia]
          Length = 237

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/43 (48%), Positives = 25/43 (58%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           V G  I+LIDDV TTGAT    A AL   GA  +  +T  R+L
Sbjct: 194 VRGKVIVLIDDVITTGATIAACASALADTGAREIRAVTLCRTL 236


>gi|229592992|ref|YP_002875111.1| hypothetical protein PFLU5616 [Pseudomonas fluorescens SBW25]
 gi|229364858|emb|CAY52911.1| conserved hypothetical protein [Pseudomonas fluorescens SBW25]
          Length = 245

 Score = 36.2 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 24/45 (53%)

Query: 14  HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            V G    L+DDV TTGATA   A  L  AGA  V +   +R+ K
Sbjct: 198 QVQGRHFALVDDVLTTGATAHSLARLLINAGARQVDVYCLARTPK 242


>gi|58699993|ref|ZP_00374558.1| putative amidophosphoribosyltransferase [Wolbachia endosymbiont
          of Drosophila ananassae]
 gi|58533490|gb|EAL57924.1| putative amidophosphoribosyltransferase [Wolbachia endosymbiont
          of Drosophila ananassae]
          Length = 47

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 27/40 (67%)

Query: 20 ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
          ++L+DDV TTGAT +  +  +  +GA  V +L+ +R++ D
Sbjct: 1  MILVDDVVTTGATVRSCSQEILNSGAKEVRVLSLARTVND 40


>gi|121997755|ref|YP_001002542.1| competence protein F [Halorhodospira halophila SL1]
 gi|121589160|gb|ABM61740.1| competence protein F [Halorhodospira halophila SL1]
          Length = 238

 Score = 36.2 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 18/37 (48%), Positives = 25/37 (67%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + L+DDV TTGATA+ AA AL+ AG   V +   +R+
Sbjct: 201 VALLDDVVTTGATAEEAAQALRDAGVGRVDLWAVART 237


>gi|326796484|ref|YP_004314304.1| phosphoribosyltransferase [Marinomonas mediterranea MMB-1]
 gi|326547248|gb|ADZ92468.1| phosphoribosyltransferase [Marinomonas mediterranea MMB-1]
          Length = 243

 Score = 36.2 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 17/37 (45%), Positives = 24/37 (64%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++LIDDV TTGAT +     L KAGA +V +   +R+
Sbjct: 203 VVLIDDVMTTGATLEACTKTLLKAGASSVDVWVIART 239


>gi|270291252|ref|ZP_06197474.1| amidophosphoribosyltransferase [Pediococcus acidilactici 7_4]
 gi|270280098|gb|EFA25934.1| amidophosphoribosyltransferase [Pediococcus acidilactici 7_4]
          Length = 489

 Score = 36.2 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 21/48 (43%), Positives = 27/48 (56%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +S  VAG K+ L+DD    G T+K     LKKAGA  V ++  S  LK
Sbjct: 345 LSAVVAGKKVALVDDSLVRGTTSKYIVKMLKKAGAKAVHLMISSPPLK 392


>gi|254491833|ref|ZP_05105012.1| hypothetical protein MDMS009_2168 [Methylophaga thiooxidans DMS010]
 gi|224463311|gb|EEF79581.1| hypothetical protein MDMS009_2168 [Methylophaga thiooxydans DMS010]
          Length = 198

 Score = 36.2 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 6/58 (10%)

Query: 1   MRNAFNV-PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           MRNAF    + + KHVA     +IDDV T+G T   AA  +K+ G   + + T +R++
Sbjct: 143 MRNAFACRTKQLPKHVA-----IIDDVMTSGYTVGEAAKIVKRQGVEVIEVWTIARAI 195


>gi|56417308|ref|YP_154382.1| hypothetical protein AM1346 [Anaplasma marginale str. St. Maries]
 gi|222475671|ref|YP_002564088.1| Competence protein F (comF) [Anaplasma marginale str. Florida]
 gi|56388540|gb|AAV87127.1| hypothetical protein AM1346 [Anaplasma marginale str. St. Maries]
 gi|222419809|gb|ACM49832.1| Competence protein F (comF) [Anaplasma marginale str. Florida]
          Length = 249

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/43 (48%), Positives = 25/43 (58%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           V G  I+LIDDV TTGAT    A AL   GA  +  +T  R+L
Sbjct: 206 VRGKVIVLIDDVITTGATIAACASALADTGAREIRAVTLCRTL 248


>gi|52842542|ref|YP_096341.1| competence protein ComF [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
 gi|52629653|gb|AAU28394.1| competence protein ComF [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
          Length = 199

 Score = 36.2 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 5/57 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R+AF V     +HV     +++DD+ TTG+TA   A  LK AG   V I   +R++
Sbjct: 145 LRHAFYVSAVTYEHV-----MIVDDLLTTGSTANEMAHTLKNAGVKRVDICCCARAV 196


>gi|300718786|ref|YP_003743589.1| gluconate periplasmic binding protein [Erwinia billingiae Eb661]
 gi|299064622|emb|CAX61742.1| Gluconate periplasmic binding protein [Erwinia billingiae Eb661]
          Length = 231

 Score = 36.2 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF V       V GL I L DDV TTG+T    +  L  AGA +V + +  R+L
Sbjct: 179 LRGAFRV----EIAVKGLHIALTDDVVTTGSTVGEISRILLAAGAASVQVWSLCRTL 231


>gi|210608824|ref|ZP_03288020.1| hypothetical protein CLONEX_00199 [Clostridium nexile DSM 1787]
 gi|210152890|gb|EEA83896.1| hypothetical protein CLONEX_00199 [Clostridium nexile DSM 1787]
          Length = 234

 Score = 36.2 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 17/35 (48%), Positives = 21/35 (60%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +L+IDD+YTTG+T    A  LK  G   V  LT S
Sbjct: 195 VLVIDDIYTTGSTIDTVAEELKSRGVQKVCFLTIS 229


>gi|325510260|gb|ADZ21896.1| amidophosphoribosyltransferase [Clostridium acetobutylicum EA 2018]
          Length = 226

 Score = 36.2 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +LLIDDV+TTGATA   +  L   GA  V +LT ++S
Sbjct: 188 VLLIDDVFTTGATAFFCSKELINNGAKKVIVLTVAKS 224


>gi|119899106|ref|YP_934319.1| putative competence protein F [Azoarcus sp. BH72]
 gi|119671519|emb|CAL95432.1| putative competence protein F [Azoarcus sp. BH72]
          Length = 230

 Score = 36.2 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 33/56 (58%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF+     +  + G ++L++DDV TTGAT   AA  LK+ GA  V  L  +R+
Sbjct: 175 VRGAFDS----ATDLRGRRVLVLDDVMTTGATLGEAARILKRRGAERVDNLVIART 226


>gi|148258762|ref|YP_001243347.1| putative competence protein F (COMF) [Bradyrhizobium sp. BTAi1]
 gi|146410935|gb|ABQ39441.1| putative competence protein F (COMF) [Bradyrhizobium sp. BTAi1]
          Length = 267

 Score = 36.2 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 33/55 (60%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++ AF V       V G +I+++DDV TTGAT    A AL +A A  VS+L F+R
Sbjct: 204 VQGAFQVSPDRLHEVQGRRIVIVDDVLTTGATVDACARALLRAKAAEVSVLVFAR 258


>gi|323703018|ref|ZP_08114674.1| phosphoribosyltransferase [Desulfotomaculum nigrificans DSM 574]
 gi|323532031|gb|EGB21914.1| phosphoribosyltransferase [Desulfotomaculum nigrificans DSM 574]
          Length = 253

 Score = 36.2 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 16/35 (45%), Positives = 24/35 (68%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           KILL+DDV+TTG+T    A  L++ GA  + ++T 
Sbjct: 200 KILLLDDVFTTGSTVSVIADLLRQQGAGEIFVITL 234


>gi|319952722|ref|YP_004163989.1| phosphoribosyltransferase [Cellulophaga algicola DSM 14237]
 gi|319421382|gb|ADV48491.1| phosphoribosyltransferase [Cellulophaga algicola DSM 14237]
          Length = 232

 Score = 36.2 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 19/43 (44%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 13  KH-VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           KH ++   ILL+DDV TTGAT +    A +K   +T+ ILT +
Sbjct: 187 KHGISNKNILLVDDVVTTGATLESCVKAFEKEEGVTIYILTMA 229


>gi|332366348|gb|EGJ44099.1| competence protein ComFC [Streptococcus sanguinis SK355]
          Length = 221

 Score = 36.2 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 20/36 (55%), Positives = 24/36 (66%), Gaps = 2/36 (5%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           KILL+DD+YTTG T + A   L +AG   V  LTFS
Sbjct: 185 KILLVDDIYTTGKTLQLAKQILLEAGVKEV--LTFS 218


>gi|326804108|ref|YP_004321926.1| comF family protein [Aerococcus urinae ACS-120-V-Col10a]
 gi|326651126|gb|AEA01309.1| comF family protein [Aerococcus urinae ACS-120-V-Col10a]
          Length = 225

 Score = 36.2 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 22/37 (59%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           KILL DDVYTTGAT    A  L+  G   ++ LT  R
Sbjct: 189 KILLFDDVYTTGATIHQVARFLESFGVEEIASLTLGR 225


>gi|163782323|ref|ZP_02177321.1| hypothetical protein HG1285_06035 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882356|gb|EDP75862.1| hypothetical protein HG1285_06035 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 216

 Score = 36.2 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 30/55 (54%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +++AF V +     V G ++L+ DD+ TTGAT++  +  L   GA  V     SR
Sbjct: 158 VKDAFGVREEFIDAVEGKRVLVFDDILTTGATSRAVSELLLSLGASEVFFYFLSR 212


>gi|68171519|ref|ZP_00544900.1| competence protein F [Ehrlichia chaffeensis str. Sapulpa]
 gi|88658293|ref|YP_506971.1| putative competence protein F [Ehrlichia chaffeensis str. Arkansas]
 gi|67999066|gb|EAM85736.1| competence protein F [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599750|gb|ABD45219.1| putative competence protein F [Ehrlichia chaffeensis str. Arkansas]
          Length = 230

 Score = 35.8 bits (81), Expect = 1.7,   Method: Composition-based stats.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ILL+DDV TTG T +     L ++GA  V ++T +R+L
Sbjct: 193 ILLVDDVITTGITVRTCTHKLIESGAKEVRVITLARTL 230


>gi|95931035|ref|ZP_01313763.1| phosphoribosyltransferase [Desulfuromonas acetoxidans DSM 684]
 gi|95132931|gb|EAT14602.1| phosphoribosyltransferase [Desulfuromonas acetoxidans DSM 684]
          Length = 247

 Score = 35.8 bits (81), Expect = 1.7,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 6/57 (10%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           MR  F  P+         +ILLIDD+ TT +TA+  + AL + G  TV++L  +R+L
Sbjct: 194 MRGVFYSPEARPS-----RILLIDDIATTTSTARACSRALTQRG-HTVAVLVVARAL 244


>gi|313631964|gb|EFR99089.1| ComF operon protein 3 [Listeria seeligeri FSL N1-067]
          Length = 217

 Score = 35.8 bits (81), Expect = 1.8,   Method: Composition-based stats.
 Identities = 17/37 (45%), Positives = 24/37 (64%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +I L DD+YTTG+T   AA  LK++G   V+ +T  R
Sbjct: 181 EITLFDDIYTTGSTLNLAAQKLKESGVKKVTSVTLFR 217


>gi|227539134|ref|ZP_03969183.1| possible competence protein F [Sphingobacterium spiritivorum ATCC
           33300]
 gi|227240816|gb|EEI90831.1| possible competence protein F [Sphingobacterium spiritivorum ATCC
           33300]
          Length = 230

 Score = 35.8 bits (81), Expect = 1.8,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 23/37 (62%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ILL+DDV TTGAT   AA  L     + VSI T +R+
Sbjct: 194 ILLVDDVLTTGATLASAARTLTGISGVRVSIATLARA 230


>gi|254973792|ref|ZP_05270264.1| putative phosphoribosyl transferase (putative competence protein)
           [Clostridium difficile QCD-66c26]
 gi|255091181|ref|ZP_05320659.1| putative phosphoribosyl transferase (putative competence protein)
           [Clostridium difficile CIP 107932]
 gi|255099293|ref|ZP_05328270.1| putative phosphoribosyl transferase (putative competence protein)
           [Clostridium difficile QCD-63q42]
 gi|255305079|ref|ZP_05349251.1| putative phosphoribosyl transferase (putative competence protein)
           [Clostridium difficile ATCC 43255]
 gi|255312836|ref|ZP_05354419.1| putative phosphoribosyl transferase (putative competence protein)
           [Clostridium difficile QCD-76w55]
 gi|255515595|ref|ZP_05383271.1| putative phosphoribosyl transferase (putative competence protein)
           [Clostridium difficile QCD-97b34]
 gi|255648689|ref|ZP_05395591.1| putative phosphoribosyl transferase (putative competence protein)
           [Clostridium difficile QCD-37x79]
 gi|260681911|ref|YP_003213196.1| putative phosphoribosyl transferase [Clostridium difficile CD196]
 gi|260685509|ref|YP_003216642.1| putative phosphoribosyl transferase [Clostridium difficile R20291]
 gi|306518810|ref|ZP_07405157.1| putative phosphoribosyl transferase (putative competence protein)
           [Clostridium difficile QCD-32g58]
 gi|260208074|emb|CBA60305.1| putative phosphoribosyl transferase (putative competence protein)
           [Clostridium difficile CD196]
 gi|260211525|emb|CBE01691.1| putative phosphoribosyl transferase (putative competence protein)
           [Clostridium difficile R20291]
          Length = 260

 Score = 35.8 bits (81), Expect = 1.8,   Method: Composition-based stats.
 Identities = 23/59 (38%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++N F V + V K +    ILLIDD++TTG T    +  LK +GA  V +LT      D
Sbjct: 198 LKNVFVVKENV-KLINNKNILLIDDIFTTGLTTNEISKLLKLSGANKVFVLTLLTKAND 255


>gi|126697705|ref|YP_001086602.1| putative phosphoribosyl transferase (putative competence protein)
           [Clostridium difficile 630]
 gi|115249142|emb|CAJ66953.1| putative phosphoribosyl transferase [Clostridium difficile]
          Length = 260

 Score = 35.8 bits (81), Expect = 1.8,   Method: Composition-based stats.
 Identities = 23/59 (38%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++N F V + V K +    ILLIDD++TTG T    +  LK +GA  V +LT      D
Sbjct: 198 LKNVFVVKENV-KLINNKNILLIDDIFTTGLTTNEISKLLKLSGANKVFVLTLLTKAND 255


>gi|270291858|ref|ZP_06198073.1| putative competence protein ComF [Streptococcus sp. M143]
 gi|270279386|gb|EFA25228.1| putative competence protein ComF [Streptococcus sp. M143]
          Length = 220

 Score = 35.8 bits (81), Expect = 1.8,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 2   RNAFNVPQYVSKHVAGL--KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           R A  +P Y+ K  A L  KIL+IDD+YTTGAT        ++AG + V   +  R
Sbjct: 166 RLATEIPFYI-KTEAPLPKKILVIDDIYTTGATINRVKRLFEEAGVLEVKTFSLVR 220


>gi|224826043|ref|ZP_03699146.1| competence protein F [Lutiella nitroferrum 2002]
 gi|224601680|gb|EEG07860.1| competence protein F [Lutiella nitroferrum 2002]
          Length = 236

 Score = 35.8 bits (81), Expect = 1.8,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 27/47 (57%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           V + + GL I ++DDV T+GAT    A  LKK GA  V     +R++
Sbjct: 186 VKRCLDGLCIAIVDDVATSGATLSALAATLKKQGAKRVEAWVLARAI 232


>gi|167765506|ref|ZP_02437574.1| hypothetical protein CLOSS21_00004 [Clostridium sp. SS2/1]
 gi|167712797|gb|EDS23376.1| hypothetical protein CLOSS21_00004 [Clostridium sp. SS2/1]
          Length = 336

 Score = 35.8 bits (81), Expect = 1.8,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 30/46 (65%)

Query: 14  HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +VAG   ++IDD+ T+GAT   A   LK+AGA  V + + ++++ +
Sbjct: 289 NVAGRDFVIIDDICTSGATLMYAEKRLKEAGARKVVLFSLAKNVSN 334


>gi|94309203|ref|YP_582413.1| amidophosphoribosyltransferases-like protein [Cupriavidus
           metallidurans CH34]
 gi|93353055|gb|ABF07144.1| putative amidophosphoribosyltransferase [Cupriavidus metallidurans
           CH34]
          Length = 279

 Score = 35.8 bits (81), Expect = 1.8,   Method: Composition-based stats.
 Identities = 21/40 (52%), Positives = 25/40 (62%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           GL I L+DDV TTGAT + AA  LK  GA  V+ L   R+
Sbjct: 239 GLHIGLVDDVMTTGATLREAARVLKAHGAARVTALPALRT 278


>gi|288550254|ref|ZP_05969771.2| competence protein F [Enterobacter cancerogenus ATCC 35316]
 gi|288315815|gb|EFC54753.1| competence protein F [Enterobacter cancerogenus ATCC 35316]
          Length = 163

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +   V+    GL I L+DDV TTG+T    +  L ++GA +V +    R+L
Sbjct: 111 LKNAFRLELPVN----GLHIALVDDVVTTGSTVAELSRLLLQSGAASVQVWCLCRTL 163


>gi|296107921|ref|YP_003619622.1| competence protein ComF [Legionella pneumophila 2300/99 Alcoy]
 gi|295649823|gb|ADG25670.1| competence protein ComF [Legionella pneumophila 2300/99 Alcoy]
          Length = 234

 Score = 35.8 bits (81), Expect = 1.8,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 5/57 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R+AF V     +HV     +++DD+ TTG+TA   A  LK AG   V I   +R++
Sbjct: 180 LRHAFYVSPVTYEHV-----MIVDDLLTTGSTANEMAHTLKNAGVKRVDICCCARAV 231


>gi|206579882|ref|YP_002236214.1| protein GntX [Klebsiella pneumoniae 342]
 gi|206568940|gb|ACI10716.1| protein GntX [Klebsiella pneumoniae 342]
          Length = 224

 Score = 35.8 bits (81), Expect = 1.8,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL I ++DDV TTG+T    +  L + GA TV +    R+L
Sbjct: 172 LKNAFQL----EFAVQGLHIAIVDDVVTTGSTVAEISRLLLRNGAATVQVWCLCRTL 224


>gi|312870395|ref|ZP_07730520.1| phosphoribosyl transferase domain protein [Lactobacillus oris
           PB013-T2-3]
 gi|311094096|gb|EFQ52415.1| phosphoribosyl transferase domain protein [Lactobacillus oris
           PB013-T2-3]
          Length = 187

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 26/37 (70%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           ++ + G K+LL+DDV +TG++   AA  L+KAG+  V
Sbjct: 117 AQQLQGKKVLLVDDVISTGSSIHSAATLLEKAGSHVV 153


>gi|312127293|ref|YP_003992167.1| phosphoribosyltransferase [Caldicellulosiruptor hydrothermalis 108]
 gi|311777312|gb|ADQ06798.1| phosphoribosyltransferase [Caldicellulosiruptor hydrothermalis 108]
          Length = 231

 Score = 35.8 bits (81), Expect = 1.9,   Method: Composition-based stats.
 Identities = 17/43 (39%), Positives = 31/43 (72%), Gaps = 2/43 (4%)

Query: 15  VAGLKILLIDDVYTTGATA-KCAAIALKK-AGAMTVSILTFSR 55
           + G K++L+DD++TTGATA +C+ + L+  A  + VS+L  ++
Sbjct: 186 IKGKKVILVDDIFTTGATANECSKVLLENGAKCVFVSVLAITK 228


>gi|290512006|ref|ZP_06551374.1| gluconate periplasmic binding protein [Klebsiella sp. 1_1_55]
 gi|289775796|gb|EFD83796.1| gluconate periplasmic binding protein [Klebsiella sp. 1_1_55]
          Length = 224

 Score = 35.8 bits (81), Expect = 1.9,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL I ++DDV TTG+T    +  L + GA TV +    R+L
Sbjct: 172 LKNAFQL----EFAVEGLHIAIVDDVVTTGSTVAEISRLLLRNGAATVQVWCLCRTL 224


>gi|289168884|ref|YP_003447153.1| ComFC protein [Streptococcus mitis B6]
 gi|288908451|emb|CBJ23293.1| ComFC protein [Streptococcus mitis B6]
          Length = 220

 Score = 35.8 bits (81), Expect = 1.9,   Method: Composition-based stats.
 Identities = 18/37 (48%), Positives = 22/37 (59%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           KILLIDD+YTTG T       L++AGA  V   +  R
Sbjct: 184 KILLIDDIYTTGTTINRVKKLLEEAGAEDVKTFSLVR 220


>gi|288933202|ref|YP_003437261.1| phosphoribosyltransferase [Klebsiella variicola At-22]
 gi|288887931|gb|ADC56249.1| phosphoribosyltransferase [Klebsiella variicola At-22]
          Length = 224

 Score = 35.8 bits (81), Expect = 1.9,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL I ++DDV TTG+T    +  L + GA TV +    R+L
Sbjct: 172 LKNAFQL----EFAVEGLHIAIVDDVVTTGSTVAEISRLLLRNGAATVQVWCLCRTL 224


>gi|148359871|ref|YP_001251078.1| competence protein ComF [Legionella pneumophila str. Corby]
 gi|148281644|gb|ABQ55732.1| competence protein ComF [Legionella pneumophila str. Corby]
          Length = 196

 Score = 35.8 bits (81), Expect = 1.9,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 5/57 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R+AF V     +HV     +++DD+ TTG+TA   A  LK AG   V I   +R++
Sbjct: 142 LRHAFYVSPVTYEHV-----MIVDDLLTTGSTANEMAHTLKNAGVKRVDICCCARAV 193


>gi|89899206|ref|YP_521677.1| ribose-phosphate pyrophosphokinase [Rhodoferax ferrireducens T118]
 gi|89343943|gb|ABD68146.1| ribose-phosphate pyrophosphokinase [Rhodoferax ferrireducens T118]
          Length = 328

 Score = 35.8 bits (81), Expect = 1.9,   Method: Composition-based stats.
 Identities = 16/38 (42%), Positives = 28/38 (73%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           V+  V G+++LL+DD+  +G T + AA+AL+++GA  V
Sbjct: 223 VAGEVDGMRVLLLDDLIASGETMRRAALALRQSGAREV 260


>gi|322377935|ref|ZP_08052423.1| putative competence protein ComF [Streptococcus sp. M334]
 gi|321281111|gb|EFX58123.1| putative competence protein ComF [Streptococcus sp. M334]
          Length = 220

 Score = 35.8 bits (81), Expect = 1.9,   Method: Composition-based stats.
 Identities = 18/37 (48%), Positives = 22/37 (59%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           KILLIDD+YTTG T       L++AGA  V   +  R
Sbjct: 184 KILLIDDIYTTGTTINRVKRLLEEAGAEDVKTFSLVR 220


>gi|318042623|ref|ZP_07974579.1| hypothetical protein SCB01_12995 [Synechococcus sp. CB0101]
          Length = 219

 Score = 35.8 bits (81), Expect = 1.9,   Method: Composition-based stats.
 Identities = 17/35 (48%), Positives = 23/35 (65%)

Query: 22  LIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           L+DD+ TTGATA  AA AL+ AG     +L  +R+
Sbjct: 179 LVDDILTTGATACSAAHALQAAGHAVQGVLALART 213


>gi|163814857|ref|ZP_02206245.1| hypothetical protein COPEUT_01007 [Coprococcus eutactus ATCC 27759]
 gi|158449796|gb|EDP26791.1| hypothetical protein COPEUT_01007 [Coprococcus eutactus ATCC 27759]
          Length = 191

 Score = 35.8 bits (81), Expect = 1.9,   Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 24/41 (58%), Gaps = 7/41 (17%)

Query: 8   PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           PQY +       IL++DD+YTTG T    A  LK+AGA  V
Sbjct: 147 PQYKN-------ILIVDDIYTTGVTIDVCASLLKEAGACNV 180


>gi|34499837|ref|NP_904052.1| competence protein F [Chromobacterium violaceum ATCC 12472]
 gi|34105687|gb|AAQ62041.1| competence protein F [Chromobacterium violaceum ATCC 12472]
          Length = 222

 Score = 35.8 bits (81), Expect = 1.9,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R+AF V     +   GL I ++DDV T+GAT    +  +KK GA  V     +R+ 
Sbjct: 166 VRHAFGV----KRRCDGLSIAIVDDVATSGATLSALSKMMKKQGAKRVDAWVLARAF 218


>gi|253680921|ref|ZP_04861724.1| competence protein F [Clostridium botulinum D str. 1873]
 gi|253562770|gb|EES92216.1| competence protein F [Clostridium botulinum D str. 1873]
          Length = 224

 Score = 35.8 bits (81), Expect = 1.9,   Method: Composition-based stats.
 Identities = 20/38 (52%), Positives = 25/38 (65%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           KILLIDDV TTGATA   +  +  +G   V ILT ++S
Sbjct: 185 KILLIDDVLTTGATAFFCSKEMVSSGCKEVIILTVAKS 222


>gi|283852706|ref|ZP_06369971.1| phosphoribosyltransferase [Desulfovibrio sp. FW1012B]
 gi|283571884|gb|EFC19879.1| phosphoribosyltransferase [Desulfovibrio sp. FW1012B]
          Length = 254

 Score = 35.8 bits (81), Expect = 1.9,   Method: Composition-based stats.
 Identities = 18/30 (60%), Positives = 21/30 (70%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAG 44
           VAG ++LL+DDV TTGAT   A  AL  AG
Sbjct: 214 VAGRRVLLVDDVMTTGATVDTAVRALLLAG 243


>gi|281492470|ref|YP_003354450.1| ribose-phosphate pyrophosphokinase [Lactococcus lactis subsp.
           lactis KF147]
 gi|281376134|gb|ADA65625.1| Ribose-phosphate pyrophosphokinase [Lactococcus lactis subsp.
           lactis KF147]
          Length = 321

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 26/39 (66%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           YV  +V+G K++LIDD+  TG T   AA  +++AGA  +
Sbjct: 209 YVIGNVSGKKVILIDDILNTGVTFANAANVVREAGASEI 247


>gi|77361761|ref|YP_341336.1| hypothetical protein PSHAa2858 [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76876672|emb|CAI87894.1| conserved protein of unknown function [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 225

 Score = 35.8 bits (81), Expect = 1.9,   Method: Composition-based stats.
 Identities = 17/38 (44%), Positives = 24/38 (63%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
           ++G  + ++DD+ TTGAT   A  ALK+AGA  V   T
Sbjct: 182 MSGKTVAIVDDIMTTGATLNAATQALKQAGAKQVWAFT 219


>gi|268682967|ref|ZP_06149829.1| competence protein [Neisseria gonorrhoeae PID332]
 gi|268623251|gb|EEZ55651.1| competence protein [Neisseria gonorrhoeae PID332]
          Length = 40

 Score = 35.8 bits (81), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 24/36 (66%)

Query: 21 LLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
          +LIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 1  MLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 36


>gi|188535340|ref|YP_001909137.1| Predicted amidophosphoribosyltransferase GntX [Erwinia tasmaniensis
           Et1/99]
 gi|188030382|emb|CAO98273.1| Predicted amidophosphoribosyltransferase GntX [Erwinia tasmaniensis
           Et1/99]
          Length = 237

 Score = 35.8 bits (81), Expect = 2.0,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF +       V G  I+L+DDV TTG+TA   +  L  +GA +V I    R+L
Sbjct: 185 LRGAFRL----ETAVRGYHIVLLDDVLTTGSTAAEISRILLASGAASVEIWCLCRTL 237


>gi|57238824|ref|YP_179960.1| putative competence protein F (DNA transformation protein comF)
           [Ehrlichia ruminantium str. Welgevonden]
 gi|58578754|ref|YP_196966.1| putative competence protein F (DNA transformation protein comF)
           [Ehrlichia ruminantium str. Welgevonden]
 gi|57160903|emb|CAH57808.1| putative competence protein F [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58417380|emb|CAI26584.1| Similar to competence protein F (DNA transformation protein comF)
           [Ehrlichia ruminantium str. Welgevonden]
          Length = 230

 Score = 35.8 bits (81), Expect = 2.0,   Method: Composition-based stats.
 Identities = 16/38 (42%), Positives = 25/38 (65%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ILL+DDV TTG T +  +  L ++GA  + ++T  R+L
Sbjct: 193 ILLVDDVVTTGITVRTCSQKLIESGAKEIRVITLGRTL 230


>gi|229020405|ref|ZP_04177160.1| ComF operon protein 3 [Bacillus cereus AH1273]
 gi|229026634|ref|ZP_04182976.1| ComF operon protein 3 [Bacillus cereus AH1272]
 gi|228734667|gb|EEL85319.1| ComF operon protein 3 [Bacillus cereus AH1272]
 gi|228740884|gb|EEL91127.1| ComF operon protein 3 [Bacillus cereus AH1273]
          Length = 149

 Score = 35.8 bits (81), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 22/37 (59%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +L++DDVYTTG T +     L   GA  VS LT  RS
Sbjct: 113 VLIVDDVYTTGITVRQIGSLLYGRGAREVSSLTLCRS 149


>gi|225420377|ref|ZP_03762680.1| hypothetical protein CLOSTASPAR_06722 [Clostridium asparagiforme
           DSM 15981]
 gi|225040996|gb|EEG51242.1| hypothetical protein CLOSTASPAR_06722 [Clostridium asparagiforme
           DSM 15981]
          Length = 240

 Score = 35.8 bits (81), Expect = 2.0,   Method: Composition-based stats.
 Identities = 17/37 (45%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 16  AGL-KILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51
           AGL  ++L+DD+YTTG+T +  +  LK+AG   V  L
Sbjct: 196 AGLTSVILVDDIYTTGSTVEACSRVLKRAGVSRVYFL 232


>gi|209519809|ref|ZP_03268594.1| putative competence protein F-related protein [Burkholderia sp.
           H160]
 gi|209499752|gb|EDZ99822.1| putative competence protein F-related protein [Burkholderia sp.
           H160]
          Length = 233

 Score = 35.8 bits (81), Expect = 2.0,   Method: Composition-based stats.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           V++ V GL + ++DDV T+GAT +  A  LK AGA  V+     R+ K+
Sbjct: 185 VARTVRGLHVGIVDDVMTSGATLEALAHTLKAAGARRVTNFVALRTPKN 233


>gi|304383729|ref|ZP_07366188.1| competence protein [Prevotella marshii DSM 16973]
 gi|304335253|gb|EFM01524.1| competence protein [Prevotella marshii DSM 16973]
          Length = 235

 Score = 35.8 bits (81), Expect = 2.0,   Method: Composition-based stats.
 Identities = 18/37 (48%), Positives = 24/37 (64%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51
           VAGL +L+IDD+ TTGAT       L+KA    +S+L
Sbjct: 192 VAGLHVLVIDDIVTTGATIVSCMHELRKAEGTRLSLL 228


>gi|289547848|ref|YP_003472836.1| amidophosphoribosyltransferase-like protein [Thermocrinis albus DSM
           14484]
 gi|289181465|gb|ADC88709.1| amidophosphoribosyltransferase-like protein [Thermocrinis albus DSM
           14484]
          Length = 214

 Score = 35.8 bits (81), Expect = 2.0,   Method: Composition-based stats.
 Identities = 18/45 (40%), Positives = 28/45 (62%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           ++++ +     V G +ILL+DD+ TTGAT+   A  L +AGA  V
Sbjct: 157 SYHLKENTKPFVEGKRILLVDDILTTGATSSKLAQLLYEAGAREV 201


>gi|238921501|ref|YP_002935016.1| hypothetical protein NT01EI_3653 [Edwardsiella ictaluri 93-146]
 gi|238871070|gb|ACR70781.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 226

 Score = 35.8 bits (81), Expect = 2.0,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF       + +AG ++LL+DDV TTG+T    +  L   G M+V  +   R+L
Sbjct: 174 LRGAFAA----HRALAGRRVLLVDDVITTGSTLSEISRLLIAQGVMSVETICLCRTL 226


>gi|149197780|ref|ZP_01874829.1| predicted amidophosphoribosyltransferase [Lentisphaera araneosa
           HTCC2155]
 gi|149139001|gb|EDM27405.1| predicted amidophosphoribosyltransferase [Lentisphaera araneosa
           HTCC2155]
          Length = 227

 Score = 35.8 bits (81), Expect = 2.0,   Method: Composition-based stats.
 Identities = 17/36 (47%), Positives = 23/36 (63%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ILLIDD+ TTGAT      AL++     +S+LT +R
Sbjct: 191 ILLIDDILTTGATLNACCKALQQEKPKEISVLTIAR 226


>gi|193214264|ref|YP_001995463.1| competence protein [Chloroherpeton thalassium ATCC 35110]
 gi|193087741|gb|ACF13016.1| competence protein [Chloroherpeton thalassium ATCC 35110]
          Length = 236

 Score = 35.8 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 24/32 (75%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
           +ILLIDDV+TTGAT    +  LKK GA+ ++I
Sbjct: 197 QILLIDDVFTTGATLVELSHELKKYGAIEITI 228


>gi|291326979|ref|ZP_06574150.1| competence protein F [Providencia rettgeri DSM 1131]
 gi|291312103|gb|EFE52556.1| competence protein F [Providencia rettgeri DSM 1131]
          Length = 152

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 26/43 (60%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           V+ L + +IDDV TTG+T   AA  L  AGA TV   +  R+L
Sbjct: 110 VSNLHVAVIDDVITTGSTMNAAAQLLICAGARTVDAWSLCRTL 152


>gi|158317692|ref|YP_001510200.1| ATP-dependent DNA helicase RecQ [Frankia sp. EAN1pec]
 gi|158113097|gb|ABW15294.1| ATP-dependent DNA helicase, RecQ family [Frankia sp. EAN1pec]
          Length = 749

 Score = 35.8 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 29/45 (64%), Gaps = 2/45 (4%)

Query: 3   NAFNVPQYVSKHVAGLK--ILLIDDVYTTGATAKCAAIALKKAGA 45
           +AF VP  ++  +A L   +LL+DD+  TG T   AA AL++AGA
Sbjct: 692 SAFEVPPPIAGPLAELTGPVLLVDDLIVTGWTMTVAARALRQAGA 736


>gi|311070051|ref|YP_003974974.1| putative component of the DNA transport apparatus [Bacillus
           atrophaeus 1942]
 gi|310870568|gb|ADP34043.1| putative component of the DNA transport apparatus [Bacillus
           atrophaeus 1942]
          Length = 225

 Score = 35.8 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 21/43 (48%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 15  VAGLKILLIDDVYTTGATAKCAA-IALKKAGAMTVSILTFSRS 56
           V  + ++LIDD+YTTGAT   AA   L+K  A +VS  T  RS
Sbjct: 183 VEDMDVILIDDLYTTGATLHHAARCLLEKGKAGSVSSFTLIRS 225


>gi|217967794|ref|YP_002353300.1| hypothetical protein Dtur_1412 [Dictyoglomus turgidum DSM 6724]
 gi|217336893|gb|ACK42686.1| conserved hypothetical protein [Dictyoglomus turgidum DSM 6724]
          Length = 231

 Score = 35.8 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 26/58 (44%), Positives = 33/58 (56%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAM-TVSILTFSRSL 57
           M NAF V +  ++ + G  ILL+DDVYTTG T K     LKK+  +  V I T  R L
Sbjct: 176 MMNAFGVIE--NREING-NILLVDDVYTTGTTLKECTRTLKKSFNLDKVYIFTAVRVL 230


>gi|261409648|ref|YP_003245889.1| amidophosphoribosyltransferase-like protein [Paenibacillus sp.
           Y412MC10]
 gi|261286111|gb|ACX68082.1| amidophosphoribosyltransferase-like protein [Paenibacillus sp.
           Y412MC10]
          Length = 274

 Score = 35.8 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 7/62 (11%)

Query: 2   RNAFNV--PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGA---MTVSI--LTFS 54
           R A N+  P+ +   +  L+ILL+DD+YTTG+T    A  L+   +   M + I  LT++
Sbjct: 213 RGAANIGSPEEILPIIGPLRILLVDDIYTTGSTINACAQVLRGYESFLEMPIEIHSLTWA 272

Query: 55  RS 56
           RS
Sbjct: 273 RS 274


>gi|193211907|ref|YP_001997860.1| phosphoribosyltransferase [Chlorobaculum parvum NCIB 8327]
 gi|193085384|gb|ACF10660.1| phosphoribosyltransferase [Chlorobaculum parvum NCIB 8327]
          Length = 262

 Score = 35.8 bits (81), Expect = 2.2,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 26/42 (61%)

Query: 8   PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVS 49
           P   + H    +++L+DDV TTGAT   AA ALK+AG   V+
Sbjct: 210 PVTRNSHRISGRVVLVDDVLTTGATMVAAASALKEAGVDEVA 251


>gi|317503619|ref|ZP_07961639.1| conserved hypothetical protein [Prevotella salivae DSM 15606]
 gi|315665280|gb|EFV04927.1| conserved hypothetical protein [Prevotella salivae DSM 15606]
          Length = 200

 Score = 35.8 bits (81), Expect = 2.2,   Method: Composition-based stats.
 Identities = 18/43 (41%), Positives = 28/43 (65%)

Query: 16  AGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           AG K+++ DD+ TTG TA+  A  L++AGA     L  ++S+K
Sbjct: 133 AGRKVIIFDDLVTTGTTAEHFAALLQEAGAEVKGALFIAKSVK 175


>gi|289435773|ref|YP_003465645.1| comFC family protein [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289172017|emb|CBH28563.1| comFC family protein [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
          Length = 217

 Score = 35.8 bits (81), Expect = 2.2,   Method: Composition-based stats.
 Identities = 16/37 (43%), Positives = 25/37 (67%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +++L DD+YTTG+T   AA  LK++G   V+ +T  R
Sbjct: 181 ELILFDDIYTTGSTLNLAAQKLKESGIKKVTSVTLFR 217


>gi|152997461|ref|YP_001342296.1| K+-dependent Na+/Ca+ exchanger related-protein [Marinomonas sp.
           MWYL1]
 gi|150838385|gb|ABR72361.1| K+-dependent Na+/Ca+ exchanger related-protein [Marinomonas sp.
           MWYL1]
          Length = 250

 Score = 35.8 bits (81), Expect = 2.2,   Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 5/55 (9%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           R+++ +   ++KHVA     L DDV TTG+T +     L KAGA  V I   +R+
Sbjct: 194 RSSYQLDGPIAKHVA-----LFDDVMTTGSTIENCTKLLLKAGAERVDIWVIART 243


>gi|258512527|ref|YP_003185961.1| ComF family protein [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|257479253|gb|ACV59572.1| ComF family protein [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 245

 Score = 35.8 bits (81), Expect = 2.3,   Method: Composition-based stats.
 Identities = 19/39 (48%), Positives = 24/39 (61%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           G ++LL+DDV TTGAT    A AL  AGA  V  +  +R
Sbjct: 205 GRRVLLVDDVMTTGATLATCAQALYGAGARAVHAVVIAR 243


>gi|309789992|ref|ZP_07684568.1| amidophosphoribosyltransferase-like protein [Oscillochloris
           trichoides DG6]
 gi|308228012|gb|EFO81664.1| amidophosphoribosyltransferase-like protein [Oscillochloris
           trichoides DG6]
          Length = 212

 Score = 35.4 bits (80), Expect = 2.3,   Method: Composition-based stats.
 Identities = 17/39 (43%), Positives = 23/39 (58%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++LL+DDV TTGAT      AL+  G   V  +  +RSL
Sbjct: 166 RVLLVDDVLTTGATLVACGDALRAVGTQEVRAVALARSL 204


>gi|187251191|ref|YP_001875673.1| adenine phosphoribosyltransferase [Elusimicrobium minutum Pei191]
 gi|186971351|gb|ACC98336.1| Adenine phosphoribosyltransferase [Elusimicrobium minutum Pei191]
          Length = 172

 Score = 35.4 bits (80), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 22/32 (68%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
           KILLIDDV  TG TA+ A   +KK+GA  + I
Sbjct: 115 KILLIDDVLATGGTAEAAVKLIKKSGAELIGI 146


>gi|119489385|ref|ZP_01622165.1| hypothetical protein L8106_02477 [Lyngbya sp. PCC 8106]
 gi|119454658|gb|EAW35804.1| hypothetical protein L8106_02477 [Lyngbya sp. PCC 8106]
          Length = 228

 Score = 35.4 bits (80), Expect = 2.3,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 35/61 (57%), Gaps = 3/61 (4%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF--SRSLK 58
           +++AF + + + +  A   +L++DD+YTTGAT K A  A ++       IL    ++SL 
Sbjct: 168 LKDAFRLGKDLRQSQAN-SVLIVDDIYTTGATIKAAIEAFRQQKITVAGILAIATTKSLS 226

Query: 59  D 59
           D
Sbjct: 227 D 227


>gi|283787952|ref|YP_003367817.1| competence protein [Citrobacter rodentium ICC168]
 gi|282951406|emb|CBG91105.1| putative competence protein [Citrobacter rodentium ICC168]
          Length = 227

 Score = 35.4 bits (80), Expect = 2.3,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL + ++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVRGLHMAIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|319647947|ref|ZP_08002165.1| ComFC protein [Bacillus sp. BT1B_CT2]
 gi|317390288|gb|EFV71097.1| ComFC protein [Bacillus sp. BT1B_CT2]
          Length = 144

 Score = 35.4 bits (80), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAG-AMTVSILTFSRS 56
           V  L ++LIDD+YTTGAT   AA  L  +G A +VS  T  RS
Sbjct: 102 VKNLDVILIDDLYTTGATLHHAADCLMTSGEAKSVSSYTLIRS 144


>gi|326318590|ref|YP_004236262.1| phosphoribosyltransferase [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|323375426|gb|ADX47695.1| phosphoribosyltransferase [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 238

 Score = 35.4 bits (80), Expect = 2.3,   Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 25/38 (65%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +I+L+DDV TTGAT   AA  L +AGA  V  +  +R+
Sbjct: 200 RIVLVDDVMTTGATLHAAAHVLLQAGASRVDAVVLART 237


>gi|319789682|ref|YP_004151315.1| phosphoribosyltransferase [Thermovibrio ammonificans HB-1]
 gi|317114184|gb|ADU96674.1| phosphoribosyltransferase [Thermovibrio ammonificans HB-1]
          Length = 236

 Score = 35.4 bits (80), Expect = 2.4,   Method: Composition-based stats.
 Identities = 17/33 (51%), Positives = 23/33 (69%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
           +L+IDDV+TTG+TA   A  LK+ GA  V + T
Sbjct: 195 VLVIDDVFTTGSTANEVARVLKEGGAERVFVYT 227


>gi|159028504|emb|CAO87311.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 215

 Score = 35.4 bits (80), Expect = 2.4,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           M+ AF + + + K V    ILLIDD+YTTG T + A   L+  G   V  +  + S
Sbjct: 160 MQAAFQLGKNLPKSVP---ILLIDDIYTTGTTIEEAVQVLRTEGYRVVGAIALASS 212


>gi|58616813|ref|YP_196012.1| putative competence protein F (DNA transformation protein comF)
           [Ehrlichia ruminantium str. Gardel]
 gi|58416425|emb|CAI27538.1| Similar to competence protein F (DNA transformation protein comF)
           [Ehrlichia ruminantium str. Gardel]
          Length = 230

 Score = 35.4 bits (80), Expect = 2.4,   Method: Composition-based stats.
 Identities = 16/38 (42%), Positives = 25/38 (65%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ILL+DDV TTG T +  +  L ++GA  + ++T  R+L
Sbjct: 193 ILLVDDVVTTGITVRTCSQKLIESGAKEIRVITLGRTL 230


>gi|119475124|ref|ZP_01615477.1| competence protein ComF, putative [marine gamma proteobacterium
           HTCC2143]
 gi|119451327|gb|EAW32560.1| competence protein ComF, putative [marine gamma proteobacterium
           HTCC2143]
          Length = 243

 Score = 35.4 bits (80), Expect = 2.4,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           M+ AF +       VAG  + ++DDV TTG T   A+  L KAGA  V I   +R+
Sbjct: 191 MKGAFQM----CGDVAGKLVAVVDDVMTTGTTVSEASQCLLKAGATEVHIWCLART 242


>gi|332654118|ref|ZP_08419862.1| putative competence protein ComF [Ruminococcaceae bacterium D16]
 gi|332517204|gb|EGJ46809.1| putative competence protein ComF [Ruminococcaceae bacterium D16]
          Length = 219

 Score = 35.4 bits (80), Expect = 2.4,   Method: Composition-based stats.
 Identities = 18/43 (41%), Positives = 27/43 (62%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           G+ +LL+DDV T+G+T    A  L  AGA TV   T +++ K+
Sbjct: 177 GMNLLLVDDVVTSGSTLSECARLLSGAGAETVVCATLAQARKN 219


>gi|306823060|ref|ZP_07456436.1| conserved hypothetical protein [Bifidobacterium dentium ATCC 27679]
 gi|309801325|ref|ZP_07695454.1| phosphoribosyl transferase domain protein [Bifidobacterium dentium
           JCVIHMP022]
 gi|304553692|gb|EFM41603.1| conserved hypothetical protein [Bifidobacterium dentium ATCC 27679]
 gi|308222214|gb|EFO78497.1| phosphoribosyl transferase domain protein [Bifidobacterium dentium
           JCVIHMP022]
          Length = 252

 Score = 35.4 bits (80), Expect = 2.4,   Method: Composition-based stats.
 Identities = 15/40 (37%), Positives = 26/40 (65%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           V G+ ++LIDD+ T+G T +     L++AGA  V++L  +
Sbjct: 195 VRGVPVVLIDDIITSGTTMRRCVEVLQQAGATVVTVLALA 234


>gi|283455804|ref|YP_003360368.1| hypothetical protein BDP_0890 [Bifidobacterium dentium Bd1]
 gi|283102438|gb|ADB09544.1| Conserved hypothetical protein [Bifidobacterium dentium Bd1]
          Length = 239

 Score = 35.4 bits (80), Expect = 2.4,   Method: Composition-based stats.
 Identities = 15/40 (37%), Positives = 26/40 (65%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           V G+ ++LIDD+ T+G T +     L++AGA  V++L  +
Sbjct: 182 VRGVPVVLIDDIITSGTTMRRCVEVLQQAGATVVTVLALA 221


>gi|255654224|ref|ZP_05399633.1| putative phosphoribosyl transferase (putative competence protein)
           [Clostridium difficile QCD-23m63]
 gi|296452508|ref|ZP_06894205.1| ComF family protein [Clostridium difficile NAP08]
 gi|296881080|ref|ZP_06905023.1| ComF family protein [Clostridium difficile NAP07]
 gi|296258613|gb|EFH05511.1| ComF family protein [Clostridium difficile NAP08]
 gi|296427946|gb|EFH13850.1| ComF family protein [Clostridium difficile NAP07]
          Length = 260

 Score = 35.4 bits (80), Expect = 2.4,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++N F V + + K +    ILLIDD++TTG T    +  LK +GA  V +LT      D
Sbjct: 198 LKNVFVVKENI-KLINNKNILLIDDIFTTGLTTNEISKLLKLSGANKVFVLTLLTKAND 255


>gi|171743215|ref|ZP_02919022.1| hypothetical protein BIFDEN_02343 [Bifidobacterium dentium ATCC
           27678]
 gi|171278829|gb|EDT46490.1| hypothetical protein BIFDEN_02343 [Bifidobacterium dentium ATCC
           27678]
          Length = 252

 Score = 35.4 bits (80), Expect = 2.4,   Method: Composition-based stats.
 Identities = 15/40 (37%), Positives = 26/40 (65%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           V G+ ++LIDD+ T+G T +     L++AGA  V++L  +
Sbjct: 195 VRGVPVVLIDDIITSGTTMRRCVEVLQQAGATVVTVLALA 234


>gi|86136799|ref|ZP_01055377.1| competence protein F, putative [Roseobacter sp. MED193]
 gi|85826123|gb|EAQ46320.1| competence protein F, putative [Roseobacter sp. MED193]
          Length = 242

 Score = 35.4 bits (80), Expect = 2.4,   Method: Composition-based stats.
 Identities = 17/39 (43%), Positives = 24/39 (61%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           G  +LL+DDV T+GAT    A A ++AGA  V +   +R
Sbjct: 200 GRVVLLVDDVMTSGATLTACADACREAGAADVRVAVLAR 238


>gi|317487364|ref|ZP_07946155.1| comF family protein [Bilophila wadsworthia 3_1_6]
 gi|316921387|gb|EFV42682.1| comF family protein [Bilophila wadsworthia 3_1_6]
          Length = 281

 Score = 35.4 bits (80), Expect = 2.4,   Method: Composition-based stats.
 Identities = 16/26 (61%), Positives = 20/26 (76%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIAL 40
           V G +ILL+DD YTTG T + AA+AL
Sbjct: 216 VRGKRILLVDDTYTTGTTLRRAALAL 241


>gi|291009677|ref|ZP_06567650.1| hypothetical protein SeryN2_34610 [Saccharopolyspora erythraea NRRL
           2338]
          Length = 166

 Score = 35.4 bits (80), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 28/47 (59%)

Query: 8   PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           P+ + +   G++ +L+DDV T+GATA     AL  +G    ++LT +
Sbjct: 91  PETLRRRGDGVRTVLVDDVMTSGATAASCLRALDSSGMAVDAVLTLT 137


>gi|282882069|ref|ZP_06290710.1| orotate phosphoribosyltransferase [Peptoniphilus lacrimalis 315-B]
 gi|281298099|gb|EFA90554.1| orotate phosphoribosyltransferase [Peptoniphilus lacrimalis 315-B]
          Length = 208

 Score = 35.4 bits (80), Expect = 2.4,   Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 35/51 (68%), Gaps = 1/51 (1%)

Query: 9   QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT-FSRSLK 58
           Q   K V G K L+I+D+++TG ++  AA+ALK++G   + I++ F+ +LK
Sbjct: 104 QIEGKIVKGAKTLVIEDLFSTGKSSIDAALALKESGFDVIGIVSIFTYNLK 154


>gi|218135319|ref|ZP_03464123.1| hypothetical protein BACPEC_03224 [Bacteroides pectinophilus ATCC
           43243]
 gi|217990704|gb|EEC56715.1| hypothetical protein BACPEC_03224 [Bacteroides pectinophilus ATCC
           43243]
          Length = 173

 Score = 35.4 bits (80), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           + NAF + + V ++    K++++DD+YTTGAT    A AL + G   V
Sbjct: 118 LENAFIITENVVRY---KKVIILDDIYTTGATMDACAKALHEGGVHEV 162


>gi|254448931|ref|ZP_05062386.1| ComF family protein [gamma proteobacterium HTCC5015]
 gi|198261468|gb|EDY85758.1| ComF family protein [gamma proteobacterium HTCC5015]
          Length = 249

 Score = 35.4 bits (80), Expect = 2.4,   Method: Composition-based stats.
 Identities = 22/54 (40%), Positives = 34/54 (62%), Gaps = 6/54 (11%)

Query: 4   AFNVPQYV-SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           AF+V + V  KH     ++L+DDV T+GAT +  + AL KAGA +V +   +R+
Sbjct: 194 AFSVVEDVRDKH-----LVLVDDVMTSGATLEALSDALLKAGAASVRLAVLART 242


>gi|225376976|ref|ZP_03754197.1| hypothetical protein ROSEINA2194_02618 [Roseburia inulinivorans DSM
           16841]
 gi|225211297|gb|EEG93651.1| hypothetical protein ROSEINA2194_02618 [Roseburia inulinivorans DSM
           16841]
          Length = 247

 Score = 35.4 bits (80), Expect = 2.4,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF   Q V   V   KIL++DD+YTTG+T    A  L +AG   +  L  S
Sbjct: 192 LKKAF---QLVPNIVKYRKILIVDDIYTTGSTIDAVAEVLLQAGVDEIYFLCIS 242


>gi|71279715|ref|YP_266985.1| competence protein,-like protein [Colwellia psychrerythraea 34H]
 gi|71145455|gb|AAZ25928.1| competence protein, homolog [Colwellia psychrerythraea 34H]
          Length = 273

 Score = 35.4 bits (80), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
           NAF + + +  H+    +L++DDV TTG T    +  LK+AG  TV+++T
Sbjct: 210 NAFALQRKLGSHIK--HVLIVDDVVTTGTTVSEISKLLKQAGVETVTLVT 257


>gi|299142823|ref|ZP_07035951.1| ribose phosphate pyrophosphokinase [Prevotella oris C735]
 gi|298575691|gb|EFI47569.1| ribose phosphate pyrophosphokinase [Prevotella oris C735]
          Length = 198

 Score = 35.4 bits (80), Expect = 2.5,   Method: Composition-based stats.
 Identities = 18/43 (41%), Positives = 28/43 (65%)

Query: 16  AGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           AG K+++ DD+ TTG TA+  A  L++AGA     L  ++S+K
Sbjct: 131 AGRKVIIFDDLVTTGTTAEHFAALLQEAGAEVKGALFIAKSVK 173


>gi|83648031|ref|YP_436466.1| amidophosphoribosyltransferase [Hahella chejuensis KCTC 2396]
 gi|83636074|gb|ABC32041.1| predicted amidophosphoribosyltransferase [Hahella chejuensis KCTC
           2396]
          Length = 244

 Score = 35.4 bits (80), Expect = 2.5,   Method: Composition-based stats.
 Identities = 17/40 (42%), Positives = 26/40 (65%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +++IDDV TTG+T    A  LK+AGA+ V + + +R   D
Sbjct: 205 LIIIDDVVTTGSTVDELARTLKQAGALEVYVFSIARRSMD 244


>gi|295398530|ref|ZP_06808564.1| superfamily II DNA/RNA helicase ComFC [Aerococcus viridans ATCC
           11563]
 gi|294973253|gb|EFG49046.1| superfamily II DNA/RNA helicase ComFC [Aerococcus viridans ATCC
           11563]
          Length = 255

 Score = 35.4 bits (80), Expect = 2.5,   Method: Composition-based stats.
 Identities = 19/36 (52%), Positives = 23/36 (63%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           I+L DDVYTTG T   A  AL+ AG   +S LT +R
Sbjct: 220 IVLFDDVYTTGTTMFSAYKALELAGFSQISGLTLAR 255


>gi|257870895|ref|ZP_05650548.1| ribose-phosphate pyrophosphokinase [Enterococcus gallinarum EG2]
 gi|257805059|gb|EEV33881.1| ribose-phosphate pyrophosphokinase [Enterococcus gallinarum EG2]
          Length = 325

 Score = 35.4 bits (80), Expect = 2.5,   Method: Composition-based stats.
 Identities = 19/39 (48%), Positives = 24/39 (61%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           YV   VAG K +L+DD+  TG T   AA  LK+AGA  +
Sbjct: 211 YVIGDVAGKKCILVDDILNTGKTLSKAADLLKEAGASEI 249


>gi|260906466|ref|ZP_05914788.1| ATP-dependent DNA helicase [Brevibacterium linens BL2]
          Length = 707

 Score = 35.4 bits (80), Expect = 2.5,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           + +AF VP  V + VAG  +LL+DD   +  T    A  L++AGA   ++L F+ +L+
Sbjct: 651 LYDAFVVPPEVEEAVAGKAVLLVDDEVVSRWTMAIGARLLRQAGA--TAVLPFALALR 706


>gi|289423614|ref|ZP_06425414.1| phosphoribosyltransferase [Peptostreptococcus anaerobius 653-L]
 gi|289155982|gb|EFD04647.1| phosphoribosyltransferase [Peptostreptococcus anaerobius 653-L]
          Length = 273

 Score = 35.4 bits (80), Expect = 2.6,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 30/53 (56%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           +R  F V    +K++    + ++DD++TTG+T    A  LK +GA  V  LTF
Sbjct: 207 LRGVFKVQDDYTKYLEDRVVAVVDDIFTTGSTLNEIAKVLKLSGAKEVIGLTF 259


>gi|184154807|ref|YP_001843147.1| hypothetical protein LAF_0331 [Lactobacillus fermentum IFO 3956]
 gi|260663165|ref|ZP_05864057.1| competence protein [Lactobacillus fermentum 28-3-CHN]
 gi|183226151|dbj|BAG26667.1| conserved hypothetical protein [Lactobacillus fermentum IFO 3956]
 gi|260552357|gb|EEX25408.1| competence protein [Lactobacillus fermentum 28-3-CHN]
          Length = 224

 Score = 35.4 bits (80), Expect = 2.6,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 26/42 (61%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           K V G  ++L+DDV+TTG T   AA  ++ AG  T+  +T +
Sbjct: 182 KRVRGKTVVLVDDVFTTGRTMYHAAQLMRAAGCKTICGVTLA 223


>gi|120437851|ref|YP_863537.1| phosphoribosyltransferases family protein [Gramella forsetii
           KT0803]
 gi|117580001|emb|CAL68470.1| phosphoribosyltransferases family protein [Gramella forsetii
           KT0803]
          Length = 226

 Score = 35.4 bits (80), Expect = 2.7,   Method: Composition-based stats.
 Identities = 17/43 (39%), Positives = 27/43 (62%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           S+ + G  ILL+DD+ TTGAT +   + L +A  + +SI T +
Sbjct: 181 SEKIRGKHILLVDDLVTTGATLEACVLKLYEAQEVEISIATMA 223


>gi|237802414|ref|ZP_04590875.1| competence protein ComF [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331025271|gb|EGI05327.1| competence protein ComF [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 245

 Score = 35.4 bits (80), Expect = 2.7,   Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 27/46 (58%), Gaps = 5/46 (10%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           KH+A     L+DDV TTG+TA+  A  L  AGA  V +   +R+ K
Sbjct: 201 KHLA-----LVDDVLTTGSTAEVIARLLNDAGARRVDVYCLARTPK 241


>gi|281491588|ref|YP_003353568.1| COMF operon competence protein 3 [Lactococcus lactis subsp. lactis
           KF147]
 gi|281375306|gb|ADA64819.1| COMF operon competence protein 3 [Lactococcus lactis subsp. lactis
           KF147]
          Length = 216

 Score = 35.4 bits (80), Expect = 2.7,   Method: Composition-based stats.
 Identities = 16/37 (43%), Positives = 23/37 (62%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           K++LIDD+YTTG T   A+  LK+AG   +   +  R
Sbjct: 180 KVILIDDIYTTGTTLYHASQILKEAGVHEIRSFSLCR 216


>gi|15673071|ref|NP_267245.1| hypothetical protein L0319 [Lactococcus lactis subsp. lactis
           Il1403]
 gi|12724045|gb|AAK05187.1|AE006341_6 competence protein ComFC [Lactococcus lactis subsp. lactis Il1403]
 gi|326406639|gb|ADZ63710.1| competence protein ComFC [Lactococcus lactis subsp. lactis CV56]
          Length = 216

 Score = 35.4 bits (80), Expect = 2.7,   Method: Composition-based stats.
 Identities = 16/37 (43%), Positives = 23/37 (62%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           K++LIDD+YTTG T   A+  LK+AG   +   +  R
Sbjct: 180 KVILIDDIYTTGTTLYHASQILKEAGVHEIRSFSLCR 216


>gi|262382451|ref|ZP_06075588.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B]
 gi|262295329|gb|EEY83260.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B]
          Length = 229

 Score = 35.4 bits (80), Expect = 2.7,   Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 21/35 (60%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ILLIDDV TTGAT    A AL     + +SIL  S
Sbjct: 193 ILLIDDVITTGATISACAKALSGIPGIRISILALS 227


>gi|256839097|ref|ZP_05544607.1| conserved hypothetical protein [Parabacteroides sp. D13]
 gi|256740016|gb|EEU53340.1| conserved hypothetical protein [Parabacteroides sp. D13]
          Length = 229

 Score = 35.4 bits (80), Expect = 2.7,   Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 21/35 (60%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ILLIDDV TTGAT    A AL     + +SIL  S
Sbjct: 193 ILLIDDVITTGATISACAKALSGIPGIRISILALS 227


>gi|150010263|ref|YP_001305006.1| putative amidophosphoribosyl-transferase [Parabacteroides
           distasonis ATCC 8503]
 gi|255012468|ref|ZP_05284594.1| putative amidophosphoribosyl-transferase [Bacteroides sp. 2_1_7]
 gi|298374642|ref|ZP_06984600.1| competence protein F-related protein [Bacteroides sp. 3_1_19]
 gi|149938687|gb|ABR45384.1| putative amidophosphoribosyl-transferase [Parabacteroides
           distasonis ATCC 8503]
 gi|298269010|gb|EFI10665.1| competence protein F-related protein [Bacteroides sp. 3_1_19]
          Length = 229

 Score = 35.4 bits (80), Expect = 2.7,   Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 21/35 (60%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ILLIDDV TTGAT    A AL     + +SIL  S
Sbjct: 193 ILLIDDVITTGATISACAKALSGIPGIRISILALS 227


>gi|313896725|ref|ZP_07830273.1| comF family protein [Selenomonas sp. oral taxon 137 str. F0430]
 gi|312974642|gb|EFR40109.1| comF family protein [Selenomonas sp. oral taxon 137 str. F0430]
          Length = 216

 Score = 35.4 bits (80), Expect = 2.8,   Method: Composition-based stats.
 Identities = 18/41 (43%), Positives = 24/41 (58%)

Query: 14  HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
            +AG  ILL+DD+ TTG T    A  LK+AGA  +  L  +
Sbjct: 172 QIAGRHILLLDDIMTTGTTLLECARTLKRAGAENIYALVLA 212


>gi|295675361|ref|YP_003603885.1| phosphoribosyltransferase [Burkholderia sp. CCGE1002]
 gi|295435204|gb|ADG14374.1| phosphoribosyltransferase [Burkholderia sp. CCGE1002]
          Length = 261

 Score = 35.4 bits (80), Expect = 2.9,   Method: Composition-based stats.
 Identities = 19/49 (38%), Positives = 30/49 (61%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +++ V GL + ++DDV T+GAT +  A  LK AGA  V+     R+ K+
Sbjct: 213 IARPVRGLHVGIVDDVMTSGATLEALAHTLKAAGARRVTNFVALRTPKN 261


>gi|27375320|ref|NP_766849.1| competence protein F [Bradyrhizobium japonicum USDA 110]
 gi|27348456|dbj|BAC45474.1| competence protein F [Bradyrhizobium japonicum USDA 110]
          Length = 265

 Score = 35.4 bits (80), Expect = 2.9,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 32/55 (58%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++ AF V       V G +I+LIDDV T+GAT    A AL +A A  V +L F+R
Sbjct: 206 VQGAFQVSPDRQAEVQGRRIVLIDDVLTSGATLDACARALLRAKAAQVDVLVFAR 260


>gi|315143343|gb|EFT87359.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX2141]
          Length = 338

 Score = 35.4 bits (80), Expect = 2.9,   Method: Composition-based stats.
 Identities = 20/43 (46%), Positives = 24/43 (55%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
           YV  +VAG K +L+DD+  TG T   AA  L K GA  V   T
Sbjct: 225 YVIGNVAGKKCILVDDILNTGQTLATAAEVLMKNGAQEVYACT 267


>gi|260400852|gb|ACX37012.1| adenine phosphoribosyltransferase [Nonomuraea sp. ATCC 39727]
          Length = 99

 Score = 35.4 bits (80), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (67%)

Query: 17 GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
          G ++L++DDV  TG TAK A   +++AGA  V I
Sbjct: 40 GDRVLIVDDVLATGGTAKAAVELVERAGAEVVGI 73


>gi|229135999|ref|ZP_04264759.1| ComF operon protein 3 [Bacillus cereus BDRD-ST196]
 gi|228647457|gb|EEL03532.1| ComF operon protein 3 [Bacillus cereus BDRD-ST196]
          Length = 149

 Score = 35.4 bits (80), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +L++DDVYTTG T +     L   GA  VS LT  R
Sbjct: 113 VLIVDDVYTTGITVRQIGSLLYDRGAREVSCLTLCR 148


>gi|229169900|ref|ZP_04297596.1| ComF operon protein 3 [Bacillus cereus AH621]
 gi|228613614|gb|EEK70743.1| ComF operon protein 3 [Bacillus cereus AH621]
          Length = 149

 Score = 35.4 bits (80), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +L++DDVYTTG T +     L   GA  VS LT  R
Sbjct: 113 VLIVDDVYTTGITVRQIGSLLYDRGAREVSCLTLCR 148


>gi|126433987|ref|YP_001069678.1| hypothetical protein Mjls_1385 [Mycobacterium sp. JLS]
 gi|126233787|gb|ABN97187.1| conserved hypothetical protein [Mycobacterium sp. JLS]
          Length = 204

 Score = 35.0 bits (79), Expect = 3.0,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           RN  N  + V + VAG  ++L+DD+ TTGATA  +   L+ AGA  +++LT + +
Sbjct: 152 RNVANRIRLV-RPVAG-SVVLVDDIITTGATATESVRVLQTAGAGVLAVLTLANA 204


>gi|83953111|ref|ZP_00961833.1| Competence protein F [Sulfitobacter sp. NAS-14.1]
 gi|83842079|gb|EAP81247.1| Competence protein F [Sulfitobacter sp. NAS-14.1]
          Length = 219

 Score = 35.0 bits (79), Expect = 3.0,   Method: Composition-based stats.
 Identities = 17/40 (42%), Positives = 26/40 (65%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +LL+DDV T+GAT + +A A   A A  + ++T +R  KD
Sbjct: 179 VLLVDDVMTSGATLQASARACLDARAGPICVVTLARVAKD 218


>gi|166367873|ref|YP_001660146.1| hypothetical protein MAE_51320 [Microcystis aeruginosa NIES-843]
 gi|166090246|dbj|BAG04954.1| hypothetical protein MAE_51320 [Microcystis aeruginosa NIES-843]
          Length = 215

 Score = 35.0 bits (79), Expect = 3.0,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           M+ AF + + + K V    ILLIDD+YTTG T + A   L+  G   V  +  + S
Sbjct: 160 MQAAFQLGKNLPKSVP---ILLIDDIYTTGTTIEEAVQVLQTEGYRVVGAIALASS 212


>gi|330994801|ref|ZP_08318723.1| Protein gntX [Gluconacetobacter sp. SXCC-1]
 gi|329758062|gb|EGG74584.1| Protein gntX [Gluconacetobacter sp. SXCC-1]
          Length = 236

 Score = 35.0 bits (79), Expect = 3.1,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 29/56 (51%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           M  A  V  +    + G  ++++DDV TTGAT      AL  AGA  V +L  +R+
Sbjct: 174 MHGAVGVRAHRQAAIQGRHMIVVDDVMTTGATLAACTRALLAAGAGRVDVLAAARA 229


>gi|254884238|ref|ZP_05256948.1| predicted protein [Bacteroides sp. 4_3_47FAA]
 gi|254837031|gb|EET17340.1| predicted protein [Bacteroides sp. 4_3_47FAA]
          Length = 269

 Score = 35.0 bits (79), Expect = 3.1,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 30/48 (62%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++  + G K+++IDDV TTG++ K  A  L K G   V ++  ++++K
Sbjct: 208 INADIVGKKVVIIDDVITTGSSIKEHAEELGKYGVEVVGVVCLAKTVK 255


>gi|326798557|ref|YP_004316376.1| phosphoribosyltransferase [Sphingobacterium sp. 21]
 gi|326549321|gb|ADZ77706.1| phosphoribosyltransferase [Sphingobacterium sp. 21]
          Length = 228

 Score = 35.0 bits (79), Expect = 3.1,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 8/57 (14%)

Query: 1   MRNAFNV--PQ-YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           M+  F V  PQ +  KH     ILL+DDV TTGAT +  A  L +   + VS++T +
Sbjct: 174 MKEIFEVLKPQTFQDKH-----ILLVDDVLTTGATIEACAYKLLEIAGVRVSVVTLA 225


>gi|307277739|ref|ZP_07558825.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX0860]
 gi|306505618|gb|EFM74802.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX0860]
          Length = 338

 Score = 35.0 bits (79), Expect = 3.1,   Method: Composition-based stats.
 Identities = 19/39 (48%), Positives = 23/39 (58%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           YV  +VAG K +L+DD+  TG T   AA  L K GA  V
Sbjct: 225 YVIGNVAGKKCILVDDILNTGQTLATAAEVLMKNGAQEV 263


>gi|312135429|ref|YP_004002767.1| phosphoribosyltransferase [Caldicellulosiruptor owensensis OL]
 gi|311775480|gb|ADQ04967.1| phosphoribosyltransferase [Caldicellulosiruptor owensensis OL]
          Length = 231

 Score = 35.0 bits (79), Expect = 3.1,   Method: Composition-based stats.
 Identities = 17/43 (39%), Positives = 30/43 (69%), Gaps = 2/43 (4%)

Query: 15  VAGLKILLIDDVYTTGATA-KCAAIALKK-AGAMTVSILTFSR 55
           + G KI+L+DD++TTGAT  +C+ + L+  A  + VS+L  ++
Sbjct: 186 IKGKKIILVDDIFTTGATTNECSKVLLENGAKCVFVSVLAITK 228


>gi|294638122|ref|ZP_06716378.1| competence protein F [Edwardsiella tarda ATCC 23685]
 gi|291088689|gb|EFE21250.1| competence protein F [Edwardsiella tarda ATCC 23685]
          Length = 226

 Score = 35.0 bits (79), Expect = 3.1,   Method: Composition-based stats.
 Identities = 16/43 (37%), Positives = 26/43 (60%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           + G ++LL+DDV TTG+T    +  L   G M+V ++   R+L
Sbjct: 184 LTGRRVLLVDDVVTTGSTLSEISQRLIAQGVMSVEVICLCRTL 226


>gi|257066252|ref|YP_003152508.1| hypothetical protein Apre_0759 [Anaerococcus prevotii DSM 20548]
 gi|256798132|gb|ACV28787.1| conserved hypothetical protein [Anaerococcus prevotii DSM 20548]
          Length = 208

 Score = 35.0 bits (79), Expect = 3.1,   Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 27/51 (52%), Gaps = 4/51 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51
           +R AF +     K + G KILLIDD+ TTG TA      LK  GA  V  L
Sbjct: 153 LRGAFRL----DKEIKGSKILLIDDLITTGNTALETIKELKNRGASEVVTL 199


>gi|302336211|ref|YP_003801418.1| phosphoribosyltransferase [Olsenella uli DSM 7084]
 gi|301320051|gb|ADK68538.1| phosphoribosyltransferase [Olsenella uli DSM 7084]
          Length = 266

 Score = 35.0 bits (79), Expect = 3.1,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 27/46 (58%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +V   V G ++LL+DD+ TTGA+ +  A AL  +GA  V     +R
Sbjct: 219 HVVDDVRGARLLLLDDIVTTGASMRACARALISSGAAEVGGCALAR 264


>gi|229549589|ref|ZP_04438314.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis ATCC
           29200]
 gi|307270239|ref|ZP_07551552.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX4248]
 gi|307287832|ref|ZP_07567868.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX0109]
 gi|229305254|gb|EEN71250.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis ATCC
           29200]
 gi|306501166|gb|EFM70472.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX0109]
 gi|306513455|gb|EFM82074.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX4248]
 gi|315034639|gb|EFT46571.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX0027]
 gi|315159476|gb|EFU03493.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX0312]
 gi|315164724|gb|EFU08741.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX1302]
 gi|329568354|gb|EGG50163.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX1467]
          Length = 338

 Score = 35.0 bits (79), Expect = 3.2,   Method: Composition-based stats.
 Identities = 19/39 (48%), Positives = 23/39 (58%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           YV  +VAG K +L+DD+  TG T   AA  L K GA  V
Sbjct: 225 YVIGNVAGKKCILVDDILNTGQTLATAAEVLMKNGAQEV 263


>gi|167038183|ref|YP_001665761.1| phosphoribosyltransferase [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|167039108|ref|YP_001662093.1| phosphoribosyltransferase [Thermoanaerobacter sp. X514]
 gi|300913302|ref|ZP_07130619.1| phosphoribosyltransferase [Thermoanaerobacter sp. X561]
 gi|307723684|ref|YP_003903435.1| phosphoribosyltransferase [Thermoanaerobacter sp. X513]
 gi|320116592|ref|YP_004186751.1| phosphoribosyltransferase [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|166853348|gb|ABY91757.1| phosphoribosyltransferase [Thermoanaerobacter sp. X514]
 gi|166857017|gb|ABY95425.1| phosphoribosyltransferase [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|300889987|gb|EFK85132.1| phosphoribosyltransferase [Thermoanaerobacter sp. X561]
 gi|307580745|gb|ADN54144.1| phosphoribosyltransferase [Thermoanaerobacter sp. X513]
 gi|319929683|gb|ADV80368.1| phosphoribosyltransferase [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
          Length = 229

 Score = 35.0 bits (79), Expect = 3.2,   Method: Composition-based stats.
 Identities = 18/40 (45%), Positives = 24/40 (60%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           + G  +LL+DDV TTGAT    A  LK+ GA  V + T +
Sbjct: 185 IVGKNVLLVDDVLTTGATLDECAKVLKENGAKDVYVATIA 224


>gi|315173199|gb|EFU17216.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX1346]
          Length = 338

 Score = 35.0 bits (79), Expect = 3.2,   Method: Composition-based stats.
 Identities = 19/39 (48%), Positives = 23/39 (58%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           YV  +VAG K +L+DD+  TG T   AA  L K GA  V
Sbjct: 225 YVIGNVAGKKCILVDDILNTGQTLATAAEVLMKNGAQEV 263


>gi|229545344|ref|ZP_04434069.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis TX1322]
 gi|293385185|ref|ZP_06631005.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis R712]
 gi|293388183|ref|ZP_06632705.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis S613]
 gi|307272733|ref|ZP_07553980.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX0855]
 gi|307295652|ref|ZP_07575487.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX0411]
 gi|312900838|ref|ZP_07760132.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX0470]
 gi|312902850|ref|ZP_07762054.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX0635]
 gi|312908271|ref|ZP_07767235.1| ribose-phosphate diphosphokinase [Enterococcus faecalis DAPTO 512]
 gi|312910657|ref|ZP_07769498.1| ribose-phosphate diphosphokinase [Enterococcus faecalis DAPTO 516]
 gi|229309551|gb|EEN75538.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis TX1322]
 gi|291077558|gb|EFE14922.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis R712]
 gi|291082423|gb|EFE19386.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis S613]
 gi|306496364|gb|EFM65941.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX0411]
 gi|306510347|gb|EFM79370.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX0855]
 gi|310625685|gb|EFQ08968.1| ribose-phosphate diphosphokinase [Enterococcus faecalis DAPTO 512]
 gi|310633904|gb|EFQ17187.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX0635]
 gi|311289033|gb|EFQ67589.1| ribose-phosphate diphosphokinase [Enterococcus faecalis DAPTO 516]
 gi|311291937|gb|EFQ70493.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX0470]
 gi|315025819|gb|EFT37751.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX2137]
 gi|315028593|gb|EFT40525.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX4000]
 gi|315031105|gb|EFT43037.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX0017]
 gi|315146244|gb|EFT90260.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX4244]
 gi|315149264|gb|EFT93280.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX0012]
 gi|315157183|gb|EFU01200.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX0043]
 gi|315161324|gb|EFU05341.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX0645]
 gi|315167554|gb|EFU11571.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX1341]
 gi|315171616|gb|EFU15633.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX1342]
 gi|315576625|gb|EFU88816.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX0630]
 gi|327535529|gb|AEA94363.1| phosphoribosyl pyrophosphate synthetase [Enterococcus faecalis
           OG1RF]
          Length = 338

 Score = 35.0 bits (79), Expect = 3.2,   Method: Composition-based stats.
 Identities = 19/39 (48%), Positives = 23/39 (58%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           YV  +VAG K +L+DD+  TG T   AA  L K GA  V
Sbjct: 225 YVIGNVAGKKCILVDDILNTGQTLATAAEVLMKNGAQEV 263


>gi|227520191|ref|ZP_03950240.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis TX0104]
 gi|227555375|ref|ZP_03985422.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis HH22]
 gi|227072363|gb|EEI10326.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis TX0104]
 gi|227175489|gb|EEI56461.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis HH22]
 gi|315575065|gb|EFU87256.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX0309B]
 gi|315582492|gb|EFU94683.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX0309A]
          Length = 338

 Score = 35.0 bits (79), Expect = 3.2,   Method: Composition-based stats.
 Identities = 19/39 (48%), Positives = 23/39 (58%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           YV  +VAG K +L+DD+  TG T   AA  L K GA  V
Sbjct: 225 YVIGNVAGKKCILVDDILNTGQTLATAAEVLMKNGAQEV 263


>gi|288574705|ref|ZP_06393062.1| phosphoribosyltransferase [Dethiosulfovibrio peptidovorans DSM
           11002]
 gi|288570446|gb|EFC92003.1| phosphoribosyltransferase [Dethiosulfovibrio peptidovorans DSM
           11002]
          Length = 225

 Score = 35.0 bits (79), Expect = 3.3,   Method: Composition-based stats.
 Identities = 20/43 (46%), Positives = 26/43 (60%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           + G    L+DDV TTG T    A AL +AGA  V  +T+SRS+
Sbjct: 172 LKGQSCTLVDDVRTTGTTLLRGAEALYEAGAENVLSITWSRSI 214


>gi|146337714|ref|YP_001202762.1| putative competence protein F (COMF) [Bradyrhizobium sp. ORS278]
 gi|146190520|emb|CAL74519.1| putative competence protein F (COMF) [Bradyrhizobium sp. ORS278]
          Length = 267

 Score = 35.0 bits (79), Expect = 3.3,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 33/55 (60%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++ AF V       V G +++++DDV TTGAT    A AL +A A  VS+L F+R
Sbjct: 204 VQGAFQVSSDRLHDVQGRRVVIVDDVLTTGATVDACARALLRAKAAEVSVLVFAR 258


>gi|146318093|ref|YP_001197805.1| amidophosphoribosyltransferase [Streptococcus suis 05ZYH33]
 gi|146320272|ref|YP_001199983.1| amidophosphoribosyltransferase [Streptococcus suis 98HAH33]
 gi|223932601|ref|ZP_03624601.1| competence protein ComFC [Streptococcus suis 89/1591]
 gi|253751285|ref|YP_003024426.1| late competence protein [Streptococcus suis SC84]
 gi|253753186|ref|YP_003026326.1| late competence protein [Streptococcus suis P1/7]
 gi|253755009|ref|YP_003028149.1| late competence protein [Streptococcus suis BM407]
 gi|330832289|ref|YP_004401114.1| amidophosphoribosyltransferase [Streptococcus suis ST3]
 gi|145688899|gb|ABP89405.1| Predicted amidophosphoribosyltransferase [Streptococcus suis
           05ZYH33]
 gi|145691078|gb|ABP91583.1| Predicted amidophosphoribosyltransferase [Streptococcus suis
           98HAH33]
 gi|223898711|gb|EEF65072.1| competence protein ComFC [Streptococcus suis 89/1591]
 gi|251815574|emb|CAZ51157.1| putative late competence protein [Streptococcus suis SC84]
 gi|251817473|emb|CAZ55214.1| putative late competence protein [Streptococcus suis BM407]
 gi|251819431|emb|CAR44908.1| putative late competence protein [Streptococcus suis P1/7]
 gi|292557854|gb|ADE30855.1| putative late competence protein [Streptococcus suis GZ1]
 gi|319757566|gb|ADV69508.1| amidophosphoribosyltransferase [Streptococcus suis JS14]
 gi|329306512|gb|AEB80928.1| amidophosphoribosyltransferase [Streptococcus suis ST3]
          Length = 221

 Score = 35.0 bits (79), Expect = 3.4,   Method: Composition-based stats.
 Identities = 16/37 (43%), Positives = 21/37 (56%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           KILL DD+YTTGAT + A     K G   +   + +R
Sbjct: 185 KILLFDDIYTTGATIQLAVELFMKIGRKEIKTFSLTR 221


>gi|311064131|ref|YP_003970856.1| phosphoribosyltransferase [Bifidobacterium bifidum PRL2010]
 gi|310866450|gb|ADP35819.1| Putative phosphoribosyltransferase [Bifidobacterium bifidum
           PRL2010]
          Length = 238

 Score = 35.0 bits (79), Expect = 3.4,   Method: Composition-based stats.
 Identities = 14/39 (35%), Positives = 25/39 (64%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++L+DD+ TTG TA+    AL  AG    +++  +R+L+
Sbjct: 193 VILVDDIVTTGTTARQCVQALNAAGIHVTTVICLARTLR 231


>gi|307276007|ref|ZP_07557140.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX2134]
 gi|306507337|gb|EFM76474.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX2134]
          Length = 338

 Score = 35.0 bits (79), Expect = 3.4,   Method: Composition-based stats.
 Identities = 19/39 (48%), Positives = 23/39 (58%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           YV  +VAG K +L+DD+  TG T   AA  L K GA  V
Sbjct: 225 YVIGNVAGKKCILVDDILNTGQTLATAAEVLMKNGAQEV 263


>gi|255975446|ref|ZP_05426032.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis T2]
 gi|255968318|gb|EET98940.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis T2]
          Length = 324

 Score = 35.0 bits (79), Expect = 3.4,   Method: Composition-based stats.
 Identities = 19/39 (48%), Positives = 23/39 (58%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           YV  +VAG K +L+DD+  TG T   AA  L K GA  V
Sbjct: 211 YVIGNVAGKKCILVDDILNTGQTLATAAEVLMKNGAQEV 249


>gi|188589495|ref|YP_001919911.1| competence protein F [Clostridium botulinum E3 str. Alaska E43]
 gi|188499776|gb|ACD52912.1| competence protein F [Clostridium botulinum E3 str. Alaska E43]
          Length = 217

 Score = 35.0 bits (79), Expect = 3.4,   Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 24/38 (63%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           KI+LIDDV TTG T       LKK GA  + +LT ++S
Sbjct: 178 KIILIDDVATTGFTITEGYKILKKYGAKEIKLLTLAKS 215


>gi|283798900|ref|ZP_06348053.1| putative competence protein [Clostridium sp. M62/1]
 gi|291073364|gb|EFE10728.1| putative competence protein [Clostridium sp. M62/1]
          Length = 256

 Score = 35.0 bits (79), Expect = 3.5,   Method: Composition-based stats.
 Identities = 15/30 (50%), Positives = 21/30 (70%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           ++LL+DD+YTTG+TA+    AL  AG   V
Sbjct: 216 RVLLVDDIYTTGSTAEACTRALLNAGVKKV 245


>gi|251780262|ref|ZP_04823182.1| competence protein F [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
 gi|243084577|gb|EES50467.1| competence protein F [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
          Length = 217

 Score = 35.0 bits (79), Expect = 3.5,   Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 24/38 (63%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           KI+LIDDV TTG T       LKK GA  + +LT ++S
Sbjct: 178 KIILIDDVATTGFTITEGYKILKKYGAKEIKLLTLAKS 215


>gi|157363515|ref|YP_001470282.1| comFC protein, putative [Thermotoga lettingae TMO]
 gi|157314119|gb|ABV33218.1| comFC protein, putative [Thermotoga lettingae TMO]
          Length = 203

 Score = 35.0 bits (79), Expect = 3.6,   Method: Composition-based stats.
 Identities = 16/38 (42%), Positives = 24/38 (63%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + +LIDDVYTTG+T K     L+K+G   V +   +R+
Sbjct: 166 RFILIDDVYTTGSTVKECVNLLRKSGVQKVYVYCVARA 203


>gi|148284486|ref|YP_001248576.1| competence protein F [Orientia tsutsugamushi str. Boryong]
 gi|146739925|emb|CAM79923.1| competence protein F [Orientia tsutsugamushi str. Boryong]
          Length = 249

 Score = 35.0 bits (79), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 25/40 (62%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51
           S+ +   KI+L+DDV TTG T    A  LK AGA +V +L
Sbjct: 205 SEIIKNKKIILLDDVVTTGTTVNLCAKLLKNAGAKSVFVL 244


>gi|302871564|ref|YP_003840200.1| phosphoribosyltransferase [Caldicellulosiruptor obsidiansis OB47]
 gi|302574423|gb|ADL42214.1| phosphoribosyltransferase [Caldicellulosiruptor obsidiansis OB47]
          Length = 231

 Score = 35.0 bits (79), Expect = 3.7,   Method: Composition-based stats.
 Identities = 16/43 (37%), Positives = 30/43 (69%), Gaps = 2/43 (4%)

Query: 15  VAGLKILLIDDVYTTGATA-KCAAIALKKA-GAMTVSILTFSR 55
           + G K++L+DD++TTGATA +C+ + L+     + VS+L  ++
Sbjct: 186 IKGKKVILVDDIFTTGATANECSTVLLENGVKCVFVSVLAITK 228


>gi|297583329|ref|YP_003699109.1| competence protein F [Bacillus selenitireducens MLS10]
 gi|297141786|gb|ADH98543.1| competence protein F [Bacillus selenitireducens MLS10]
          Length = 249

 Score = 35.0 bits (79), Expect = 3.7,   Method: Composition-based stats.
 Identities = 18/40 (45%), Positives = 25/40 (62%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           G  + +IDD+YTTG+T   A+  L KAGA  V  +T  R+
Sbjct: 210 GKTVCIIDDLYTTGSTLYSASALLYKAGAKHVVAVTAVRA 249


>gi|255972285|ref|ZP_05422871.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis T1]
 gi|256956525|ref|ZP_05560696.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis DS5]
 gi|257079448|ref|ZP_05573809.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis JH1]
 gi|257082167|ref|ZP_05576528.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis E1Sol]
 gi|294780350|ref|ZP_06745719.1| ribose-phosphate diphosphokinase [Enterococcus faecalis PC1.1]
 gi|300860550|ref|ZP_07106637.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TUSoD Ef11]
 gi|255963303|gb|EET95779.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis T1]
 gi|256947021|gb|EEU63653.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis DS5]
 gi|256987478|gb|EEU74780.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis JH1]
 gi|256990197|gb|EEU77499.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis E1Sol]
 gi|294452614|gb|EFG21047.1| ribose-phosphate diphosphokinase [Enterococcus faecalis PC1.1]
 gi|300849589|gb|EFK77339.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TUSoD Ef11]
          Length = 324

 Score = 35.0 bits (79), Expect = 3.7,   Method: Composition-based stats.
 Identities = 19/39 (48%), Positives = 23/39 (58%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           YV  +VAG K +L+DD+  TG T   AA  L K GA  V
Sbjct: 211 YVIGNVAGKKCILVDDILNTGQTLATAAEVLMKNGAQEV 249


>gi|190571652|ref|YP_001976010.1| competence protein f [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213019054|ref|ZP_03334861.1| competence protein f [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357924|emb|CAQ55385.1| competence protein f [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995163|gb|EEB55804.1| competence protein f [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 234

 Score = 35.0 bits (79), Expect = 3.7,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++N F V    S+ +    ++L+DDV T GATA+  +  +  +GA  V +L+ +R++
Sbjct: 180 LKNTFKVSN--SEIIKNKIVILVDDVVTIGATARSCSQEILNSGAREVRVLSLARTV 234


>gi|256762943|ref|ZP_05503523.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis T3]
 gi|256853587|ref|ZP_05558952.1| ribose-phosphate pyrophosphokinase 2 [Enterococcus faecalis T8]
 gi|256961495|ref|ZP_05565666.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis Merz96]
 gi|256963416|ref|ZP_05567587.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis HIP11704]
 gi|257084784|ref|ZP_05579145.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis Fly1]
 gi|257087273|ref|ZP_05581634.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis D6]
 gi|257090349|ref|ZP_05584710.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis CH188]
 gi|257416452|ref|ZP_05593446.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis AR01/DG]
 gi|257422147|ref|ZP_05599137.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis X98]
 gi|256684194|gb|EEU23889.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis T3]
 gi|256710530|gb|EEU25573.1| ribose-phosphate pyrophosphokinase 2 [Enterococcus faecalis T8]
 gi|256951991|gb|EEU68623.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis Merz96]
 gi|256953912|gb|EEU70544.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis HIP11704]
 gi|256992814|gb|EEU80116.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis Fly1]
 gi|256995303|gb|EEU82605.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis D6]
 gi|256999161|gb|EEU85681.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis CH188]
 gi|257158280|gb|EEU88240.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis ARO1/DG]
 gi|257163971|gb|EEU93931.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis X98]
 gi|323481206|gb|ADX80645.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis 62]
          Length = 324

 Score = 35.0 bits (79), Expect = 3.7,   Method: Composition-based stats.
 Identities = 19/39 (48%), Positives = 23/39 (58%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           YV  +VAG K +L+DD+  TG T   AA  L K GA  V
Sbjct: 211 YVIGNVAGKKCILVDDILNTGQTLATAAEVLMKNGAQEV 249


>gi|242087115|ref|XP_002439390.1| hypothetical protein SORBIDRAFT_09g005630 [Sorghum bicolor]
 gi|241944675|gb|EES17820.1| hypothetical protein SORBIDRAFT_09g005630 [Sorghum bicolor]
          Length = 193

 Score = 35.0 bits (79), Expect = 3.7,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 25/39 (64%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           VAG  +++++D+  TG T  C    L+K GA ++S+ TF
Sbjct: 94  VAGKHVVVVEDIVDTGNTLSCLIAHLEKKGASSISVCTF 132


>gi|29376582|ref|NP_815736.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis V583]
 gi|257419694|ref|ZP_05596688.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis T11]
 gi|46396360|sp|Q832Z5|KPRS2_ENTFA RecName: Full=Ribose-phosphate pyrophosphokinase 2; Short=RPPK 2;
           AltName: Full=Phosphoribosyl pyrophosphate synthase 2;
           Short=P-Rib-PP synthase 2; Short=PRPP synthase 2
 gi|29344046|gb|AAO81806.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis V583]
 gi|257161522|gb|EEU91482.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis T11]
          Length = 324

 Score = 35.0 bits (79), Expect = 3.7,   Method: Composition-based stats.
 Identities = 19/39 (48%), Positives = 23/39 (58%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           YV  +VAG K +L+DD+  TG T   AA  L K GA  V
Sbjct: 211 YVIGNVAGKKCILVDDILNTGQTLATAAEVLMKNGAQEV 249


>gi|195978168|ref|YP_002123412.1| ribose-phosphate pyrophosphokinase [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
 gi|225868498|ref|YP_002744446.1| ribose-phosphate pyrophosphokinase 2 [Streptococcus equi subsp.
           zooepidemicus]
 gi|195974873|gb|ACG62399.1| ribose-phosphate pyrophosphokinase Prs [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
 gi|225701774|emb|CAW99171.1| ribose-phosphate pyrophosphokinase 2 [Streptococcus equi subsp.
           zooepidemicus]
          Length = 324

 Score = 35.0 bits (79), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 24/39 (61%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           YV   VAG K +LIDD+  TG T   AA  L++AGA  +
Sbjct: 211 YVIGDVAGKKAILIDDILNTGKTFAEAAKILERAGATDI 249


>gi|301059590|ref|ZP_07200502.1| ComF family protein [delta proteobacterium NaphS2]
 gi|300446355|gb|EFK10208.1| ComF family protein [delta proteobacterium NaphS2]
          Length = 246

 Score = 35.0 bits (79), Expect = 3.8,   Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 31/51 (60%), Gaps = 3/51 (5%)

Query: 10  YVSKHVAGL---KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +V K+ +G+    ILL+DDV+TTG T    A  L + GA  V  +T +R++
Sbjct: 195 FVLKNPSGVLKKNILLVDDVFTTGNTLNECAKVLMQGGAEAVFCVTLARAV 245


>gi|256619547|ref|ZP_05476393.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis ATCC
           4200]
 gi|256599074|gb|EEU18250.1| ribose-phosphate pyrophosphokinase [Enterococcus faecalis ATCC
           4200]
          Length = 324

 Score = 35.0 bits (79), Expect = 3.8,   Method: Composition-based stats.
 Identities = 19/39 (48%), Positives = 23/39 (58%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           YV  +VAG K +L+DD+  TG T   AA  L K GA  V
Sbjct: 211 YVIGNVAGKKCILVDDILNTGQTLATAAEVLMKNGAQEV 249


>gi|88606693|ref|YP_505817.1| comF family protein [Anaplasma phagocytophilum HZ]
 gi|88597756|gb|ABD43226.1| comF family protein [Anaplasma phagocytophilum HZ]
          Length = 217

 Score = 35.0 bits (79), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           N+F V   V     G  ++LIDDV TTGA+ +  A  LK +GA  V  LT +R++
Sbjct: 164 NSFKVTNSV--LFRGKVVVLIDDVVTTGASLQECARVLKNSGAKEVLGLTLARTM 216


>gi|322411661|gb|EFY02569.1| ribose-phosphate pyrophosphokinase [Streptococcus dysgalactiae
           subsp. dysgalactiae ATCC 27957]
          Length = 326

 Score = 35.0 bits (79), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 24/39 (61%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           YV   VAG K +LIDD+  TG T   AA  L++AGA  +
Sbjct: 211 YVIGDVAGKKAILIDDILNTGKTFAEAAKILERAGATDI 249


>gi|225677126|ref|ZP_03788126.1| putative competence protein F [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|225590830|gb|EEH12057.1| putative competence protein F [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
          Length = 241

 Score = 35.0 bits (79), Expect = 3.8,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 25/38 (65%)

Query: 22  LIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           L+DDV TTGAT +  +  +  +GA  V +L+ +R++ D
Sbjct: 199 LVDDVVTTGATVRSCSQEILNSGAKEVRVLSLARTVND 236


>gi|167763742|ref|ZP_02435869.1| hypothetical protein BACSTE_02122 [Bacteroides stercoris ATCC
           43183]
 gi|167697858|gb|EDS14437.1| hypothetical protein BACSTE_02122 [Bacteroides stercoris ATCC
           43183]
          Length = 239

 Score = 34.7 bits (78), Expect = 3.9,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 5/46 (10%)

Query: 9   QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++V KH     ILL+DDV TTGAT    A   +    + +S+LT +
Sbjct: 195 RFVGKH-----ILLVDDVLTTGATITTCADVFRDVEGVRISVLTLA 235


>gi|83815714|ref|YP_445203.1| competence protein F [Salinibacter ruber DSM 13855]
 gi|83757108|gb|ABC45221.1| competence protein F [Salinibacter ruber DSM 13855]
          Length = 239

 Score = 34.7 bits (78), Expect = 3.9,   Method: Composition-based stats.
 Identities = 17/33 (51%), Positives = 22/33 (66%)

Query: 21  LLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           LL+DDV TTGATA  A   L  AGA  ++++T 
Sbjct: 202 LLVDDVLTTGATAVAAGQTLAGAGADALNLMTL 234


>gi|313903615|ref|ZP_07837005.1| phosphoribosyltransferase [Thermaerobacter subterraneus DSM 13965]
 gi|313466168|gb|EFR61692.1| phosphoribosyltransferase [Thermaerobacter subterraneus DSM 13965]
          Length = 288

 Score = 34.7 bits (78), Expect = 3.9,   Method: Composition-based stats.
 Identities = 18/41 (43%), Positives = 24/41 (58%)

Query: 8   PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           P   ++ +AG  +LL+DDV TTG T   A  AL+  GA  V
Sbjct: 221 PSPRARRLAGRPVLLVDDVLTTGRTLAAACEALQALGAGAV 261


>gi|290580999|ref|YP_003485391.1| putative late competence protein [Streptococcus mutans NN2025]
 gi|254997898|dbj|BAH88499.1| putative late competence protein [Streptococcus mutans NN2025]
          Length = 221

 Score = 34.7 bits (78), Expect = 3.9,   Method: Composition-based stats.
 Identities = 14/37 (37%), Positives = 24/37 (64%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           K++L+DD+YTTG T + A+  L + G  T+   + +R
Sbjct: 185 KVMLVDDIYTTGMTIQLASQLLLENGVKTIKSFSLAR 221


>gi|239623234|ref|ZP_04666265.1| amidophosphoribosyltransferase [Clostridiales bacterium 1_7_47_FAA]
 gi|239522200|gb|EEQ62066.1| amidophosphoribosyltransferase [Clostridiales bacterium 1_7_47FAA]
          Length = 241

 Score = 34.7 bits (78), Expect = 3.9,   Method: Composition-based stats.
 Identities = 15/33 (45%), Positives = 22/33 (66%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
           ++L+DD+YTTG+T +     LKKAG   V  +T
Sbjct: 202 VILVDDIYTTGSTIEACTRVLKKAGMEHVYFVT 234


>gi|15673839|ref|NP_268014.1| ribose-phosphate pyrophosphokinase [Lactococcus lactis subsp.
           lactis Il1403]
 gi|24418534|sp|Q9CEI4|KPRS2_LACLA RecName: Full=Ribose-phosphate pyrophosphokinase 2; Short=RPPK 2;
           AltName: Full=Phosphoribosyl pyrophosphate synthase 2;
           Short=P-Rib-PP synthase 2; Short=PRPP synthase 2
 gi|12724888|gb|AAK05955.1|AE006415_10 ribose-phosphate pyrophosphokinase [Lactococcus lactis subsp.
           lactis Il1403]
 gi|326407348|gb|ADZ64419.1| ribose-phosphate pyrophosphokinase [Lactococcus lactis subsp.
           lactis CV56]
          Length = 321

 Score = 34.7 bits (78), Expect = 4.0,   Method: Composition-based stats.
 Identities = 17/39 (43%), Positives = 26/39 (66%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           YV  +V+G K++LIDD+  TG T   AA  +++AGA  +
Sbjct: 209 YVIGNVSGKKVILIDDILNTGVTFANAANVVREAGASEI 247


>gi|282163070|ref|YP_003355455.1| adenine phosphoribosyltransferase [Methanocella paludicola SANAE]
 gi|282155384|dbj|BAI60472.1| adenine phosphoribosyltransferase [Methanocella paludicola SANAE]
          Length = 191

 Score = 34.7 bits (78), Expect = 4.0,   Method: Composition-based stats.
 Identities = 17/35 (48%), Positives = 24/35 (68%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51
           G ++L+IDDV +TG T K    AL+KAGA+   I+
Sbjct: 114 GDRVLIIDDVISTGGTMKAVIKALEKAGAVIKDIV 148


>gi|134102878|ref|YP_001108539.1| hypothetical protein SACE_6444 [Saccharopolyspora erythraea NRRL
           2338]
 gi|133915501|emb|CAM05614.1| hypothetical protein SACE_6444 [Saccharopolyspora erythraea NRRL
           2338]
          Length = 297

 Score = 34.7 bits (78), Expect = 4.0,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 30/54 (55%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +R     P+ + +   G++ +L+DDV T+GATA     AL  +G    ++LT +
Sbjct: 215 VRTGRIAPETLRRRGDGVRTVLVDDVMTSGATAASCLRALDSSGMAVDAVLTLT 268


>gi|116512735|ref|YP_811642.1| ribose-phosphate pyrophosphokinase [Lactococcus lactis subsp.
           cremoris SK11]
 gi|116108389|gb|ABJ73529.1| Phosphoribosylpyrophosphate synthetase [Lactococcus lactis subsp.
           cremoris SK11]
          Length = 321

 Score = 34.7 bits (78), Expect = 4.0,   Method: Composition-based stats.
 Identities = 17/39 (43%), Positives = 26/39 (66%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           YV  +V+G K++LIDD+  TG T   AA  +++AGA  +
Sbjct: 209 YVIGNVSGKKVILIDDILNTGVTFANAANVVREAGASEI 247


>gi|320530105|ref|ZP_08031175.1| ComF family protein [Selenomonas artemidis F0399]
 gi|320137538|gb|EFW29450.1| ComF family protein [Selenomonas artemidis F0399]
          Length = 172

 Score = 34.7 bits (78), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 24/41 (58%)

Query: 14  HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
            +AG  ILL+DD+ TTG T    A  LK+AGA  +  L  +
Sbjct: 128 QIAGRHILLLDDIMTTGTTLLECARTLKRAGAENIYALVLA 168


>gi|304384988|ref|ZP_07367334.1| amidophosphoribosyltransferase [Pediococcus acidilactici DSM 20284]
 gi|304329182|gb|EFL96402.1| amidophosphoribosyltransferase [Pediococcus acidilactici DSM 20284]
          Length = 489

 Score = 34.7 bits (78), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 25/44 (56%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           VAG K+ L+DD    G T+K     LKKAGA  V ++  S  LK
Sbjct: 349 VAGKKVALVDDSLVRGTTSKYIVKMLKKAGAKAVHLMISSPPLK 392


>gi|291514884|emb|CBK64094.1| Predicted amidophosphoribosyltransferases [Alistipes shahii WAL
           8301]
          Length = 240

 Score = 34.7 bits (78), Expect = 4.1,   Method: Composition-based stats.
 Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 13  KHVAGLKILLIDDVYTTGAT-AKCAAIALKKAGAMTVSILTFSRSLKD 59
           + +AG  +LL+DDV TTG+T   CA+  L+ A    +SI   + S ++
Sbjct: 188 ERLAGRHVLLVDDVMTTGSTLLSCASAILRDAPGCRISIAALAVSQRE 235


>gi|260173249|ref|ZP_05759661.1| putative amidophosphoribosyl-transferase [Bacteroides sp. D2]
 gi|315921522|ref|ZP_07917762.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|313695397|gb|EFS32232.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 235

 Score = 34.7 bits (78), Expect = 4.1,   Method: Composition-based stats.
 Identities = 17/40 (42%), Positives = 24/40 (60%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           + G  IL++DDV TTG+T    A  L K   + +SILT +
Sbjct: 193 LVGKHILIVDDVLTTGSTTLACASCLVKVEGIRISILTLA 232


>gi|159896698|ref|YP_001542945.1| phosphoribosyltransferase [Herpetosiphon aurantiacus ATCC 23779]
 gi|159889737|gb|ABX02817.1| phosphoribosyltransferase [Herpetosiphon aurantiacus ATCC 23779]
          Length = 223

 Score = 34.7 bits (78), Expect = 4.1,   Method: Composition-based stats.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +LLIDDV TTG+T +  A AL  AG+  V  L  ++++
Sbjct: 175 VLLIDDVLTTGSTFEACASALIAAGSTAVEGLALAKAV 212


>gi|317125626|ref|YP_004099738.1| phosphoribosyltransferase [Intrasporangium calvum DSM 43043]
 gi|315589714|gb|ADU49011.1| phosphoribosyltransferase [Intrasporangium calvum DSM 43043]
          Length = 282

 Score = 34.7 bits (78), Expect = 4.2,   Method: Composition-based stats.
 Identities = 20/48 (41%), Positives = 27/48 (56%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           +++A  V    +  V G + LL+DDV TTG+T    A AL  AGA  V
Sbjct: 196 LQSAMEVRGSAAHRVRGRRCLLVDDVMTTGSTLAEGARALHDAGAADV 243


>gi|149197760|ref|ZP_01874810.1| adenine phosphoribosyltransferase [Lentisphaera araneosa HTCC2155]
 gi|149139330|gb|EDM27733.1| adenine phosphoribosyltransferase [Lentisphaera araneosa HTCC2155]
          Length = 195

 Score = 34.7 bits (78), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 23/38 (60%)

Query: 16  AGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           AG ++L+IDDV  TG TA+ A   ++K GA T     F
Sbjct: 135 AGDRVLIIDDVLATGGTARAAGDLVEKMGAQTAGFAFF 172


>gi|332524133|ref|ZP_08400363.1| putative phosphoribosyl transferase [Rubrivivax benzoatilyticus
           JA2]
 gi|332107472|gb|EGJ08696.1| putative phosphoribosyl transferase [Rubrivivax benzoatilyticus
           JA2]
          Length = 228

 Score = 34.7 bits (78), Expect = 4.2,   Method: Composition-based stats.
 Identities = 16/34 (47%), Positives = 22/34 (64%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAK 34
           +R AF+VP      +AG +I L+DDV TTG T +
Sbjct: 171 LRAAFHVPPSARAVLAGRRIALVDDVATTGTTLR 204


>gi|330834183|ref|YP_004408911.1| orotate phosphoribosyltransferase [Metallosphaera cuprina Ar-4]
 gi|329566322|gb|AEB94427.1| orotate phosphoribosyltransferase [Metallosphaera cuprina Ar-4]
          Length = 191

 Score = 34.7 bits (78), Expect = 4.2,   Method: Composition-based stats.
 Identities = 16/51 (31%), Positives = 26/51 (50%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
           +  +   + V   ++G  +LL+DDV TTG + + A I +   G   V  LT
Sbjct: 89  KKGYGTDKLVEAEISGRNVLLVDDVTTTGGSLEKAIIEITNGGGKVVGALT 139


>gi|320175495|gb|EFW50593.1| gluconate periplasmic binding protein [Shigella dysenteriae CDC
           74-1112]
          Length = 116

 Score = 34.7 bits (78), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 64  LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 116


>gi|296105107|ref|YP_003615253.1| gluconate periplasmic binding protein [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295059566|gb|ADF64304.1| gluconate periplasmic binding protein [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 215

 Score = 34.7 bits (78), Expect = 4.2,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL I ++DDV TTG+T    +  L ++GA +V +    R+L
Sbjct: 163 LKNAFRL----EFAVKGLHIAIVDDVVTTGSTVAELSRLLLQSGAASVQVWCLCRTL 215


>gi|256419923|ref|YP_003120576.1| phosphoribosyltransferase [Chitinophaga pinensis DSM 2588]
 gi|256034831|gb|ACU58375.1| phosphoribosyltransferase [Chitinophaga pinensis DSM 2588]
          Length = 232

 Score = 34.7 bits (78), Expect = 4.2,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query: 15  VAGLKILLIDDVYTTGATAK-CAAIALKKAGAMTVSILTFSR 55
           + G  +LLIDDV TTGAT + C+ + +    A+++  L F+R
Sbjct: 190 LKGKHLLLIDDVITTGATLEACSRLLISAGAAVSICALAFAR 231


>gi|300822788|ref|ZP_07102925.1| ComF family protein [Escherichia coli MS 119-7]
 gi|300524788|gb|EFK45857.1| ComF family protein [Escherichia coli MS 119-7]
          Length = 123

 Score = 34.7 bits (78), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 71  LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 123


>gi|323174048|gb|EFZ59676.1| protein gntX [Escherichia coli LT-68]
          Length = 129

 Score = 34.7 bits (78), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 77  LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 129


>gi|253987621|ref|YP_003038977.1| hypothetical protein PAU_00138 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253779071|emb|CAQ82231.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 154

 Score = 34.7 bits (78), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 26/43 (60%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           VAG  + ++DDV TTGAT    +  L +AGA +V +    R+L
Sbjct: 112 VAGQHVAILDDVITTGATITEISRLLIRAGARSVQVWAICRTL 154


>gi|307728346|ref|YP_003905570.1| phosphoribosyltransferase [Burkholderia sp. CCGE1003]
 gi|307582881|gb|ADN56279.1| phosphoribosyltransferase [Burkholderia sp. CCGE1003]
          Length = 233

 Score = 34.7 bits (78), Expect = 4.3,   Method: Composition-based stats.
 Identities = 19/49 (38%), Positives = 30/49 (61%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++++V  L + ++DDV TTGAT +  A  LK AGA  V+     R+ K+
Sbjct: 185 LTRNVERLHVGIVDDVMTTGATLEALARTLKAAGARRVTNFVALRTPKN 233


>gi|53724518|ref|YP_104676.1| ComF family protein [Burkholderia mallei ATCC 23344]
 gi|52427941|gb|AAU48534.1| ComF family protein [Burkholderia mallei ATCC 23344]
          Length = 242

 Score = 34.7 bits (78), Expect = 4.3,   Method: Composition-based stats.
 Identities = 19/43 (44%), Positives = 26/43 (60%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           GL + ++DDV T+GAT    A  LK+AGA  V+     R+ KD
Sbjct: 200 GLHVGVVDDVMTSGATLDALARTLKEAGARRVTNFVALRTAKD 242


>gi|237804119|ref|ZP_04591704.1| competence protein ComF [Pseudomonas syringae pv. oryzae str.
          1_6]
 gi|331026100|gb|EGI06156.1| competence protein ComF [Pseudomonas syringae pv. oryzae str.
          1_6]
          Length = 89

 Score = 34.7 bits (78), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 5/47 (10%)

Query: 12 SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           KH+A     L+DDV TTG+TA+  A  L  AGA  V +   +R+ K
Sbjct: 44 DKHLA-----LVDDVLTTGSTAEVIARLLNDAGARRVDVYCLARTPK 85


>gi|312199937|ref|YP_004019998.1| helicase domain protein [Frankia sp. EuI1c]
 gi|311231273|gb|ADP84128.1| helicase domain protein [Frankia sp. EuI1c]
          Length = 859

 Score = 34.7 bits (78), Expect = 4.4,   Method: Composition-based stats.
 Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 3   NAFNVPQYVSKHVAGLK--ILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           +AF VP  V+  +A     +LL+DDV  TG T   AA  L++AGA  V
Sbjct: 802 SAFTVPPAVATGIARADGPVLLVDDVVATGWTMTVAARLLREAGAPAV 849


>gi|312869518|ref|ZP_07729673.1| ribose-phosphate diphosphokinase [Lactobacillus oris PB013-T2-3]
 gi|311094965|gb|EFQ53254.1| ribose-phosphate diphosphokinase [Lactobacillus oris PB013-T2-3]
          Length = 324

 Score = 34.7 bits (78), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 23/39 (58%)

Query: 7   VPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGA 45
           VP+YV   V G   L++DD+  TG   K +A AL K GA
Sbjct: 213 VPEYVIGDVKGKTALVVDDIVDTGVRMKLSAQALAKFGA 251


>gi|305663794|ref|YP_003860082.1| orotate phosphoribosyltransferase [Ignisphaera aggregans DSM 17230]
 gi|304378363|gb|ADM28202.1| orotate phosphoribosyltransferase [Ignisphaera aggregans DSM 17230]
          Length = 195

 Score = 34.7 bits (78), Expect = 4.6,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 27/50 (54%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51
           R  +     V   V   KIL++DDV TTG++ + A +A+K+ G   + + 
Sbjct: 91  RKEYGTKSLVEGDVVSKKILIVDDVATTGSSIEYAYLAVKEQGGNPIGVF 140


>gi|253995944|ref|YP_003048008.1| hypothetical protein Mmol_0571 [Methylotenera mobilis JLW8]
 gi|253982623|gb|ACT47481.1| conserved hypothetical protein [Methylotenera mobilis JLW8]
          Length = 253

 Score = 34.7 bits (78), Expect = 4.6,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           MR AF    +    +  L I ++DDV TTG +    A  LK+AGA  V     +R+L
Sbjct: 199 MRGAF----HCQPSLHNLNIAVVDDVMTTGTSLNELAKTLKQAGAARVECWVMARTL 251


>gi|297544021|ref|YP_003676323.1| phosphoribosyltransferase [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|296841796|gb|ADH60312.1| phosphoribosyltransferase [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
          Length = 229

 Score = 34.7 bits (78), Expect = 4.6,   Method: Composition-based stats.
 Identities = 18/40 (45%), Positives = 24/40 (60%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           + G  +LL+DDV TTGAT    A  LK+ GA  V + T +
Sbjct: 185 IIGRNVLLVDDVLTTGATLDECAKVLKENGAKDVYVATIA 224


>gi|228911025|ref|ZP_04074833.1| ComF operon protein 3 [Bacillus thuringiensis IBL 200]
 gi|228848680|gb|EEM93526.1| ComF operon protein 3 [Bacillus thuringiensis IBL 200]
          Length = 190

 Score = 34.7 bits (78), Expect = 4.6,   Method: Composition-based stats.
 Identities = 17/36 (47%), Positives = 21/36 (58%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +L++DDVYTTG T +     L   GA  VS LT  R
Sbjct: 154 VLIVDDVYTTGITVRQIGSLLYDRGAREVSCLTLCR 189


>gi|229014359|ref|ZP_04171478.1| ComF operon protein 3 [Bacillus mycoides DSM 2048]
 gi|228746959|gb|EEL96843.1| ComF operon protein 3 [Bacillus mycoides DSM 2048]
          Length = 234

 Score = 34.7 bits (78), Expect = 4.6,   Method: Composition-based stats.
 Identities = 17/36 (47%), Positives = 21/36 (58%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +L++DDVYTTG T +     L   GA  VS LT  R
Sbjct: 198 VLIVDDVYTTGITVRQIGSLLYDRGAREVSCLTLCR 233


>gi|229063848|ref|ZP_04200152.1| ComF operon protein 3 [Bacillus cereus AH603]
 gi|228716485|gb|EEL68189.1| ComF operon protein 3 [Bacillus cereus AH603]
          Length = 234

 Score = 34.7 bits (78), Expect = 4.6,   Method: Composition-based stats.
 Identities = 17/36 (47%), Positives = 21/36 (58%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +L++DDVYTTG T +     L   GA  VS LT  R
Sbjct: 198 VLIVDDVYTTGITVRQIGSLLYDRGAREVSCLTLCR 233


>gi|163942876|ref|YP_001647760.1| comF operon protein 3 [Bacillus weihenstephanensis KBAB4]
 gi|163865073|gb|ABY46132.1| comF operon protein 3 [Bacillus weihenstephanensis KBAB4]
          Length = 234

 Score = 34.7 bits (78), Expect = 4.6,   Method: Composition-based stats.
 Identities = 17/36 (47%), Positives = 21/36 (58%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +L++DDVYTTG T +     L   GA  VS LT  R
Sbjct: 198 VLIVDDVYTTGITVRQIGSLLYDRGAREVSCLTLCR 233


>gi|294507086|ref|YP_003571144.1| Competence protein F [Salinibacter ruber M8]
 gi|294343414|emb|CBH24192.1| Competence protein F [Salinibacter ruber M8]
          Length = 252

 Score = 34.7 bits (78), Expect = 4.6,   Method: Composition-based stats.
 Identities = 17/33 (51%), Positives = 22/33 (66%)

Query: 21  LLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           LL+DDV TTGATA  A   L  AGA  ++++T 
Sbjct: 215 LLVDDVLTTGATAVAAGQTLAGAGADALNLMTL 247


>gi|222529664|ref|YP_002573546.1| phosphoribosyltransferase [Caldicellulosiruptor bescii DSM 6725]
 gi|222456511|gb|ACM60773.1| phosphoribosyltransferase [Caldicellulosiruptor bescii DSM 6725]
          Length = 231

 Score = 34.7 bits (78), Expect = 4.6,   Method: Composition-based stats.
 Identities = 16/43 (37%), Positives = 30/43 (69%), Gaps = 2/43 (4%)

Query: 15  VAGLKILLIDDVYTTGATA-KCAAIALKKA-GAMTVSILTFSR 55
           + G K++L+DD++TTGATA +C+ + L+     + VS+L  ++
Sbjct: 186 IKGKKVILVDDIFTTGATANECSKVLLENGVKCVFVSVLAITK 228


>gi|167892648|ref|ZP_02480050.1| ComF family protein [Burkholderia pseudomallei 7894]
          Length = 160

 Score = 34.7 bits (78), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 26/43 (60%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           GL + ++DDV T+GAT    A  LK+AGA  V+     R+ KD
Sbjct: 118 GLHVGVVDDVMTSGATLDALARTLKEAGARRVTNFVALRTAKD 160


>gi|300814979|ref|ZP_07095207.1| orotate phosphoribosyltransferase [Peptoniphilus sp. oral taxon 836
           str. F0141]
 gi|300510949|gb|EFK38221.1| orotate phosphoribosyltransferase [Peptoniphilus sp. oral taxon 836
           str. F0141]
          Length = 208

 Score = 34.7 bits (78), Expect = 4.7,   Method: Composition-based stats.
 Identities = 18/45 (40%), Positives = 33/45 (73%), Gaps = 1/45 (2%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT-FSRSLK 58
           V G K L+I+D+++TG ++  AA+ALK++G   + I++ F+ +LK
Sbjct: 110 VKGAKTLVIEDLFSTGKSSIDAALALKESGFDVIGIVSIFTYNLK 154


>gi|121600389|ref|YP_991524.1| ComF family protein [Burkholderia mallei SAVP1]
 gi|124383797|ref|YP_001027402.1| ComF family protein [Burkholderia mallei NCTC 10229]
 gi|126448718|ref|YP_001082367.1| ComF family protein [Burkholderia mallei NCTC 10247]
 gi|167001963|ref|ZP_02267753.1| ComF family protein [Burkholderia mallei PRL-20]
 gi|238563019|ref|ZP_00439525.2| ComF family protein [Burkholderia mallei GB8 horse 4]
 gi|254174892|ref|ZP_04881553.1| ComF family protein [Burkholderia mallei ATCC 10399]
 gi|254201770|ref|ZP_04908134.1| ComF family protein [Burkholderia mallei FMH]
 gi|254207103|ref|ZP_04913454.1| ComF family protein [Burkholderia mallei JHU]
 gi|254357587|ref|ZP_04973861.1| ComF family protein [Burkholderia mallei 2002721280]
 gi|121229199|gb|ABM51717.1| ComF family protein [Burkholderia mallei SAVP1]
 gi|124291817|gb|ABN01086.1| ComF family protein [Burkholderia mallei NCTC 10229]
 gi|126241588|gb|ABO04681.1| ComF family protein [Burkholderia mallei NCTC 10247]
 gi|147747664|gb|EDK54740.1| ComF family protein [Burkholderia mallei FMH]
 gi|147752645|gb|EDK59711.1| ComF family protein [Burkholderia mallei JHU]
 gi|148026651|gb|EDK84736.1| ComF family protein [Burkholderia mallei 2002721280]
 gi|160695937|gb|EDP85907.1| ComF family protein [Burkholderia mallei ATCC 10399]
 gi|238521500|gb|EEP84951.1| ComF family protein [Burkholderia mallei GB8 horse 4]
 gi|243062289|gb|EES44475.1| ComF family protein [Burkholderia mallei PRL-20]
          Length = 255

 Score = 34.7 bits (78), Expect = 4.7,   Method: Composition-based stats.
 Identities = 19/43 (44%), Positives = 26/43 (60%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           GL + ++DDV T+GAT    A  LK+AGA  V+     R+ KD
Sbjct: 213 GLHVGVVDDVMTSGATLDALARTLKEAGARRVTNFVALRTAKD 255


>gi|227541891|ref|ZP_03971940.1| conserved hypothetical protein [Corynebacterium glucuronolyticum
           ATCC 51866]
 gi|227182334|gb|EEI63306.1| conserved hypothetical protein [Corynebacterium glucuronolyticum
           ATCC 51866]
          Length = 132

 Score = 34.7 bits (78), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%)

Query: 9   QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           + V + V    ILL+DD+ TTG+T +  A+AL   G   V  LT +
Sbjct: 85  KVVVEAVPAGPILLVDDIVTTGSTIEATALALTARGGTVVGALTLA 130


>gi|167736935|ref|ZP_02409709.1| ComF family protein [Burkholderia pseudomallei 14]
          Length = 75

 Score = 34.7 bits (78), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 26/43 (60%)

Query: 17 GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
          GL + ++DDV T+GAT    A  LK+AGA  V+     R+ KD
Sbjct: 33 GLHVGVVDDVMTSGATLDALARTLKEAGARRVTNFVALRTAKD 75


>gi|223983242|ref|ZP_03633436.1| hypothetical protein HOLDEFILI_00716 [Holdemania filiformis DSM
           12042]
 gi|223964847|gb|EEF69165.1| hypothetical protein HOLDEFILI_00716 [Holdemania filiformis DSM
           12042]
          Length = 179

 Score = 34.7 bits (78), Expect = 4.8,   Method: Composition-based stats.
 Identities = 17/39 (43%), Positives = 22/39 (56%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           V  L ILL++D+  TG T K     LK  GA TV ++T 
Sbjct: 90  VKNLDILLVEDIVDTGRTLKTVKAMLKNKGAKTVRVVTL 128


>gi|108798322|ref|YP_638519.1| hypothetical protein Mmcs_1351 [Mycobacterium sp. MCS]
 gi|119867419|ref|YP_937371.1| hypothetical protein Mkms_1369 [Mycobacterium sp. KMS]
 gi|108768741|gb|ABG07463.1| conserved hypothetical protein [Mycobacterium sp. MCS]
 gi|119693508|gb|ABL90581.1| conserved hypothetical protein [Mycobacterium sp. KMS]
          Length = 204

 Score = 34.7 bits (78), Expect = 4.8,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 29/42 (69%), Gaps = 1/42 (2%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           VAG  ++L+DD+ TTGATA  +   L+ AGA  +++LT + +
Sbjct: 164 VAG-SVVLVDDIITTGATATESVRVLQTAGAGVLAVLTLANA 204


>gi|312622112|ref|YP_004023725.1| phosphoribosyltransferase [Caldicellulosiruptor kronotskyensis
           2002]
 gi|312202579|gb|ADQ45906.1| phosphoribosyltransferase [Caldicellulosiruptor kronotskyensis
           2002]
          Length = 231

 Score = 34.7 bits (78), Expect = 4.8,   Method: Composition-based stats.
 Identities = 16/43 (37%), Positives = 30/43 (69%), Gaps = 2/43 (4%)

Query: 15  VAGLKILLIDDVYTTGATA-KCAAIALKKA-GAMTVSILTFSR 55
           + G K++L+DD++TTGATA +C+ + L+     + VS+L  ++
Sbjct: 186 IKGKKVILVDDIFTTGATANECSKVLLENGVKCVFVSVLAITK 228


>gi|299144700|ref|ZP_07037768.1| competence protein [Bacteroides sp. 3_1_23]
 gi|298515191|gb|EFI39072.1| competence protein [Bacteroides sp. 3_1_23]
          Length = 234

 Score = 34.7 bits (78), Expect = 4.8,   Method: Composition-based stats.
 Identities = 17/40 (42%), Positives = 24/40 (60%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +AG  IL++DDV TTG+T    A  L     + +SILT +
Sbjct: 193 LAGKHILIVDDVLTTGSTTLACASCLVNVEGIRISILTLA 232


>gi|298480136|ref|ZP_06998335.1| competence protein [Bacteroides sp. D22]
 gi|298273945|gb|EFI15507.1| competence protein [Bacteroides sp. D22]
          Length = 234

 Score = 34.7 bits (78), Expect = 4.8,   Method: Composition-based stats.
 Identities = 17/40 (42%), Positives = 24/40 (60%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +AG  IL++DDV TTG+T    A  L     + +SILT +
Sbjct: 193 LAGKHILIVDDVLTTGSTTLACASCLVNVEGIRISILTLA 232


>gi|237718860|ref|ZP_04549341.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|293371903|ref|ZP_06618307.1| ComF family protein [Bacteroides ovatus SD CMC 3f]
 gi|229451992|gb|EEO57783.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|292633149|gb|EFF51726.1| ComF family protein [Bacteroides ovatus SD CMC 3f]
          Length = 234

 Score = 34.7 bits (78), Expect = 4.8,   Method: Composition-based stats.
 Identities = 17/40 (42%), Positives = 24/40 (60%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +AG  IL++DDV TTG+T    A  L     + +SILT +
Sbjct: 193 LAGKHILIVDDVLTTGSTTLACASCLVNVEGIRISILTLA 232


>gi|227514372|ref|ZP_03944421.1| late competence protein [Lactobacillus fermentum ATCC 14931]
 gi|227087238|gb|EEI22550.1| late competence protein [Lactobacillus fermentum ATCC 14931]
          Length = 140

 Score = 34.7 bits (78), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 26/42 (61%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           K V G  ++L+DDV+TTG T   AA  ++ AG  T+  +T +
Sbjct: 98  KRVRGKTVVLVDDVFTTGRTMYHAAQLMRAAGCKTICGVTLA 139


>gi|167814040|ref|ZP_02445720.1| ComF family protein [Burkholderia pseudomallei 91]
          Length = 76

 Score = 34.7 bits (78), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 26/43 (60%)

Query: 17 GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
          GL + ++DDV T+GAT    A  LK+AGA  V+     R+ KD
Sbjct: 34 GLHVGVVDDVMTSGATLDALARTLKEAGARRVTNFVALRTAKD 76


>gi|160884054|ref|ZP_02065057.1| hypothetical protein BACOVA_02030 [Bacteroides ovatus ATCC 8483]
 gi|156110396|gb|EDO12141.1| hypothetical protein BACOVA_02030 [Bacteroides ovatus ATCC 8483]
          Length = 234

 Score = 34.7 bits (78), Expect = 4.8,   Method: Composition-based stats.
 Identities = 17/40 (42%), Positives = 24/40 (60%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +AG  IL++DDV TTG+T    A  L     + +SILT +
Sbjct: 193 LAGKHILIVDDVLTTGSTTLACASCLVNVEGIRISILTLA 232


>gi|70727139|ref|YP_254055.1| hypothetical protein SH2140 [Staphylococcus haemolyticus JCSC1435]
 gi|68447865|dbj|BAE05449.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435]
          Length = 224

 Score = 34.7 bits (78), Expect = 4.8,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 8   PQYVSKHV--AGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           P Y+ + V     +ILL+DD+YTTG T   A   L         + TFSR
Sbjct: 175 PFYIKEDVDLTDKEILLVDDIYTTGLTIHHAGCKLYDKNVRKFKVFTFSR 224


>gi|171060486|ref|YP_001792835.1| putative phosphoribosyl transferase [Leptothrix cholodnii SP-6]
 gi|170777931|gb|ACB36070.1| putative phosphoribosyl transferase [Leptothrix cholodnii SP-6]
          Length = 266

 Score = 34.7 bits (78), Expect = 4.8,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 30/56 (53%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R A+ +       VA   + ++DDV TTGAT    A+ L++ GA +V     +R+
Sbjct: 208 VRGAYALTAAGQIAVAARHVAIVDDVMTTGATLAELALTLQRGGAASVQAWVLART 263


>gi|76811333|ref|YP_332083.1| ComF family protein [Burkholderia pseudomallei 1710b]
 gi|126440013|ref|YP_001057539.1| putative competence protein [Burkholderia pseudomallei 668]
 gi|126451766|ref|YP_001064787.1| putative competence protein [Burkholderia pseudomallei 1106a]
 gi|167844143|ref|ZP_02469651.1| ComF family protein [Burkholderia pseudomallei B7210]
 gi|167909363|ref|ZP_02496454.1| ComF family protein [Burkholderia pseudomallei 112]
 gi|226193721|ref|ZP_03789324.1| ComF family protein [Burkholderia pseudomallei Pakistan 9]
 gi|242314129|ref|ZP_04813145.1| ComF family protein [Burkholderia pseudomallei 1106b]
 gi|254187875|ref|ZP_04894387.1| putative competence protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|254196896|ref|ZP_04903320.1| putative competence protein [Burkholderia pseudomallei S13]
 gi|254261894|ref|ZP_04952948.1| competence protein homolog [Burkholderia pseudomallei 1710a]
 gi|76580786|gb|ABA50261.1| ComF family protein [Burkholderia pseudomallei 1710b]
 gi|126219506|gb|ABN83012.1| putative competence protein [Burkholderia pseudomallei 668]
 gi|126225408|gb|ABN88948.1| ComF family protein [Burkholderia pseudomallei 1106a]
 gi|157935555|gb|EDO91225.1| putative competence protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|169653639|gb|EDS86332.1| putative competence protein [Burkholderia pseudomallei S13]
 gi|225934299|gb|EEH30283.1| ComF family protein [Burkholderia pseudomallei Pakistan 9]
 gi|242137368|gb|EES23770.1| ComF family protein [Burkholderia pseudomallei 1106b]
 gi|254220583|gb|EET09967.1| competence protein homolog [Burkholderia pseudomallei 1710a]
          Length = 255

 Score = 34.7 bits (78), Expect = 4.8,   Method: Composition-based stats.
 Identities = 19/43 (44%), Positives = 26/43 (60%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           GL + ++DDV T+GAT    A  LK+AGA  V+     R+ KD
Sbjct: 213 GLHVGVVDDVMTSGATLDALARTLKEAGARRVTNFVALRTAKD 255


>gi|53718089|ref|YP_107075.1| hypothetical protein BPSL0450 [Burkholderia pseudomallei K96243]
 gi|52208503|emb|CAH34438.1| conserved hypothetical protein [Burkholderia pseudomallei K96243]
          Length = 242

 Score = 34.7 bits (78), Expect = 4.8,   Method: Composition-based stats.
 Identities = 19/43 (44%), Positives = 26/43 (60%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           GL + ++DDV T+GAT    A  LK+AGA  V+     R+ KD
Sbjct: 200 GLHVGVVDDVMTSGATLDALARTLKEAGARRVTNFVALRTAKD 242


>gi|323457312|gb|EGB13178.1| hypothetical protein AURANDRAFT_15088 [Aureococcus anophagefferens]
          Length = 222

 Score = 34.7 bits (78), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 26/40 (65%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
           V   VAG K+LL+DDV + G   + A   LK+AGA+ V++
Sbjct: 108 VGADVAGKKVLLVDDVISAGTAVREATGILKQAGAILVAV 147


>gi|320639695|gb|EFX09289.1| DNA utilization protein GntX [Escherichia coli O157:H7 str. G5101]
          Length = 227

 Score = 34.7 bits (78), Expect = 4.9,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELAVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|282877098|ref|ZP_06285940.1| ComF family protein [Prevotella buccalis ATCC 35310]
 gi|281300780|gb|EFA93107.1| ComF family protein [Prevotella buccalis ATCC 35310]
          Length = 231

 Score = 34.7 bits (78), Expect = 4.9,   Method: Composition-based stats.
 Identities = 16/37 (43%), Positives = 24/37 (64%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           G  +L+IDD+ TTGAT      AL++ G + VS+L+ 
Sbjct: 190 GKHVLIIDDIVTTGATICACGKALQRDGRVHVSVLSL 226


>gi|322421671|ref|YP_004200894.1| phosphoribosyltransferase [Geobacter sp. M18]
 gi|320128058|gb|ADW15618.1| phosphoribosyltransferase [Geobacter sp. M18]
          Length = 245

 Score = 34.7 bits (78), Expect = 4.9,   Method: Composition-based stats.
 Identities = 17/41 (41%), Positives = 27/41 (65%), Gaps = 2/41 (4%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALK 41
           ++ AF V    +K +AG ++LL+DDV TTG+T +    AL+
Sbjct: 189 VKGAFGVRD--AKSLAGKRVLLVDDVLTTGSTVRACVDALR 227


>gi|183222027|ref|YP_001840023.1| putative competence-related protein [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
 gi|189912094|ref|YP_001963649.1| amidophosphoribosyltransferase [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167776770|gb|ABZ95071.1| Amidophosphoribosyltransferase [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167780449|gb|ABZ98747.1| Putative competence-related protein [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
          Length = 236

 Score = 34.7 bits (78), Expect = 4.9,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 25/42 (59%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + GL +LL+DD++TTGA+    A   K  GA  V+ + F  S
Sbjct: 183 IEGLHVLLVDDIFTTGASLNEIARLYKLRGARKVTCVVFMLS 224


>gi|303238037|ref|ZP_07324580.1| ComF family protein [Prevotella disiens FB035-09AN]
 gi|302481827|gb|EFL44879.1| ComF family protein [Prevotella disiens FB035-09AN]
          Length = 234

 Score = 34.7 bits (78), Expect = 5.0,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 30/55 (54%), Gaps = 6/55 (10%)

Query: 1   MRNAFNV--PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           + NAF +  P+ +S       ILLIDDV TTGAT    A  L KA  + +S+L  
Sbjct: 178 VENAFQLCHPEKLSNQ----HILLIDDVMTTGATLTSLAKELMKAENIKISVLAL 228


>gi|134279927|ref|ZP_01766639.1| ComF family protein [Burkholderia pseudomallei 305]
 gi|167901143|ref|ZP_02488348.1| ComF family protein [Burkholderia pseudomallei NCTC 13177]
 gi|254181942|ref|ZP_04888539.1| putative competence protein [Burkholderia pseudomallei 1655]
 gi|134249127|gb|EBA49209.1| ComF family protein [Burkholderia pseudomallei 305]
 gi|184212480|gb|EDU09523.1| putative competence protein [Burkholderia pseudomallei 1655]
          Length = 255

 Score = 34.7 bits (78), Expect = 5.0,   Method: Composition-based stats.
 Identities = 19/43 (44%), Positives = 26/43 (60%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           GL + ++DDV T+GAT    A  LK+AGA  V+     R+ KD
Sbjct: 213 GLHVGVVDDVMTSGATLDALARTLKEAGARRVTNFVALRTAKD 255


>gi|225351865|ref|ZP_03742888.1| hypothetical protein BIFPSEUDO_03467 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|225157112|gb|EEG70451.1| hypothetical protein BIFPSEUDO_03467 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 249

 Score = 34.7 bits (78), Expect = 5.0,   Method: Composition-based stats.
 Identities = 13/37 (35%), Positives = 24/37 (64%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++L+DD+ TTGAT +     ++K GA  V++L  + +
Sbjct: 194 VILVDDIVTTGATMRSCVETMRKEGATVVTVLALAHT 230


>gi|167917392|ref|ZP_02504483.1| ComF family protein [Burkholderia pseudomallei BCC215]
 gi|217419806|ref|ZP_03451312.1| ComF family protein [Burkholderia pseudomallei 576]
 gi|254296008|ref|ZP_04963465.1| putative competence protein [Burkholderia pseudomallei 406e]
 gi|157805585|gb|EDO82755.1| putative competence protein [Burkholderia pseudomallei 406e]
 gi|217397110|gb|EEC37126.1| ComF family protein [Burkholderia pseudomallei 576]
          Length = 255

 Score = 34.3 bits (77), Expect = 5.1,   Method: Composition-based stats.
 Identities = 19/43 (44%), Positives = 26/43 (60%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           GL + ++DDV T+GAT    A  LK+AGA  V+     R+ KD
Sbjct: 213 GLHVGVVDDVMTSGATLDALARTLKEAGARRVTNFVALRTAKD 255


>gi|289577708|ref|YP_003476335.1| phosphoribosyltransferase [Thermoanaerobacter italicus Ab9]
 gi|289527421|gb|ADD01773.1| phosphoribosyltransferase [Thermoanaerobacter italicus Ab9]
          Length = 229

 Score = 34.3 bits (77), Expect = 5.1,   Method: Composition-based stats.
 Identities = 18/40 (45%), Positives = 24/40 (60%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           + G  +LL+DDV TTGAT    A  LK+ GA  V + T +
Sbjct: 185 IIGKNVLLVDDVLTTGATLDECAKVLKENGAKDVYVATIA 224


>gi|184200529|ref|YP_001854736.1| hypothetical protein KRH_08830 [Kocuria rhizophila DC2201]
 gi|183580759|dbj|BAG29230.1| hypothetical protein [Kocuria rhizophila DC2201]
          Length = 262

 Score = 34.3 bits (77), Expect = 5.1,   Method: Composition-based stats.
 Identities = 18/43 (41%), Positives = 27/43 (62%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ VAG   +++DDV TTGATA  A   L  AGA   +++T +
Sbjct: 208 AEDVAGRTCVVVDDVLTTGATAAEAVRCLTAAGAHVPAVVTLA 250


>gi|149277499|ref|ZP_01883640.1| putative amidophosphoribosyl-transferase [Pedobacter sp. BAL39]
 gi|149231732|gb|EDM37110.1| putative amidophosphoribosyl-transferase [Pedobacter sp. BAL39]
          Length = 232

 Score = 34.3 bits (77), Expect = 5.1,   Method: Composition-based stats.
 Identities = 16/35 (45%), Positives = 22/35 (62%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ILL+DDV TTGAT +  A+ L + G   +SI   +
Sbjct: 195 ILLVDDVITTGATIEACALELHRCGIRKLSIFALA 229


>gi|91776533|ref|YP_546289.1| hypothetical protein Mfla_2181 [Methylobacillus flagellatus KT]
 gi|91710520|gb|ABE50448.1| conserved hypothetical protein [Methylobacillus flagellatus KT]
          Length = 227

 Score = 34.3 bits (77), Expect = 5.2,   Method: Composition-based stats.
 Identities = 15/42 (35%), Positives = 26/42 (61%)

Query: 18  LKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++++L+DDV TTGA+    A  +K AGA  V     +R++ +
Sbjct: 186 MRVILLDDVMTTGASLNALAKTVKAAGASRVECWVIARTIAE 227


>gi|81428274|ref|YP_395274.1| amidophosphoribosyltransferase [Lactobacillus sakei subsp. sakei
           23K]
 gi|78609916|emb|CAI54963.1| Amidophosphoribosyltransferase [Lactobacillus sakei subsp. sakei
           23K]
          Length = 477

 Score = 34.3 bits (77), Expect = 5.2,   Method: Composition-based stats.
 Identities = 20/48 (41%), Positives = 27/48 (56%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           V   VAG +I+L+DD    G T+K     LK+AGA+ V +   S  LK
Sbjct: 344 VKSVVAGKRIVLVDDSIVRGTTSKHIVKRLKEAGALEVHLRVASPPLK 391


>gi|307265486|ref|ZP_07547041.1| phosphoribosyltransferase [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306919440|gb|EFN49659.1| phosphoribosyltransferase [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 229

 Score = 34.3 bits (77), Expect = 5.3,   Method: Composition-based stats.
 Identities = 18/40 (45%), Positives = 24/40 (60%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           + G   LL+DDV TTGAT    A  LK+ GA  V ++T +
Sbjct: 185 IVGKNALLVDDVLTTGATLDECAKVLKENGAKDVYVVTIA 224


>gi|256750931|ref|ZP_05491815.1| phosphoribosyltransferase [Thermoanaerobacter ethanolicus CCSD1]
 gi|256750266|gb|EEU63286.1| phosphoribosyltransferase [Thermoanaerobacter ethanolicus CCSD1]
          Length = 229

 Score = 34.3 bits (77), Expect = 5.3,   Method: Composition-based stats.
 Identities = 18/40 (45%), Positives = 24/40 (60%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           + G   LL+DDV TTGAT    A  LK+ GA  V ++T +
Sbjct: 185 IVGKNALLVDDVLTTGATLDECAKVLKENGAKDVYVVTIA 224


>gi|330834167|ref|YP_004408895.1| amidophosphoribosyltransferase [Metallosphaera cuprina Ar-4]
 gi|329566306|gb|AEB94411.1| amidophosphoribosyltransferase [Metallosphaera cuprina Ar-4]
          Length = 401

 Score = 34.3 bits (77), Expect = 5.3,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 26/47 (55%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +   V G KI+LIDD   TG T K   ++L++ GA  V +L  S  L
Sbjct: 290 IKSAVLGKKIVLIDDSMVTGTTIKNTIMSLRRLGAKEVHVLIGSPKL 336


>gi|313893733|ref|ZP_07827300.1| comF family protein [Veillonella sp. oral taxon 158 str. F0412]
 gi|313441747|gb|EFR60172.1| comF family protein [Veillonella sp. oral taxon 158 str. F0412]
          Length = 231

 Score = 34.3 bits (77), Expect = 5.3,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 3   NAFNV-PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +AF V  +Y    +A   IL++DD+YTTGAT +     L+    + +  LT +
Sbjct: 175 DAFVVKAEYKHMELANKNILIVDDIYTTGATIEAVTKVLRSYKPLKIDALTLA 227


>gi|295132356|ref|YP_003583032.1| phosphoribosyltransferases family protein [Zunongwangia profunda
           SM-A87]
 gi|294980371|gb|ADF50836.1| phosphoribosyltransferases family protein [Zunongwangia profunda
           SM-A87]
          Length = 205

 Score = 34.3 bits (77), Expect = 5.3,   Method: Composition-based stats.
 Identities = 16/40 (40%), Positives = 26/40 (65%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++G  ILL+DD+ TTGAT +     L+K+  + +SI T +
Sbjct: 163 ISGKHILLVDDILTTGATLEACIGCLRKSEKIKISIATMA 202


>gi|119505551|ref|ZP_01627623.1| K+-dependent Na+/Ca+ exchanger related-protein [marine gamma
           proteobacterium HTCC2080]
 gi|119458660|gb|EAW39763.1| K+-dependent Na+/Ca+ exchanger related-protein [marine gamma
           proteobacterium HTCC2080]
          Length = 266

 Score = 34.3 bits (77), Expect = 5.3,   Method: Composition-based stats.
 Identities = 16/37 (43%), Positives = 22/37 (59%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +L+IDDV TTG T +  A  L KAGA  +     +R+
Sbjct: 219 VLIIDDVVTTGNTLEAVAATLAKAGATRIDAWCLARA 255


>gi|78042838|ref|YP_358890.1| phosphoribosyl transferase domain-containing protein
           [Carboxydothermus hydrogenoformans Z-2901]
 gi|77994953|gb|ABB13852.1| phosphoribosyl transferase domain protein [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 212

 Score = 34.3 bits (77), Expect = 5.3,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51
           M+N +N+  Y++       +LL+DD   TG T   A ++LKK GA +++++
Sbjct: 107 MQNIYNM-DYINYDYTNKNVLLVDDGLATGFTVLAAGLSLKKRGANSITVV 156


>gi|15607029|ref|NP_214411.1| hypothetical protein aq_2059 [Aquifex aeolicus VF5]
 gi|2984284|gb|AAC07809.1| hypothetical protein aq_2059 [Aquifex aeolicus VF5]
          Length = 213

 Score = 34.3 bits (77), Expect = 5.3,   Method: Composition-based stats.
 Identities = 16/38 (42%), Positives = 25/38 (65%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           V  +V G ++L+ DD+ TTG+TAK  +  L ++GA  V
Sbjct: 168 VRGNVKGKRVLVFDDILTTGSTAKSVSKTLLESGAKEV 205


>gi|37523333|ref|NP_926710.1| hypothetical protein glr3764 [Gloeobacter violaceus PCC 7421]
 gi|35214337|dbj|BAC91705.1| glr3764 [Gloeobacter violaceus PCC 7421]
          Length = 218

 Score = 34.3 bits (77), Expect = 5.3,   Method: Composition-based stats.
 Identities = 20/41 (48%), Positives = 27/41 (65%), Gaps = 2/41 (4%)

Query: 20  ILLIDDVYTTGAT-AKCAAIALKKAGAMTVSILTFSRSLKD 59
           +LL+DD+ TTG+T A+CAA AL KAG+  V     +R   D
Sbjct: 172 VLLVDDICTTGSTLARCAA-ALVKAGSGAVQAAVVARPALD 211


>gi|188025401|ref|ZP_02958488.2| hypothetical protein PROSTU_00226 [Providencia stuartii ATCC 25827]
 gi|188023650|gb|EDU61690.1| hypothetical protein PROSTU_00226 [Providencia stuartii ATCC 25827]
          Length = 229

 Score = 34.3 bits (77), Expect = 5.4,   Method: Composition-based stats.
 Identities = 19/43 (44%), Positives = 24/43 (55%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           V G  + + DDV TTGAT + AA  L  AG  TV   +  R+L
Sbjct: 187 VIGQHVAIFDDVLTTGATMQAAAQLLICAGVETVQAWSLCRTL 229


>gi|326389598|ref|ZP_08211164.1| phosphoribosyltransferase [Thermoanaerobacter ethanolicus JW 200]
 gi|325994313|gb|EGD52739.1| phosphoribosyltransferase [Thermoanaerobacter ethanolicus JW 200]
          Length = 229

 Score = 34.3 bits (77), Expect = 5.4,   Method: Composition-based stats.
 Identities = 18/40 (45%), Positives = 24/40 (60%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           + G   LL+DDV TTGAT    A  LK+ GA  V ++T +
Sbjct: 185 IVGKNALLVDDVLTTGATLDECAKVLKENGAKDVYVVTIA 224


>gi|189485653|ref|YP_001956594.1| competence protein F [uncultured Termite group 1 bacterium
           phylotype Rs-D17]
 gi|170287612|dbj|BAG14133.1| competence protein F [uncultured Termite group 1 bacterium
           phylotype Rs-D17]
          Length = 238

 Score = 34.3 bits (77), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (63%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++LIDD+ TT AT    ++ALK  G   V +LT +R
Sbjct: 202 VILIDDIATTSATVSACSLALKTVGTKKVYVLTLAR 237


>gi|167822560|ref|ZP_02454031.1| ComF family protein [Burkholderia pseudomallei 9]
          Length = 62

 Score = 34.3 bits (77), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 26/43 (60%)

Query: 17 GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
          GL + ++DDV T+GAT    A  LK+AGA  V+     R+ KD
Sbjct: 20 GLHVGVVDDVMTSGATLDALARTLKEAGARRVTNFVALRTAKD 62


>gi|312877563|ref|ZP_07737522.1| phosphoribosyltransferase [Caldicellulosiruptor lactoaceticus 6A]
 gi|311795638|gb|EFR12008.1| phosphoribosyltransferase [Caldicellulosiruptor lactoaceticus 6A]
          Length = 231

 Score = 34.3 bits (77), Expect = 5.5,   Method: Composition-based stats.
 Identities = 16/39 (41%), Positives = 29/39 (74%), Gaps = 2/39 (5%)

Query: 19  KILLIDDVYTTGATA-KCAAIALKK-AGAMTVSILTFSR 55
           +++L+DD++TTGATA +C+ + LK  A  + VS+L  ++
Sbjct: 190 RVILVDDIFTTGATANECSKVLLKNGAKCVFVSVLAITK 228


>gi|312793874|ref|YP_004026797.1| phosphoribosyltransferase [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312181014|gb|ADQ41184.1| phosphoribosyltransferase [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 231

 Score = 34.3 bits (77), Expect = 5.5,   Method: Composition-based stats.
 Identities = 16/39 (41%), Positives = 29/39 (74%), Gaps = 2/39 (5%)

Query: 19  KILLIDDVYTTGATA-KCAAIALKK-AGAMTVSILTFSR 55
           +++L+DD++TTGATA +C+ + LK  A  + VS+L  ++
Sbjct: 190 RVILVDDIFTTGATANECSKVLLKNGAKCVFVSVLAITK 228


>gi|296123438|ref|YP_003631216.1| amidophosphoribosyltransferase family protein [Planctomyces
           limnophilus DSM 3776]
 gi|296015778|gb|ADG69017.1| amidophosphoribosyltransferase family protein [Planctomyces
           limnophilus DSM 3776]
          Length = 274

 Score = 34.3 bits (77), Expect = 5.5,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 26/39 (66%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++LL+DDV TTG+TA     AL+ +G+  V++  + R +
Sbjct: 218 RVLLVDDVLTTGSTANDCIRALQASGSGPVAVAVWGRGI 256


>gi|99082742|ref|YP_614896.1| competence protein F, putative [Ruegeria sp. TM1040]
 gi|99039022|gb|ABF65634.1| competence protein F putative [Ruegeria sp. TM1040]
          Length = 243

 Score = 34.3 bits (77), Expect = 5.5,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 8   PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           P+  S+ + G ++LL+DDV T+G+T    A A   AGA + ++   +R
Sbjct: 193 PRMASR-LKGRRVLLVDDVMTSGSTLSACARACMDAGAKSTNVAVLAR 239


>gi|312963457|ref|ZP_07777939.1| phosphoribosyltransferase [Pseudomonas fluorescens WH6]
 gi|311282263|gb|EFQ60862.1| phosphoribosyltransferase [Pseudomonas fluorescens WH6]
          Length = 245

 Score = 34.3 bits (77), Expect = 5.6,   Method: Composition-based stats.
 Identities = 18/37 (48%), Positives = 22/37 (59%)

Query: 22  LIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           L+DDV TTGATA   A  L  AGA  V +   +R+ K
Sbjct: 206 LVDDVLTTGATAHSLARLLINAGARQVDVYCLARTPK 242


>gi|296270032|ref|YP_003652664.1| adenine phosphoribosyltransferase [Thermobispora bispora DSM 43833]
 gi|296092819|gb|ADG88771.1| adenine phosphoribosyltransferase [Thermobispora bispora DSM 43833]
          Length = 168

 Score = 34.3 bits (77), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 23/34 (67%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
           G ++L++DDV  TG TA  A   +++AGA  VS+
Sbjct: 109 GERVLIVDDVLATGGTASAAVELVRQAGAEVVSV 142


>gi|167717916|ref|ZP_02401152.1| ComF family protein [Burkholderia pseudomallei DM98]
          Length = 60

 Score = 34.3 bits (77), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 26/43 (60%)

Query: 17 GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
          GL + ++DDV T+GAT    A  LK+AGA  V+     R+ KD
Sbjct: 18 GLHVGVVDDVMTSGATLDALARTLKEAGARRVTNFVALRTAKD 60


>gi|330683982|gb|EGG95743.1| comF family protein [Staphylococcus epidermidis VCU121]
          Length = 229

 Score = 34.3 bits (77), Expect = 5.6,   Method: Composition-based stats.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 8   PQYVSKHVA--GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           P ++ K++   G +ILL+DD+YTTG T   A   L        ++  F+R
Sbjct: 180 PFFIRKNIELDGKEILLVDDIYTTGLTINRAMCKLSTLNVRKFNVFAFAR 229


>gi|295097022|emb|CBK86112.1| Predicted amidophosphoribosyltransferases [Enterobacter cloacae
           subsp. cloacae NCTC 9394]
          Length = 210

 Score = 34.3 bits (77), Expect = 5.6,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 4/56 (7%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +NAF +   V+    GL I ++DDV TTG+T    +  L ++GA +V +    R+L
Sbjct: 159 KNAFRLELPVN----GLHIAIVDDVVTTGSTVAELSRLLLQSGAASVQVWCLCRTL 210


>gi|239917963|ref|YP_002957521.1| predicted amidophosphoribosyltransferase [Micrococcus luteus NCTC
           2665]
 gi|239839170|gb|ACS30967.1| predicted amidophosphoribosyltransferase [Micrococcus luteus NCTC
           2665]
          Length = 265

 Score = 34.3 bits (77), Expect = 5.6,   Method: Composition-based stats.
 Identities = 16/30 (53%), Positives = 21/30 (70%)

Query: 16  AGLKILLIDDVYTTGATAKCAAIALKKAGA 45
           AG  +LL+DDV TTGAT    A A+++AG 
Sbjct: 207 AGAPVLLVDDVLTTGATLAALAEAVRRAGG 236


>gi|331674901|ref|ZP_08375658.1| protein GntX [Escherichia coli TA280]
 gi|331067810|gb|EGI39208.1| protein GntX [Escherichia coli TA280]
          Length = 243

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 191 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 243


>gi|331654991|ref|ZP_08355990.1| protein GntX [Escherichia coli M718]
 gi|331047006|gb|EGI19084.1| protein GntX [Escherichia coli M718]
          Length = 243

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 191 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 243


>gi|331649211|ref|ZP_08350297.1| protein GntX [Escherichia coli M605]
 gi|331041709|gb|EGI13853.1| protein GntX [Escherichia coli M605]
          Length = 243

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 191 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 243


>gi|323974783|gb|EGB69895.1| comF family protein [Escherichia coli TW10509]
          Length = 215

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|323966226|gb|EGB61662.1| comF family protein [Escherichia coli M863]
 gi|327251049|gb|EGE62742.1| protein gntX [Escherichia coli STEC_7v]
          Length = 227

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|323182874|gb|EFZ68275.1| protein gntX [Escherichia coli 1357]
          Length = 215

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|320181905|gb|EFW56811.1| gluconate periplasmic binding protein [Shigella boydii ATCC 9905]
          Length = 227

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|312968275|ref|ZP_07782485.1| protein gntX [Escherichia coli 2362-75]
 gi|312287100|gb|EFR15010.1| protein gntX [Escherichia coli 2362-75]
          Length = 215

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|331685055|ref|ZP_08385641.1| protein GntX [Escherichia coli H299]
 gi|331077426|gb|EGI48638.1| protein GntX [Escherichia coli H299]
          Length = 227

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|330909446|gb|EGH37960.1| hypothetical protein ECAA86_03648 [Escherichia coli AA86]
          Length = 227

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|300919300|ref|ZP_07135814.1| ComF family protein [Escherichia coli MS 115-1]
 gi|300413615|gb|EFJ96925.1| ComF family protein [Escherichia coli MS 115-1]
          Length = 227

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|300985359|ref|ZP_07177415.1| ComF family protein [Escherichia coli MS 45-1]
 gi|300408100|gb|EFJ91638.1| ComF family protein [Escherichia coli MS 45-1]
          Length = 227

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|301019566|ref|ZP_07183728.1| ComF family protein [Escherichia coli MS 69-1]
 gi|300399191|gb|EFJ82729.1| ComF family protein [Escherichia coli MS 69-1]
          Length = 227

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|293412831|ref|ZP_06655499.1| gluconate periplasmic binding protein [Escherichia coli B354]
 gi|300907443|ref|ZP_07125090.1| ComF family protein [Escherichia coli MS 84-1]
 gi|301302292|ref|ZP_07208424.1| ComF family protein [Escherichia coli MS 124-1]
 gi|291468478|gb|EFF10971.1| gluconate periplasmic binding protein [Escherichia coli B354]
 gi|300400858|gb|EFJ84396.1| ComF family protein [Escherichia coli MS 84-1]
 gi|300842455|gb|EFK70215.1| ComF family protein [Escherichia coli MS 124-1]
 gi|315256004|gb|EFU35972.1| ComF family protein [Escherichia coli MS 85-1]
          Length = 227

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|293406991|ref|ZP_06650915.1| gluconate periplasmic binding protein [Escherichia coli FVEC1412]
 gi|298382733|ref|ZP_06992328.1| gluconate periplasmic binding protein [Escherichia coli FVEC1302]
 gi|291425802|gb|EFE98836.1| gluconate periplasmic binding protein [Escherichia coli FVEC1412]
 gi|298276569|gb|EFI18087.1| gluconate periplasmic binding protein [Escherichia coli FVEC1302]
          Length = 215

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|293453719|ref|ZP_06664138.1| gluconate periplasmic binding protein [Escherichia coli B088]
 gi|291321845|gb|EFE61276.1| gluconate periplasmic binding protein [Escherichia coli B088]
          Length = 227

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|284822068|gb|ADB98038.1| gluconate periplasmic binding protein [Escherichia coli]
          Length = 243

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 191 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 243


>gi|281180445|dbj|BAI56775.1| conserved hypothetical protein [Escherichia coli SE15]
          Length = 227

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|297565213|ref|YP_003684185.1| ribose-phosphate pyrophosphokinase [Meiothermus silvanus DSM 9946]
 gi|296849662|gb|ADH62677.1| ribose-phosphate pyrophosphokinase [Meiothermus silvanus DSM 9946]
          Length = 361

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 19/48 (39%), Positives = 29/48 (60%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           YV   VAG + LLIDD+ +TG T +    AL  AGA+  +I+  + ++
Sbjct: 257 YVIGDVAGKRPLLIDDIISTGGTIRRGVEALLAAGALPEAIVMATHAV 304


>gi|227883547|ref|ZP_04001352.1| competence protein F [Escherichia coli 83972]
 gi|227839426|gb|EEJ49892.1| competence protein F [Escherichia coli 83972]
 gi|320185944|gb|EFW60693.1| gluconate periplasmic binding protein [Shigella flexneri CDC
           796-83]
 gi|332090224|gb|EGI95322.1| protein gntX [Shigella boydii 3594-74]
          Length = 215

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|222035114|emb|CAP77859.1| Protein gntX [Escherichia coli LF82]
 gi|312947961|gb|ADR28788.1| gluconate periplasmic binding protein [Escherichia coli O83:H1 str.
           NRG 857C]
          Length = 227

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|218707004|ref|YP_002414523.1| gluconate periplasmic binding protein [Escherichia coli UMN026]
 gi|300898898|ref|ZP_07117199.1| ComF family protein [Escherichia coli MS 198-1]
 gi|331665019|ref|ZP_08365920.1| protein GntX [Escherichia coli TA143]
 gi|218434101|emb|CAR15018.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli UMN026]
 gi|284923405|emb|CBG36499.1| putative competence protein [Escherichia coli 042]
 gi|300357460|gb|EFJ73330.1| ComF family protein [Escherichia coli MS 198-1]
 gi|331057529|gb|EGI29515.1| protein GntX [Escherichia coli TA143]
          Length = 227

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|218691689|ref|YP_002399901.1| gluconate periplasmic binding protein [Escherichia coli ED1a]
 gi|306816249|ref|ZP_07450387.1| gluconate periplasmic binding protein [Escherichia coli NC101]
 gi|218429253|emb|CAR10064.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli ED1a]
 gi|305850645|gb|EFM51102.1| gluconate periplasmic binding protein [Escherichia coli NC101]
 gi|320197372|gb|EFW71987.1| gluconate periplasmic binding protein [Escherichia coli WV_060327]
          Length = 227

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|215488694|ref|YP_002331125.1| gluconate periplasmic binding protein [Escherichia coli O127:H6
           str. E2348/69]
 gi|215266766|emb|CAS11206.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli O127:H6 str. E2348/69]
          Length = 227

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|194435591|ref|ZP_03067694.1| protein GntX [Escherichia coli 101-1]
 gi|194425134|gb|EDX41118.1| protein GntX [Escherichia coli 101-1]
          Length = 248

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 196 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 248


>gi|193061813|ref|ZP_03042910.1| protein GntX [Escherichia coli E22]
 gi|194427043|ref|ZP_03059595.1| protein GntX [Escherichia coli B171]
 gi|260846197|ref|YP_003223975.1| gluconate periplasmic binding protein GntX [Escherichia coli
           O103:H2 str. 12009]
 gi|192932603|gb|EDV85200.1| protein GntX [Escherichia coli E22]
 gi|194415004|gb|EDX31274.1| protein GntX [Escherichia coli B171]
 gi|257761344|dbj|BAI32841.1| gluconate periplasmic binding protein GntX [Escherichia coli
           O103:H2 str. 12009]
          Length = 227

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|189401819|ref|ZP_02778173.2| protein GntX [Escherichia coli O157:H7 str. EC4401]
 gi|189405505|ref|ZP_02822191.2| protein GntX [Escherichia coli O157:H7 str. EC508]
 gi|189358967|gb|EDU77386.1| protein GntX [Escherichia coli O157:H7 str. EC4401]
 gi|189380059|gb|EDU98475.1| protein GntX [Escherichia coli O157:H7 str. EC508]
 gi|320191575|gb|EFW66225.1| gluconate periplasmic binding protein [Escherichia coli O157:H7
           str. EC1212]
 gi|326337623|gb|EGD61458.1| gluconate periplasmic binding protein [Escherichia coli O157:H7
           str. 1044]
 gi|326344626|gb|EGD68375.1| gluconate periplasmic binding protein [Escherichia coli O157:H7
           str. 1125]
          Length = 215

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|187775692|ref|ZP_02992680.1| protein GntX [Escherichia coli O157:H7 str. EC4196]
 gi|188024504|ref|ZP_02772131.2| protein GntX [Escherichia coli O157:H7 str. EC4113]
 gi|189010096|ref|ZP_02804504.2| protein GntX [Escherichia coli O157:H7 str. EC4076]
 gi|189402773|ref|ZP_02790768.2| protein GntX [Escherichia coli O157:H7 str. EC4486]
 gi|189403746|ref|ZP_02784445.2| protein GntX [Escherichia coli O157:H7 str. EC4501]
 gi|189404697|ref|ZP_02810225.2| protein GntX [Escherichia coli O157:H7 str. EC869]
 gi|208809535|ref|ZP_03251872.1| protein GntX [Escherichia coli O157:H7 str. EC4206]
 gi|208813850|ref|ZP_03255179.1| protein GntX [Escherichia coli O157:H7 str. EC4045]
 gi|208821693|ref|ZP_03262013.1| protein GntX [Escherichia coli O157:H7 str. EC4042]
 gi|209396165|ref|YP_002272849.1| protein GntX [Escherichia coli O157:H7 str. EC4115]
 gi|217324234|ref|ZP_03440318.1| protein GntX [Escherichia coli O157:H7 str. TW14588]
 gi|187771691|gb|EDU35535.1| protein GntX [Escherichia coli O157:H7 str. EC4196]
 gi|188018351|gb|EDU56473.1| protein GntX [Escherichia coli O157:H7 str. EC4113]
 gi|189002345|gb|EDU71331.1| protein GntX [Escherichia coli O157:H7 str. EC4076]
 gi|189364761|gb|EDU83180.1| protein GntX [Escherichia coli O157:H7 str. EC4486]
 gi|189369879|gb|EDU88295.1| protein GntX [Escherichia coli O157:H7 str. EC4501]
 gi|189374500|gb|EDU92916.1| protein GntX [Escherichia coli O157:H7 str. EC869]
 gi|208729336|gb|EDZ78937.1| protein GntX [Escherichia coli O157:H7 str. EC4206]
 gi|208735127|gb|EDZ83814.1| protein GntX [Escherichia coli O157:H7 str. EC4045]
 gi|208741816|gb|EDZ89498.1| protein GntX [Escherichia coli O157:H7 str. EC4042]
 gi|209157565|gb|ACI34998.1| protein GntX [Escherichia coli O157:H7 str. EC4115]
 gi|217320455|gb|EEC28879.1| protein GntX [Escherichia coli O157:H7 str. TW14588]
          Length = 248

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 196 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 248


>gi|187733952|ref|YP_001882092.1| gluconate periplasmic binding protein [Shigella boydii CDC 3083-94]
 gi|187430944|gb|ACD10218.1| protein GntX [Shigella boydii CDC 3083-94]
          Length = 227

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|170681819|ref|YP_001745661.1| gluconate periplasmic binding protein [Escherichia coli SMS-3-5]
 gi|170519537|gb|ACB17715.1| protein GntX [Escherichia coli SMS-3-5]
          Length = 227

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|157158776|ref|YP_001464871.1| gluconate periplasmic binding protein [Escherichia coli E24377A]
 gi|157080806|gb|ABV20514.1| protein GntX [Escherichia coli E24377A]
          Length = 227

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|157162890|ref|YP_001460208.1| gluconate periplasmic binding protein [Escherichia coli HS]
 gi|161986432|ref|YP_312335.2| gluconate periplasmic binding protein [Shigella sonnei Ss046]
 gi|191167292|ref|ZP_03029109.1| protein GntX [Escherichia coli B7A]
 gi|191167880|ref|ZP_03029684.1| protein GntX [Escherichia coli B7A]
 gi|209920871|ref|YP_002294955.1| gluconate periplasmic binding protein [Escherichia coli SE11]
 gi|218555962|ref|YP_002388875.1| gluconate periplasmic binding protein [Escherichia coli IAI1]
 gi|254163341|ref|YP_003046449.1| gluconate periplasmic binding protein [Escherichia coli B str.
           REL606]
 gi|297516951|ref|ZP_06935337.1| gluconate periplasmic binding protein [Escherichia coli OP50]
 gi|300926896|ref|ZP_07142662.1| ComF family protein [Escherichia coli MS 182-1]
 gi|300931054|ref|ZP_07146410.1| ComF family protein [Escherichia coli MS 187-1]
 gi|309794684|ref|ZP_07689106.1| ComF family protein [Escherichia coli MS 145-7]
 gi|331670235|ref|ZP_08371074.1| protein GntX [Escherichia coli TA271]
 gi|157068570|gb|ABV07825.1| protein GntX [Escherichia coli HS]
 gi|190902053|gb|EDV61798.1| protein GntX [Escherichia coli B7A]
 gi|190902644|gb|EDV62376.1| protein GntX [Escherichia coli B7A]
 gi|209914130|dbj|BAG79204.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|218362730|emb|CAR00356.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli IAI1]
 gi|242378936|emb|CAQ33734.1| protein involved in utilization of DNA as a carbon source
           [Escherichia coli BL21(DE3)]
 gi|253975242|gb|ACT40913.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli B str. REL606]
 gi|253979398|gb|ACT45068.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli BL21(DE3)]
 gi|300417100|gb|EFK00411.1| ComF family protein [Escherichia coli MS 182-1]
 gi|300461109|gb|EFK24602.1| ComF family protein [Escherichia coli MS 187-1]
 gi|308121734|gb|EFO58996.1| ComF family protein [Escherichia coli MS 145-7]
 gi|323939367|gb|EGB35578.1| comF family protein [Escherichia coli E482]
 gi|323959587|gb|EGB55239.1| comF family protein [Escherichia coli H489]
 gi|324018650|gb|EGB87869.1| ComF family protein [Escherichia coli MS 117-3]
 gi|324116390|gb|EGC10309.1| comF family protein [Escherichia coli E1167]
 gi|331062297|gb|EGI34217.1| protein GntX [Escherichia coli TA271]
          Length = 227

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|170018351|ref|YP_001723305.1| gluconate periplasmic binding protein [Escherichia coli ATCC 8739]
 gi|169753279|gb|ACA75978.1| comF family protein [Escherichia coli ATCC 8739]
          Length = 227

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|110643646|ref|YP_671376.1| gluconate periplasmic binding protein [Escherichia coli 536]
 gi|191171572|ref|ZP_03033120.1| protein GntX [Escherichia coli F11]
 gi|300987299|ref|ZP_07178107.1| ComF family protein [Escherichia coli MS 200-1]
 gi|110345238|gb|ABG71475.1| putative amidophosphoribosyltransferase [Escherichia coli 536]
 gi|190908199|gb|EDV67790.1| protein GntX [Escherichia coli F11]
 gi|300306167|gb|EFJ60687.1| ComF family protein [Escherichia coli MS 200-1]
 gi|324014595|gb|EGB83814.1| ComF family protein [Escherichia coli MS 60-1]
          Length = 227

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|237703143|ref|ZP_04533624.1| gluconate periplasmic binding protein [Escherichia sp. 3_2_53FAA]
 gi|91074462|gb|ABE09343.1| hypothetical protein YhgH [Escherichia coli UTI89]
 gi|226902407|gb|EEH88666.1| gluconate periplasmic binding protein [Escherichia sp. 3_2_53FAA]
          Length = 248

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 196 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 248


>gi|323179061|gb|EFZ64635.1| protein gntX [Escherichia coli 1180]
 gi|325498955|gb|EGC96814.1| gluconate periplasmic binding protein [Escherichia fergusonii
           ECD227]
 gi|332086008|gb|EGI91172.1| protein gntX [Shigella dysenteriae 155-74]
 gi|332751297|gb|EGJ81700.1| protein gntX [Shigella flexneri 2747-71]
 gi|332763600|gb|EGJ93839.1| comF family protein [Shigella flexneri 2930-71]
 gi|332996635|gb|EGK16260.1| protein gntX [Shigella flexneri K-272]
 gi|333012517|gb|EGK31898.1| protein gntX [Shigella flexneri K-304]
 gi|333013044|gb|EGK32420.1| protein gntX [Shigella flexneri K-227]
          Length = 215

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|323188997|gb|EFZ74281.1| protein gntX [Escherichia coli RN587/1]
          Length = 215

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|323162798|gb|EFZ48635.1| protein gntX [Escherichia coli E128010]
 gi|323944365|gb|EGB40440.1| comF family protein [Escherichia coli H120]
          Length = 215

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|301329724|ref|ZP_07222467.1| ComF family protein [Escherichia coli MS 78-1]
 gi|312972323|ref|ZP_07786497.1| protein gntX [Escherichia coli 1827-70]
 gi|300844196|gb|EFK71956.1| ComF family protein [Escherichia coli MS 78-1]
 gi|310334700|gb|EFQ00905.1| protein gntX [Escherichia coli 1827-70]
 gi|323164977|gb|EFZ50768.1| protein gntX [Shigella sonnei 53G]
 gi|323970011|gb|EGB65286.1| comF family protein [Escherichia coli TA007]
          Length = 215

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|117625678|ref|YP_859001.1| gluconate periplasmic binding protein [Escherichia coli APEC O1]
 gi|81247180|gb|ABB67888.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|115514802|gb|ABJ02877.1| conserved hypothetical protein [Escherichia coli APEC O1]
          Length = 243

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 191 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 243


>gi|331679477|ref|ZP_08380147.1| protein GntX [Escherichia coli H591]
 gi|73857392|gb|AAZ90099.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|331072649|gb|EGI43974.1| protein GntX [Escherichia coli H591]
          Length = 243

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 191 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 243


>gi|110807248|ref|YP_690768.1| gluconate periplasmic binding protein [Shigella flexneri 5 str.
           8401]
 gi|332281959|ref|ZP_08394372.1| conserved hypothetical protein [Shigella sp. D9]
 gi|30043564|gb|AAP19284.1| hypothetical protein S4330 [Shigella flexneri 2a str. 2457T]
 gi|56383886|gb|AAN44897.2| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|110616796|gb|ABF05463.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|281602767|gb|ADA75751.1| gluconate periplasmic binding protein [Shigella flexneri 2002017]
 gi|332104311|gb|EGJ07657.1| conserved hypothetical protein [Shigella sp. D9]
          Length = 243

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 191 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 243


>gi|26110443|gb|AAN82628.1|AE016768_46 Hypothetical protein yhgH [Escherichia coli CFT073]
          Length = 248

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 196 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 248


>gi|161486090|ref|NP_756054.2| gluconate periplasmic binding protein [Escherichia coli CFT073]
 gi|161984841|ref|YP_409717.2| gluconate periplasmic binding protein [Shigella boydii Sb227]
 gi|162138354|ref|YP_542874.2| gluconate periplasmic binding protein [Escherichia coli UTI89]
 gi|218560471|ref|YP_002393384.1| gluconate periplasmic binding protein [Escherichia coli S88]
 gi|218702158|ref|YP_002409787.1| gluconate periplasmic binding protein [Escherichia coli IAI39]
 gi|293416815|ref|ZP_06659452.1| gluconate periplasmic binding protein [Escherichia coli B185]
 gi|300937288|ref|ZP_07152131.1| ComF family protein [Escherichia coli MS 21-1]
 gi|301050375|ref|ZP_07197264.1| ComF family protein [Escherichia coli MS 185-1]
 gi|331659702|ref|ZP_08360640.1| protein GntX [Escherichia coli TA206]
 gi|51701423|sp|Q8FCT3|GNTX_ECOL6 RecName: Full=Protein GntX
 gi|218367240|emb|CAR05014.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli S88]
 gi|218372144|emb|CAR20006.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli IAI39]
 gi|291431391|gb|EFF04376.1| gluconate periplasmic binding protein [Escherichia coli B185]
 gi|294492334|gb|ADE91090.1| protein GntX [Escherichia coli IHE3034]
 gi|300298004|gb|EFJ54389.1| ComF family protein [Escherichia coli MS 185-1]
 gi|300457647|gb|EFK21140.1| ComF family protein [Escherichia coli MS 21-1]
 gi|307555499|gb|ADN48274.1| protein GntX [Escherichia coli ABU 83972]
 gi|307628475|gb|ADN72779.1| gluconate periplasmic binding protein [Escherichia coli UM146]
 gi|315286087|gb|EFU45525.1| ComF family protein [Escherichia coli MS 110-3]
 gi|315291746|gb|EFU51102.1| ComF family protein [Escherichia coli MS 153-1]
 gi|315295926|gb|EFU55235.1| ComF family protein [Escherichia coli MS 16-3]
 gi|323950070|gb|EGB45953.1| comF family protein [Escherichia coli H252]
 gi|323954650|gb|EGB50432.1| comF family protein [Escherichia coli H263]
 gi|324009391|gb|EGB78610.1| ComF family protein [Escherichia coli MS 57-2]
 gi|331052917|gb|EGI24950.1| protein GntX [Escherichia coli TA206]
 gi|332345366|gb|AEE58700.1| conserved hypothetical protein [Escherichia coli UMNK88]
          Length = 227

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|161367506|ref|NP_289953.2| gluconate periplasmic binding protein [Escherichia coli O157:H7
           EDL933]
 gi|162139751|ref|NP_312282.2| gluconate periplasmic binding protein [Escherichia coli O157:H7
           str. Sakai]
 gi|195934902|ref|ZP_03080284.1| gluconate periplasmic binding protein [Escherichia coli O157:H7
           str. EC4024]
 gi|254795328|ref|YP_003080165.1| gluconate periplasmic binding protein [Escherichia coli O157:H7
           str. TW14359]
 gi|261224694|ref|ZP_05938975.1| gluconate periplasmic binding protein [Escherichia coli O157:H7
           str. FRIK2000]
 gi|261254411|ref|ZP_05946944.1| gluconate periplasmic binding protein [Escherichia coli O157:H7
           str. FRIK966]
 gi|291284749|ref|YP_003501567.1| gluconate periplasmic binding protein [Escherichia coli O55:H7 str.
           CB9615]
 gi|51701438|sp|Q8X715|GNTX_ECO57 RecName: Full=Protein GntX
 gi|254594728|gb|ACT74089.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli O157:H7 str. TW14359]
 gi|290764622|gb|ADD58583.1| gluconate periplasmic binding protein [Escherichia coli O55:H7 str.
           CB9615]
 gi|320645193|gb|EFX14209.1| DNA utilization protein GntX [Escherichia coli O157:H- str. 493-89]
 gi|320650504|gb|EFX18970.1| DNA utilization protein GntX [Escherichia coli O157:H- str. H 2687]
 gi|320655696|gb|EFX23619.1| DNA utilization protein GntX [Escherichia coli O55:H7 str. 3256-97
           TW 07815]
 gi|320661480|gb|EFX28895.1| DNA utilization protein GntX [Escherichia coli O55:H7 str. USDA
           5905]
 gi|320666503|gb|EFX33486.1| DNA utilization protein GntX [Escherichia coli O157:H7 str. LSU-61]
          Length = 227

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|161485822|ref|NP_709190.3| gluconate periplasmic binding protein [Shigella flexneri 2a str.
           301]
 gi|161486382|ref|NP_839473.2| gluconate periplasmic binding protein [Shigella flexneri 2a str.
           2457T]
 gi|193068814|ref|ZP_03049774.1| protein GntX [Escherichia coli E110019]
 gi|194431130|ref|ZP_03063423.1| protein GntX [Shigella dysenteriae 1012]
 gi|218550671|ref|YP_002384462.1| gluconate periplasmic binding protein [Escherichia fergusonii ATCC
           35469]
 gi|218697096|ref|YP_002404763.1| gluconate periplasmic binding protein [Escherichia coli 55989]
 gi|256020758|ref|ZP_05434623.1| gluconate periplasmic binding protein [Shigella sp. D9]
 gi|260857520|ref|YP_003231411.1| gluconate periplasmic binding protein GntX [Escherichia coli
           O26:H11 str. 11368]
 gi|260870139|ref|YP_003236541.1| gluconate periplasmic binding protein GntX [Escherichia coli
           O111:H- str. 11128]
 gi|307311922|ref|ZP_07591560.1| comF family protein [Escherichia coli W]
 gi|51701421|sp|Q83J92|GNTX_SHIFL RecName: Full=Protein GntX
 gi|192957890|gb|EDV88333.1| protein GntX [Escherichia coli E110019]
 gi|194420585|gb|EDX36661.1| protein GntX [Shigella dysenteriae 1012]
 gi|218353828|emb|CAV00184.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli 55989]
 gi|218358212|emb|CAQ90859.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia fergusonii ATCC 35469]
 gi|257756169|dbj|BAI27671.1| gluconate periplasmic binding protein GntX [Escherichia coli
           O26:H11 str. 11368]
 gi|257766495|dbj|BAI37990.1| gluconate periplasmic binding protein GntX [Escherichia coli
           O111:H- str. 11128]
 gi|306908066|gb|EFN38566.1| comF family protein [Escherichia coli W]
 gi|313647285|gb|EFS11737.1| protein gntX [Shigella flexneri 2a str. 2457T]
 gi|315062691|gb|ADT77018.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli W]
 gi|320199586|gb|EFW74176.1| gluconate periplasmic binding protein [Escherichia coli EC4100B]
 gi|323154248|gb|EFZ40451.1| protein gntX [Escherichia coli EPECa14]
 gi|323376721|gb|ADX48989.1| comF family protein [Escherichia coli KO11]
 gi|324111726|gb|EGC05706.1| comF family protein [Escherichia fergusonii B253]
 gi|332749485|gb|EGJ79902.1| protein gntX [Shigella flexneri K-671]
 gi|332750332|gb|EGJ80743.1| protein gntX [Shigella flexneri 4343-70]
 gi|332996396|gb|EGK16023.1| protein gntX [Shigella flexneri VA-6]
 gi|332997062|gb|EGK16678.1| protein gntX [Shigella flexneri K-218]
          Length = 227

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|12518043|gb|AAG58514.1|AE005563_8 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|13363729|dbj|BAB37678.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|209756448|gb|ACI76536.1| hypothetical protein ECs4254 [Escherichia coli]
 gi|209756450|gb|ACI76537.1| hypothetical protein ECs4254 [Escherichia coli]
 gi|209756452|gb|ACI76538.1| hypothetical protein ECs4254 [Escherichia coli]
 gi|209756454|gb|ACI76539.1| hypothetical protein ECs4254 [Escherichia coli]
 gi|209756456|gb|ACI76540.1| hypothetical protein ECs4254 [Escherichia coli]
          Length = 243

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 191 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 243


>gi|288573970|ref|ZP_06392327.1| phosphoribosyltransferase [Dethiosulfovibrio peptidovorans DSM
           11002]
 gi|288569711|gb|EFC91268.1| phosphoribosyltransferase [Dethiosulfovibrio peptidovorans DSM
           11002]
          Length = 182

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 16/35 (45%), Positives = 25/35 (71%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVS 49
           + G K+ L+DDV +TGA+ + A   L +AGA+TV+
Sbjct: 119 IRGRKVCLVDDVVSTGASLRSARQILDRAGAITVA 153


>gi|300770632|ref|ZP_07080511.1| amidophosphoribosyltransferase [Sphingobacterium spiritivorum
          ATCC 33861]
 gi|300763108|gb|EFK59925.1| amidophosphoribosyltransferase [Sphingobacterium spiritivorum
          ATCC 33861]
          Length = 84

 Score = 34.3 bits (77), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 27/54 (50%), Gaps = 5/54 (9%)

Query: 3  NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
          +  N      KH     ILL+DDV TTGAT   AA  L     + VSI T +R+
Sbjct: 36 DILNKEALTDKH-----ILLVDDVLTTGATLASAARTLTGISGVRVSIATLARA 84


>gi|237810690|ref|YP_002895141.1| ComF family protein [Burkholderia pseudomallei MSHR346]
 gi|237505062|gb|ACQ97380.1| ComF family protein [Burkholderia pseudomallei MSHR346]
          Length = 255

 Score = 34.3 bits (77), Expect = 5.8,   Method: Composition-based stats.
 Identities = 19/43 (44%), Positives = 26/43 (60%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           GL + ++DDV T+GAT    A  LK+AGA  V+     R+ KD
Sbjct: 213 GLHVGVVDDVMTSGATLDALARTLKEAGARHVTNFVALRTAKD 255


>gi|257870236|ref|ZP_05649889.1| competence protein F [Enterococcus gallinarum EG2]
 gi|257804400|gb|EEV33222.1| competence protein F [Enterococcus gallinarum EG2]
          Length = 224

 Score = 34.3 bits (77), Expect = 5.8,   Method: Composition-based stats.
 Identities = 16/37 (43%), Positives = 23/37 (62%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++LL+DDVYTTG T   AA  L      T++  +F+R
Sbjct: 188 RVLLVDDVYTTGQTIYHAAEVLLTCQPKTITSFSFAR 224


>gi|322690809|ref|YP_004220379.1| hypothetical protein BLLJ_0619 [Bifidobacterium longum subsp.
           longum JCM 1217]
 gi|320455665|dbj|BAJ66287.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           longum JCM 1217]
          Length = 240

 Score = 34.3 bits (77), Expect = 5.9,   Method: Composition-based stats.
 Identities = 15/41 (36%), Positives = 25/41 (60%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           G  +LL+DD+ TTGAT +    A ++AG   V +L  + ++
Sbjct: 190 GDAVLLVDDIVTTGATVRQCVQAFQQAGTKVVGVLVLADAV 230


>gi|227546169|ref|ZP_03976218.1| phosphoribosyltransferase [Bifidobacterium longum subsp. infantis
           ATCC 55813]
 gi|239621789|ref|ZP_04664820.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis CCUG 52486]
 gi|227213150|gb|EEI81022.1| phosphoribosyltransferase [Bifidobacterium longum subsp. infantis
           ATCC 55813]
 gi|239514980|gb|EEQ54847.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis CCUG 52486]
          Length = 240

 Score = 34.3 bits (77), Expect = 6.0,   Method: Composition-based stats.
 Identities = 15/41 (36%), Positives = 25/41 (60%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           G  +LL+DD+ TTGAT +    A ++AG   V +L  + ++
Sbjct: 190 GDAVLLVDDIVTTGATVRQCVQAFQQAGTKVVGVLVLADAV 230


>gi|189501156|ref|YP_001960626.1| phosphoribosyltransferase [Chlorobium phaeobacteroides BS1]
 gi|189496597|gb|ACE05145.1| phosphoribosyltransferase [Chlorobium phaeobacteroides BS1]
          Length = 230

 Score = 34.3 bits (77), Expect = 6.0,   Method: Composition-based stats.
 Identities = 17/35 (48%), Positives = 22/35 (62%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ILL+DDV TTGAT      AL+  GA  +S+ T +
Sbjct: 193 ILLVDDVLTTGATVSAVKNALESEGAEHISLATIA 227


>gi|301308349|ref|ZP_07214303.1| competence protein [Bacteroides sp. 20_3]
 gi|300833819|gb|EFK64435.1| competence protein [Bacteroides sp. 20_3]
          Length = 108

 Score = 34.3 bits (77), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 24/44 (54%), Gaps = 3/44 (6%)

Query: 14  HVAGLK---ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           H   LK   ILLIDDV TTGAT    A AL     + +SIL  S
Sbjct: 63  HPESLKNKHILLIDDVITTGATISACAKALSGIPGIRISILALS 106


>gi|296129459|ref|YP_003636709.1| ATP-dependent DNA helicase, RecQ family [Cellulomonas flavigena DSM
           20109]
 gi|296021274|gb|ADG74510.1| ATP-dependent DNA helicase, RecQ family [Cellulomonas flavigena DSM
           20109]
          Length = 733

 Score = 34.3 bits (77), Expect = 6.2,   Method: Composition-based stats.
 Identities = 18/44 (40%), Positives = 26/44 (59%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
            ++P  V+  VAG ++LL+DD   TG T   A   L++AGA  V
Sbjct: 682 LDLPDDVAVAVAGQRVLLVDDRTDTGWTLTVAGRLLRRAGATQV 725


>gi|116334782|ref|YP_796309.1| orotate phosphoribosyltransferase [Lactobacillus brevis ATCC 367]
 gi|122268539|sp|Q03NE4|PYRE_LACBA RecName: Full=Orotate phosphoribosyltransferase; Short=OPRT;
           Short=OPRTase
 gi|116100129|gb|ABJ65278.1| orotate phosphoribosyltransferase [Lactobacillus brevis ATCC 367]
          Length = 210

 Score = 34.3 bits (77), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 9   QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT-FSRSLKD 59
           Q   +  A  +++LIDD+ +TG +   AA A++KAGA  + ++  FS  L D
Sbjct: 107 QIEGQMTASDQVVLIDDLISTGGSVLAAAKAVRKAGATVLGVVAIFSYELPD 158


>gi|150015321|ref|YP_001307575.1| ComF protein [Clostridium beijerinckii NCIMB 8052]
 gi|149901786|gb|ABR32619.1| ComF protein [Clostridium beijerinckii NCIMB 8052]
          Length = 218

 Score = 34.3 bits (77), Expect = 6.3,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +++AF + + +   +    I+L+DDV TTGAT K A   L+K     + +LT ++S
Sbjct: 163 IKDAFKIKKGL--EIGKYNIILVDDVTTTGATLKEAYKLLRKYQVKDIKLLTLAKS 216


>gi|319897928|ref|YP_004136125.1| hypothetical protein HIBPF17711 [Haemophilus influenzae F3031]
 gi|317433434|emb|CBY81815.1| conserved hypothetical protein [Haemophilus influenzae F3031]
          Length = 188

 Score = 34.3 bits (77), Expect = 6.4,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 27/42 (64%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + G  ILLIDD+Y +G+T + +   L   GA +VS+L  +++
Sbjct: 145 IKGRNILLIDDLYESGSTLEASTNILLINGASSVSVLAMTKT 186


>gi|166030540|ref|ZP_02233369.1| hypothetical protein DORFOR_00201 [Dorea formicigenerans ATCC
           27755]
 gi|166029702|gb|EDR48459.1| hypothetical protein DORFOR_00201 [Dorea formicigenerans ATCC
           27755]
          Length = 266

 Score = 34.3 bits (77), Expect = 6.4,   Method: Composition-based stats.
 Identities = 16/36 (44%), Positives = 21/36 (58%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++++IDD+YTTG T    A  LK  G   V  LT S
Sbjct: 226 RVIIIDDIYTTGNTVDQVAKVLKTMGFQKVYFLTIS 261


>gi|326202852|ref|ZP_08192719.1| phosphoribosyltransferase [Clostridium papyrosolvens DSM 2782]
 gi|325986929|gb|EGD47758.1| phosphoribosyltransferase [Clostridium papyrosolvens DSM 2782]
          Length = 223

 Score = 34.3 bits (77), Expect = 6.4,   Method: Composition-based stats.
 Identities = 18/34 (52%), Positives = 22/34 (64%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           +A   ILLIDD+ TTG+T      ALK+AGA  V
Sbjct: 179 IADKNILLIDDIVTTGSTVNQCCKALKQAGAEKV 212


>gi|319900815|ref|YP_004160543.1| phosphoribosyltransferase [Bacteroides helcogenes P 36-108]
 gi|319415846|gb|ADV42957.1| phosphoribosyltransferase [Bacteroides helcogenes P 36-108]
          Length = 234

 Score = 34.3 bits (77), Expect = 6.4,   Method: Composition-based stats.
 Identities = 15/35 (42%), Positives = 22/35 (62%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +L++DDV TTGAT    A A +    + +SILT +
Sbjct: 196 VLIVDDVLTTGATVTACADAFRGVEGIRISILTLA 230


>gi|315658895|ref|ZP_07911762.1| competence protein FC [Staphylococcus lugdunensis M23590]
 gi|315496019|gb|EFU84347.1| competence protein FC [Staphylococcus lugdunensis M23590]
          Length = 224

 Score = 34.3 bits (77), Expect = 6.4,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 8   PQYVSKHV--AGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           P Y+S  +     +ILL+DD+YTTG T   A   L +      S+ TF+R
Sbjct: 175 PFYISLDIDLTNKEILLVDDIYTTGLTIHHAGCKLLENKVRKFSVYTFAR 224


>gi|145294920|ref|YP_001137741.1| hypothetical protein cgR_0866 [Corynebacterium glutamicum R]
 gi|140844840|dbj|BAF53839.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 196

 Score = 34.3 bits (77), Expect = 6.4,   Method: Composition-based stats.
 Identities = 16/37 (43%), Positives = 23/37 (62%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +L+IDDV TTGAT   +A  L+ AG      LT+ ++
Sbjct: 160 VLIIDDVVTTGATISASANVLRAAGVQVRGALTYCQA 196


>gi|159041318|ref|YP_001540570.1| phosphoribosyltransferase [Caldivirga maquilingensis IC-167]
 gi|157920153|gb|ABW01580.1| phosphoribosyltransferase [Caldivirga maquilingensis IC-167]
          Length = 191

 Score = 34.3 bits (77), Expect = 6.4,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 25/47 (53%)

Query: 7   VPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           + Q +   V GL++LL+DDV  TG T   A   LK+ GA  +   T 
Sbjct: 79  IAQPLPVSVKGLRVLLVDDVSDTGTTLSTAYNYLKEQGAAEIKTATL 125


>gi|23308802|ref|NP_694638.1| hypothetical protein NCgl0724 [Corynebacterium glutamicum ATCC
           13032]
 gi|62389645|ref|YP_225047.1| hypothetical protein cg0866 [Corynebacterium glutamicum ATCC 13032]
 gi|21323523|dbj|BAB98150.1| Predicted amidophosphoribosyltransferases [Corynebacterium
           glutamicum ATCC 13032]
 gi|41324980|emb|CAF19461.1| Purine/pyrimidine phosphoribosyl transferase [Corynebacterium
           glutamicum ATCC 13032]
          Length = 196

 Score = 34.3 bits (77), Expect = 6.4,   Method: Composition-based stats.
 Identities = 16/37 (43%), Positives = 23/37 (62%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +L+IDDV TTGAT   +A  L+ AG      LT+ ++
Sbjct: 160 VLIIDDVVTTGATISASANVLRAAGVQVRGALTYCQA 196


>gi|294777683|ref|ZP_06743134.1| ComF family protein [Bacteroides vulgatus PC510]
 gi|319640269|ref|ZP_07994994.1| amidophosphoribosyl-transferase [Bacteroides sp. 3_1_40A]
 gi|294448751|gb|EFG17300.1| ComF family protein [Bacteroides vulgatus PC510]
 gi|317388044|gb|EFV68898.1| amidophosphoribosyl-transferase [Bacteroides sp. 3_1_40A]
          Length = 231

 Score = 33.9 bits (76), Expect = 6.7,   Method: Composition-based stats.
 Identities = 16/38 (42%), Positives = 23/38 (60%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           G  +LL+DDV TTGAT    A A +    + +S+LT +
Sbjct: 189 GKHLLLVDDVLTTGATVVSCADAFRGIPGLRISVLTLA 226


>gi|254881267|ref|ZP_05253977.1| conserved hypothetical protein [Bacteroides sp. 4_3_47FAA]
 gi|254834060|gb|EET14369.1| conserved hypothetical protein [Bacteroides sp. 4_3_47FAA]
          Length = 231

 Score = 33.9 bits (76), Expect = 6.7,   Method: Composition-based stats.
 Identities = 16/38 (42%), Positives = 23/38 (60%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           G  +LL+DDV TTGAT    A A +    + +S+LT +
Sbjct: 189 GKHLLLVDDVLTTGATVVSCADAFRGIPGLRISVLTLA 226


>gi|237711581|ref|ZP_04542062.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|265753009|ref|ZP_06088578.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
 gi|229454276|gb|EEO59997.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|263236195|gb|EEZ21690.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
          Length = 231

 Score = 33.9 bits (76), Expect = 6.7,   Method: Composition-based stats.
 Identities = 16/38 (42%), Positives = 23/38 (60%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           G  +LL+DDV TTGAT    A A +    + +S+LT +
Sbjct: 189 GKHLLLVDDVLTTGATVVSCADAFRGIPGLRISVLTLA 226


>gi|237725966|ref|ZP_04556447.1| conserved hypothetical protein [Bacteroides sp. D4]
 gi|229435774|gb|EEO45851.1| conserved hypothetical protein [Bacteroides dorei 5_1_36/D4]
          Length = 231

 Score = 33.9 bits (76), Expect = 6.7,   Method: Composition-based stats.
 Identities = 16/38 (42%), Positives = 23/38 (60%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           G  +LL+DDV TTGAT    A A +    + +S+LT +
Sbjct: 189 GKHLLLVDDVLTTGATVVSCADAFRGIPGLRISVLTLA 226


>gi|150003434|ref|YP_001298178.1| putative amidophosphoribosyl-transferase [Bacteroides vulgatus ATCC
           8482]
 gi|149931858|gb|ABR38556.1| putative amidophosphoribosyl-transferase [Bacteroides vulgatus ATCC
           8482]
          Length = 231

 Score = 33.9 bits (76), Expect = 6.7,   Method: Composition-based stats.
 Identities = 16/38 (42%), Positives = 23/38 (60%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           G  +LL+DDV TTGAT    A A +    + +S+LT +
Sbjct: 189 GKHLLLVDDVLTTGATVVSCADAFRGIPGLRISVLTLA 226


>gi|228473984|ref|ZP_04058725.1| phosphoribosyltransferases family protein [Capnocytophaga
           gingivalis ATCC 33624]
 gi|228274498|gb|EEK13339.1| phosphoribosyltransferases family protein [Capnocytophaga
           gingivalis ATCC 33624]
          Length = 233

 Score = 33.9 bits (76), Expect = 6.7,   Method: Composition-based stats.
 Identities = 15/41 (36%), Positives = 26/41 (63%), Gaps = 1/41 (2%)

Query: 15  VAGLKILLIDDVYTTGAT-AKCAAIALKKAGAMTVSILTFS 54
           +AG  ILL+DD+ TTGAT  +CA + +     ++ + + +S
Sbjct: 190 IAGKHILLVDDIVTTGATLTQCATLLIGAGAKVSFACMAYS 230


>gi|238019432|ref|ZP_04599858.1| hypothetical protein VEIDISOL_01301 [Veillonella dispar ATCC 17748]
 gi|237864131|gb|EEP65421.1| hypothetical protein VEIDISOL_01301 [Veillonella dispar ATCC 17748]
          Length = 231

 Score = 33.9 bits (76), Expect = 6.8,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 1   MRNAFNV-PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           + NAF +  +Y     +  +IL++DD+YTTGAT +  A  L+      +  LT +
Sbjct: 173 IENAFVIKAEYKDIDFSTKRILIVDDIYTTGATIEAVAKVLRSYNPSRLDALTLA 227


>gi|56475996|ref|YP_157585.1| hypothetical protein ebA1065 [Aromatoleum aromaticum EbN1]
 gi|56312039|emb|CAI06684.1| conserved hypothetical protein,predicted phosphoribosyltransferase
           family [Aromatoleum aromaticum EbN1]
          Length = 236

 Score = 33.9 bits (76), Expect = 6.9,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           MR AF          AG  ++++DDV TTGAT    A  LK  GA  V  L  +R+
Sbjct: 181 MRGAFRC----EASFAGRTVIVVDDVMTTGATLDELARTLKMHGAARVENLVVART 232


>gi|289551389|ref|YP_003472293.1| ComF operon protein C [Staphylococcus lugdunensis HKU09-01]
 gi|289180920|gb|ADC88165.1| ComF operon protein C [Staphylococcus lugdunensis HKU09-01]
          Length = 224

 Score = 33.9 bits (76), Expect = 6.9,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 8   PQYVSKHV--AGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           P Y+S  +     +ILL+DD+YTTG T   A   L +      S+ TF+R
Sbjct: 175 PFYISLDIDLTNKEILLVDDIYTTGLTIHHAGCKLLENKVRKFSVYTFAR 224


>gi|315231716|ref|YP_004072152.1| orotate phosphoribosyltransferase [Thermococcus barophilus MP]
 gi|315184744|gb|ADT84929.1| orotate phosphoribosyltransferase [Thermococcus barophilus MP]
          Length = 182

 Score = 33.9 bits (76), Expect = 6.9,   Method: Composition-based stats.
 Identities = 18/36 (50%), Positives = 24/36 (66%)

Query: 16  AGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51
           AG K+LL++DV TTG +   AA  L+K GA  V I+
Sbjct: 109 AGDKVLLVEDVTTTGGSVLRAAKILEKEGAKVVGIM 144


>gi|78185439|ref|YP_377874.1| hypothetical protein Syncc9902_1873 [Synechococcus sp. CC9902]
 gi|78169733|gb|ABB26830.1| conserved hypothetical protein [Synechococcus sp. CC9902]
          Length = 190

 Score = 33.9 bits (76), Expect = 6.9,   Method: Composition-based stats.
 Identities = 17/37 (45%), Positives = 22/37 (59%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + L+DD+ TTGATA  A  AL KAG     I+   R+
Sbjct: 147 VWLVDDILTTGATALAAQKALNKAGHPVGGIICLGRT 183


>gi|296134288|ref|YP_003641535.1| phosphoribosyltransferase [Thermincola sp. JR]
 gi|296032866|gb|ADG83634.1| phosphoribosyltransferase [Thermincola potens JR]
          Length = 251

 Score = 33.9 bits (76), Expect = 7.0,   Method: Composition-based stats.
 Identities = 18/41 (43%), Positives = 25/41 (60%)

Query: 14  HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ G  +LLIDDV TTG+T +     L  AGA  V +LT +
Sbjct: 195 NLKGKNVLLIDDVLTTGSTVQECTRTLIMAGAHRVCVLTLA 235


>gi|53715668|ref|YP_101660.1| putative amidophosphoribosyl-transferase [Bacteroides fragilis
           YCH46]
 gi|52218533|dbj|BAD51126.1| putative amidophosphoribosyl-transferase [Bacteroides fragilis
           YCH46]
          Length = 230

 Score = 33.9 bits (76), Expect = 7.0,   Method: Composition-based stats.
 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 5/49 (10%)

Query: 6   NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +V  ++ KHV     L+IDDV TTG+T    A  L K   + +S+LT +
Sbjct: 184 DVACFLGKHV-----LIIDDVLTTGSTTVACASTLFKVEGVRISVLTLA 227


>gi|126463616|ref|YP_001044730.1| competence protein F [Rhodobacter sphaeroides ATCC 17029]
 gi|126105280|gb|ABN77958.1| competence protein F [Rhodobacter sphaeroides ATCC 17029]
          Length = 240

 Score = 33.9 bits (76), Expect = 7.1,   Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 28/45 (62%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           + G  +L++DDV T+GAT   A  A + AGA +VS+   +R  KD
Sbjct: 195 LKGRPVLILDDVMTSGATLAAATEACQAAGATSVSVAVLARVAKD 239


>gi|152966993|ref|YP_001362777.1| adenine phosphoribosyltransferase [Kineococcus radiotolerans
           SRS30216]
 gi|182627503|sp|A6WCH4|APT_KINRD RecName: Full=Adenine phosphoribosyltransferase; Short=APRT
 gi|151361510|gb|ABS04513.1| Adenine phosphoribosyltransferase [Kineococcus radiotolerans
           SRS30216]
          Length = 185

 Score = 33.9 bits (76), Expect = 7.1,   Method: Composition-based stats.
 Identities = 16/35 (45%), Positives = 25/35 (71%)

Query: 16  AGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
           AG ++L++DDV  TG TA+ A   L++AGA  V++
Sbjct: 124 AGERVLVVDDVLATGGTARAACELLEEAGAQVVAL 158


>gi|221640691|ref|YP_002526953.1| Competence protein F [Rhodobacter sphaeroides KD131]
 gi|221161472|gb|ACM02452.1| Competence protein F [Rhodobacter sphaeroides KD131]
          Length = 240

 Score = 33.9 bits (76), Expect = 7.2,   Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 28/45 (62%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           + G  +L++DDV T+GAT   A  A + AGA +VS+   +R  KD
Sbjct: 195 LKGRPVLILDDVMTSGATLAAATEACQAAGATSVSVAVLARVAKD 239


>gi|203284671|ref|YP_002222411.1| adenine phosphoribosyltransferase [Borrelia duttonii Ly]
 gi|201084114|gb|ACH93705.1| adenine phosphoribosyltransferase [Borrelia duttonii Ly]
          Length = 186

 Score = 33.9 bits (76), Expect = 7.2,   Method: Composition-based stats.
 Identities = 15/35 (42%), Positives = 21/35 (60%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           KILL+DD+  TG T + A   L++AG +   I  F
Sbjct: 128 KILLVDDILATGGTIRAAVRLLERAGGVISDIFCF 162


>gi|332559669|ref|ZP_08413991.1| competence protein F [Rhodobacter sphaeroides WS8N]
 gi|332277381|gb|EGJ22696.1| competence protein F [Rhodobacter sphaeroides WS8N]
          Length = 240

 Score = 33.9 bits (76), Expect = 7.2,   Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 28/45 (62%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           + G  +L++DDV T+GAT   A  A + AGA +VS+   +R  KD
Sbjct: 195 LKGRPVLILDDVMTSGATLAAATEACQAAGATSVSVAVLARVAKD 239


>gi|325568342|ref|ZP_08144709.1| phosphoribosyl pyrophosphate synthetase [Enterococcus casseliflavus
           ATCC 12755]
 gi|325158111|gb|EGC70264.1| phosphoribosyl pyrophosphate synthetase [Enterococcus casseliflavus
           ATCC 12755]
          Length = 321

 Score = 33.9 bits (76), Expect = 7.2,   Method: Composition-based stats.
 Identities = 19/39 (48%), Positives = 23/39 (58%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           YV   V G K +L+DD+  TG T   AA  LK+AGA  V
Sbjct: 207 YVIGDVVGKKCILVDDILNTGHTLAKAADLLKEAGASEV 245


>gi|253575859|ref|ZP_04853193.1| amidophosphoribosyltransferase [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251844653|gb|EES72667.1| amidophosphoribosyltransferase [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 314

 Score = 33.9 bits (76), Expect = 7.2,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 28/44 (63%), Gaps = 5/44 (11%)

Query: 18  LKILLIDDVYTTGATAKCAAIALKKAGA-----MTVSILTFSRS 56
           ++ILL+DDVYTTG+T +  +  L + G      + +  LT++RS
Sbjct: 271 IRILLVDDVYTTGSTLEACSRVLHELGGQIGKRIEIYCLTWARS 314


>gi|225175288|ref|ZP_03729283.1| amidophosphoribosyltransferase [Dethiobacter alkaliphilus AHT 1]
 gi|225169040|gb|EEG77839.1| amidophosphoribosyltransferase [Dethiobacter alkaliphilus AHT 1]
          Length = 231

 Score = 33.9 bits (76), Expect = 7.3,   Method: Composition-based stats.
 Identities = 17/37 (45%), Positives = 22/37 (59%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++LL+DD+ TTGATA  A   L KAG   V +    R
Sbjct: 195 RVLLVDDLLTTGATAHFAGQTLLKAGVGEVYVAVVGR 231


>gi|217978300|ref|YP_002362447.1| adenine phosphoribosyltransferase [Methylocella silvestris BL2]
 gi|217503676|gb|ACK51085.1| adenine phosphoribosyltransferase [Methylocella silvestris BL2]
          Length = 186

 Score = 33.9 bits (76), Expect = 7.3,   Method: Composition-based stats.
 Identities = 17/35 (48%), Positives = 23/35 (65%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVS 49
           +AG K++L+DD+  TG TA  A   LKK GA  V+
Sbjct: 120 IAGEKVILVDDLVATGGTAVGAVSLLKKIGADVVA 154


>gi|171778162|ref|ZP_02919419.1| hypothetical protein STRINF_00255 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171283144|gb|EDT48568.1| hypothetical protein STRINF_00255 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 220

 Score = 33.9 bits (76), Expect = 7.4,   Method: Composition-based stats.
 Identities = 17/37 (45%), Positives = 22/37 (59%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           K+L++DD+YTTGAT K       + GA  V  LT  R
Sbjct: 184 KVLILDDIYTTGATLKGICHLFFEKGAKIVKSLTIVR 220


>gi|307298445|ref|ZP_07578248.1| phosphoribosyltransferase [Thermotogales bacterium mesG1.Ag.4.2]
 gi|306915610|gb|EFN45994.1| phosphoribosyltransferase [Thermotogales bacterium mesG1.Ag.4.2]
          Length = 209

 Score = 33.9 bits (76), Expect = 7.5,   Method: Composition-based stats.
 Identities = 16/45 (35%), Positives = 25/45 (55%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           Y+ +      ++L DDV TTGATA   A  LK+ G   +++L  +
Sbjct: 161 YLKRSPRSTSVILFDDVVTTGATASQCARVLKEGGVKEITLLAIA 205


>gi|329964274|ref|ZP_08301375.1| comF family protein [Bacteroides fluxus YIT 12057]
 gi|328525579|gb|EGF52622.1| comF family protein [Bacteroides fluxus YIT 12057]
          Length = 192

 Score = 33.9 bits (76), Expect = 7.5,   Method: Composition-based stats.
 Identities = 16/38 (42%), Positives = 22/38 (57%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           G  IL++DDV TTG+T    A   K    + +SILT +
Sbjct: 151 GKHILIVDDVLTTGSTTTACADVFKGVEGIRISILTLA 188


>gi|15603421|ref|NP_246495.1| ComF [Pasteurella multocida subsp. multocida str. Pm70]
 gi|12721947|gb|AAK03640.1| ComF [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 228

 Score = 33.9 bits (76), Expect = 7.7,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R+AF +      H     + LIDDV TTGAT    A+ LKKAG   + +   +++
Sbjct: 174 LRHAFRLHPKSQTHRYQ-SVALIDDVITTGATLNELALLLKKAGVEHIQVWGLAKT 228


>gi|206900881|ref|YP_002251139.1| purine phosphoribosyltransferase [Dictyoglomus thermophilum H-6-12]
 gi|206739984|gb|ACI19042.1| purine phosphoribosyltransferase [Dictyoglomus thermophilum H-6-12]
          Length = 195

 Score = 33.9 bits (76), Expect = 7.7,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 26/46 (56%)

Query: 7   VPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
           + Q +S  V G K+L+ DDV  +G + K A   L++ GA  V I T
Sbjct: 75  ITQTISTIVEGKKVLITDDVADSGKSLKVAKEHLEQCGASQVKIAT 120


>gi|189439619|ref|YP_001954700.1| putative amidophosphoribosyltransferase [Bifidobacterium longum
          DJO10A]
 gi|189428054|gb|ACD98202.1| Putative amidophosphoribosyltransferase [Bifidobacterium longum
          DJO10A]
          Length = 107

 Score = 33.9 bits (76), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 17 GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
          G  +LL+DD+ TTGAT +    A ++AG   V +L  +
Sbjct: 57 GDAVLLVDDIVTTGATVRQCVQAFQQAGTKVVGVLVLA 94


>gi|323127194|gb|ADX24491.1| ribose-phosphate pyrophosphokinase [Streptococcus dysgalactiae
           subsp. equisimilis ATCC 12394]
          Length = 326

 Score = 33.9 bits (76), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           YV   V+G K +LIDD+  TG T   AA  L++AGA  +
Sbjct: 211 YVIGDVSGKKAILIDDILNTGKTFAEAAKILERAGATDI 249


>gi|146304713|ref|YP_001192029.1| orotate phosphoribosyltransferase [Metallosphaera sedula DSM 5348]
 gi|145702963|gb|ABP96105.1| orotate phosphoribosyltransferase [Metallosphaera sedula DSM 5348]
          Length = 191

 Score = 33.9 bits (76), Expect = 7.8,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 27/50 (54%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51
           R  +   + V   V G K+L++DDV TTG + + A+  + ++G   V  L
Sbjct: 89  RKGYGTDKLVEGEVTGRKVLVVDDVATTGGSLERASAEIVRSGGKVVGAL 138


>gi|257867006|ref|ZP_05646659.1| ribose-phosphate pyrophosphokinase [Enterococcus casseliflavus
           EC30]
 gi|257873340|ref|ZP_05652993.1| ribose-phosphate pyrophosphokinase [Enterococcus casseliflavus
           EC10]
 gi|257877082|ref|ZP_05656735.1| ribose-phosphate pyrophosphokinase [Enterococcus casseliflavus
           EC20]
 gi|257801062|gb|EEV29992.1| ribose-phosphate pyrophosphokinase [Enterococcus casseliflavus
           EC30]
 gi|257807504|gb|EEV36326.1| ribose-phosphate pyrophosphokinase [Enterococcus casseliflavus
           EC10]
 gi|257811248|gb|EEV40068.1| ribose-phosphate pyrophosphokinase [Enterococcus casseliflavus
           EC20]
          Length = 325

 Score = 33.9 bits (76), Expect = 7.9,   Method: Composition-based stats.
 Identities = 19/39 (48%), Positives = 23/39 (58%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           YV   V G K +L+DD+  TG T   AA  LK+AGA  V
Sbjct: 211 YVIGDVVGKKCILVDDILNTGHTLAKAADLLKEAGASEV 249


>gi|251782295|ref|YP_002996597.1| ribose-phosphate pyrophosphokinase [Streptococcus dysgalactiae
           subsp. equisimilis GGS_124]
 gi|242390924|dbj|BAH81383.1| ribose-phosphate pyrophosphokinase [Streptococcus dysgalactiae
           subsp. equisimilis GGS_124]
          Length = 326

 Score = 33.9 bits (76), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           YV   V+G K +LIDD+  TG T   AA  L++AGA  +
Sbjct: 211 YVIGDVSGKKAILIDDILNTGKTFAEAAKILERAGATDI 249


>gi|18977684|ref|NP_579041.1| hypothetical protein PF1312 [Pyrococcus furiosus DSM 3638]
 gi|18893416|gb|AAL81436.1| hypothetical protein PF1312 [Pyrococcus furiosus DSM 3638]
          Length = 235

 Score = 33.9 bits (76), Expect = 7.9,   Method: Composition-based stats.
 Identities = 14/44 (31%), Positives = 27/44 (61%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + +  +K++L DD+ TTG TA+     + + GA  V ++T +R+
Sbjct: 188 QRLENMKVVLFDDILTTGDTARACVRIIFECGASKVYLITLART 231


>gi|268612018|ref|ZP_06145745.1| competence protein [Ruminococcus flavefaciens FD-1]
          Length = 219

 Score = 33.9 bits (76), Expect = 8.0,   Method: Composition-based stats.
 Identities = 19/39 (48%), Positives = 26/39 (66%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVS 49
           V+++V G  +LLIDDV TTG+T      AL K GA +V+
Sbjct: 167 VTENVRGRNLLLIDDVCTTGSTFAEITAALLKNGAASVT 205


>gi|46190226|ref|ZP_00206375.1| COG1040: Predicted amidophosphoribosyltransferases
          [Bifidobacterium longum DJO10A]
          Length = 103

 Score = 33.9 bits (76), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 17 GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
          G  +LL+DD+ TTGAT +    A ++AG   V +L  +
Sbjct: 53 GDAVLLVDDIVTTGATVRQCVQAFQQAGTKVVGVLVLA 90


>gi|291456486|ref|ZP_06595876.1| putative phosphoribosyl transferase domain protein [Bifidobacterium
           breve DSM 20213]
 gi|291381763|gb|EFE89281.1| putative phosphoribosyl transferase domain protein [Bifidobacterium
           breve DSM 20213]
          Length = 224

 Score = 33.9 bits (76), Expect = 8.1,   Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 27/42 (64%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           G +++L+DD+ TTG+T +  A   ++AGA  +  +T + + K
Sbjct: 181 GQQVVLVDDIITTGSTLRQCAQTCRQAGAEVIGAMTLTEAKK 222


>gi|323343504|ref|ZP_08083731.1| amidophosphoribosyl-transferase [Prevotella oralis ATCC 33269]
 gi|323095323|gb|EFZ37897.1| amidophosphoribosyl-transferase [Prevotella oralis ATCC 33269]
          Length = 231

 Score = 33.9 bits (76), Expect = 8.4,   Method: Composition-based stats.
 Identities = 15/37 (40%), Positives = 23/37 (62%)

Query: 20  ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +L++DDV TTGAT       L K+G + +S+L+   S
Sbjct: 193 LLIVDDVVTTGATVCACGKELMKSGGVRISVLSLGYS 229


>gi|227529545|ref|ZP_03959594.1| competence protein FC [Lactobacillus vaginalis ATCC 49540]
 gi|227350630|gb|EEJ40921.1| competence protein FC [Lactobacillus vaginalis ATCC 49540]
          Length = 225

 Score = 33.9 bits (76), Expect = 8.4,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 8   PQYVSKHV--AGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           P ++ K +   G K+LL+DD+YTTG T   AA    + G   V  L+ +R
Sbjct: 176 PFFLDKDINLRGRKVLLVDDIYTTGRTLYHAAELCYQNGCKRVQSLSLAR 225


>gi|15217112|gb|AAK92511.1|AF401037_1 phosphoribosylpyrophosphate amidotransferase [Lactobacillus sakei]
          Length = 284

 Score = 33.9 bits (76), Expect = 8.4,   Method: Composition-based stats.
 Identities = 20/48 (41%), Positives = 27/48 (56%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           V   VAG +I+L+DD    G T+K     LK+AGA+ V +   S  LK
Sbjct: 151 VKSVVAGKRIVLVDDSIVRGTTSKHIVKRLKEAGALEVHLRVASPPLK 198


>gi|319778874|ref|YP_004129787.1| phosphoribosyltransferase [Taylorella equigenitalis MCE9]
 gi|317108898|gb|ADU91644.1| phosphoribosyltransferase [Taylorella equigenitalis MCE9]
          Length = 181

 Score = 33.9 bits (76), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLK-ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
            R A +  QY   + A  K ++++DDV TTG+T   A+ ALK AG  ++     +R+
Sbjct: 119 QRFASSSSQYFCAYRAKFKKVIIVDDVLTTGSTIHAASRALKAAGVESIQAAVIARA 175


>gi|217967807|ref|YP_002353313.1| phosphoribosyltransferase [Dictyoglomus turgidum DSM 6724]
 gi|217336906|gb|ACK42699.1| phosphoribosyltransferase [Dictyoglomus turgidum DSM 6724]
          Length = 195

 Score = 33.5 bits (75), Expect = 8.6,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 26/46 (56%)

Query: 7   VPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
           + Q +S  V G K+L+ DDV  +G + K A   L++ GA  V I T
Sbjct: 75  ITQTISTIVEGRKVLITDDVADSGKSLKVAREHLEQCGASQVKIAT 120


>gi|332638873|ref|ZP_08417736.1| amidophosphoribosyltransferase-like protein [Weissella cibaria KACC
           11862]
          Length = 224

 Score = 33.5 bits (75), Expect = 8.8,   Method: Composition-based stats.
 Identities = 15/41 (36%), Positives = 26/41 (63%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           + G +I ++DDV TTG T + A+  L ++GA  +  +T +R
Sbjct: 184 LTGQRICIVDDVCTTGRTLRHASSCLYESGATQICTVTLAR 224


>gi|310789944|gb|EFQ25477.1| adenine phosphoribosyltransferase [Glomerella graminicola M1.001]
          Length = 223

 Score = 33.5 bits (75), Expect = 8.8,   Method: Composition-based stats.
 Identities = 15/35 (42%), Positives = 22/35 (62%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51
           G K+L++DD+  TG +AK AA  +KK G   +  L
Sbjct: 163 GQKVLIVDDIIATGGSAKAAADLVKKLGGDIIGYL 197


>gi|154484179|ref|ZP_02026627.1| hypothetical protein EUBVEN_01890 [Eubacterium ventriosum ATCC
           27560]
 gi|149734656|gb|EDM50573.1| hypothetical protein EUBVEN_01890 [Eubacterium ventriosum ATCC
           27560]
          Length = 235

 Score = 33.5 bits (75), Expect = 8.8,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF V + +        +LL+DD+YTTG+T    A  LK AG   V  L+ +
Sbjct: 179 LQKAFGVDRKICSEYK--TVLLVDDIYTTGSTFDACAKVLKVAGVEKVYCLSVA 230


>gi|328948685|ref|YP_004366022.1| phosphoribosyltransferase [Treponema succinifaciens DSM 2489]
 gi|328449009|gb|AEB14725.1| phosphoribosyltransferase [Treponema succinifaciens DSM 2489]
          Length = 253

 Score = 33.5 bits (75), Expect = 9.0,   Method: Composition-based stats.
 Identities = 16/35 (45%), Positives = 21/35 (60%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           ++LLIDDV TTG T +     LK AG   V +L+ 
Sbjct: 215 QVLLIDDVLTTGVTVESCCEILKNAGISKVDVLSL 249


>gi|296110378|ref|YP_003620759.1| orotate phosphoribosyltransferase [Leuconostoc kimchii IMSNU 11154]
 gi|295831909|gb|ADG39790.1| orotate phosphoribosyltransferase [Leuconostoc kimchii IMSNU 11154]
          Length = 208

 Score = 33.5 bits (75), Expect = 9.1,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 30/46 (65%), Gaps = 1/46 (2%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT-FSRSLKD 59
           VAG K++LIDD+ +TG +   A  A ++AGA  + +++ FS  L +
Sbjct: 114 VAGQKVVLIDDLISTGGSVLGAVEATRQAGAEVIGVVSIFSYELPE 159


>gi|225012116|ref|ZP_03702553.1| putative amidophosphoribosyl-transferase [Flavobacteria bacterium
          MS024-2A]
 gi|225003671|gb|EEG41644.1| putative amidophosphoribosyl-transferase [Flavobacteria bacterium
          MS024-2A]
          Length = 76

 Score = 33.5 bits (75), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 22/31 (70%)

Query: 20 ILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
          +LL+DDV TTGAT    A ALKK  ++ +SI
Sbjct: 39 LLLVDDVITTGATLSACADALKKNSSLKLSI 69


>gi|332796795|ref|YP_004458295.1| glutamine phosphoribosylpyrophosphate amidotransferase [Acidianus
           hospitalis W1]
 gi|332694530|gb|AEE93997.1| glutamine phosphoribosylpyrophosphate amidotransferase [Acidianus
           hospitalis W1]
          Length = 401

 Score = 33.5 bits (75), Expect = 9.4,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 25/47 (53%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +   V G +++LIDD   TG T K    +L+K GA  V +L  S  L
Sbjct: 290 IKSAVFGKRVILIDDSMVTGTTLKNTIFSLRKMGAKEVHVLIGSPKL 336


>gi|227827769|ref|YP_002829549.1| amidophosphoribosyltransferase [Sulfolobus islandicus M.14.25]
 gi|227459565|gb|ACP38251.1| Amidophosphoribosyltransferase [Sulfolobus islandicus M.14.25]
          Length = 401

 Score = 33.5 bits (75), Expect = 9.4,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +   V G +I+LIDD   TG T K     L+K GA  + +L  S  L
Sbjct: 292 IKSAVKGKRIILIDDSMVTGTTLKNTIFNLRKLGAKEIHVLIGSPKL 338


>gi|227496217|ref|ZP_03926516.1| adenine phosphoribosyltransferase [Actinomyces urogenitalis DSM
           15434]
 gi|226834248|gb|EEH66631.1| adenine phosphoribosyltransferase [Actinomyces urogenitalis DSM
           15434]
          Length = 188

 Score = 33.5 bits (75), Expect = 9.4,   Method: Composition-based stats.
 Identities = 16/36 (44%), Positives = 23/36 (63%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
           V G ++L+IDDV  TG TA  +   L++AGA  V +
Sbjct: 124 VPGQRVLVIDDVLATGGTAAASIALLEEAGAEVVGL 159


>gi|116671255|ref|YP_832188.1| phosphoribosyltransferase [Arthrobacter sp. FB24]
 gi|116611364|gb|ABK04088.1| phosphoribosyltransferase [Arthrobacter sp. FB24]
          Length = 308

 Score = 33.5 bits (75), Expect = 9.4,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 28/47 (59%)

Query: 8   PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           P +++  + G   +++DDV TTGAT   AA A+ +AG + +  +  +
Sbjct: 238 PAFLAPDIRGCPCIIVDDVLTTGATLAEAARAVHQAGGVVLGAVVLA 284


>gi|237717308|ref|ZP_04547789.1| conserved hypothetical protein [Bacteroides sp. D1]
 gi|262406074|ref|ZP_06082624.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
 gi|294806839|ref|ZP_06765664.1| ComF family protein [Bacteroides xylanisolvens SD CC 1b]
 gi|229443291|gb|EEO49082.1| conserved hypothetical protein [Bacteroides sp. D1]
 gi|262356949|gb|EEZ06039.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
 gi|294445868|gb|EFG14510.1| ComF family protein [Bacteroides xylanisolvens SD CC 1b]
          Length = 235

 Score = 33.5 bits (75), Expect = 9.5,   Method: Composition-based stats.
 Identities = 17/40 (42%), Positives = 24/40 (60%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +AG  IL++DDV TTG+T    A  L     + +SILT +
Sbjct: 193 LAGKHILIVDDVLTTGSTTLACASCLVDMEEIRISILTLA 232


>gi|296454192|ref|YP_003661335.1| adenine phosphoribosyltransferase [Bifidobacterium longum subsp.
           longum JDM301]
 gi|296183623|gb|ADH00505.1| adenine phosphoribosyltransferase [Bifidobacterium longum subsp.
           longum JDM301]
          Length = 193

 Score = 33.5 bits (75), Expect = 9.5,   Method: Composition-based stats.
 Identities = 15/33 (45%), Positives = 22/33 (66%)

Query: 16  AGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           AG ++L++DD+  TG TAK  A  ++KAG   V
Sbjct: 131 AGERVLIVDDLIATGGTAKAGADLIEKAGGTVV 163


>gi|325567754|ref|ZP_08144365.1| phosphoribosyl pyrophosphate synthetase [Enterococcus casseliflavus
           ATCC 12755]
 gi|325158527|gb|EGC70674.1| phosphoribosyl pyrophosphate synthetase [Enterococcus casseliflavus
           ATCC 12755]
          Length = 333

 Score = 33.5 bits (75), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 22/35 (62%)

Query: 14  HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           HV G   +LIDD+  T  T   AA ALK+AGA +V
Sbjct: 225 HVEGKTCVLIDDMIDTAGTITLAANALKQAGAKSV 259


>gi|291540633|emb|CBL13744.1| Predicted amidophosphoribosyltransferases [Roseburia intestinalis
           XB6B4]
          Length = 248

 Score = 33.5 bits (75), Expect = 9.6,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 28/53 (52%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           RN  N  Q  +  V   +++L+DD+YTTG+T    +  LK +G   +  +  S
Sbjct: 191 RNLKNAFQLTADIVEYKRVVLVDDIYTTGSTMDEVSKVLKASGVENIYYICIS 243


>gi|240144754|ref|ZP_04743355.1| ComF family protein [Roseburia intestinalis L1-82]
 gi|257203275|gb|EEV01560.1| ComF family protein [Roseburia intestinalis L1-82]
 gi|291534616|emb|CBL07728.1| Predicted amidophosphoribosyltransferases [Roseburia intestinalis
           M50/1]
          Length = 248

 Score = 33.5 bits (75), Expect = 9.6,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 28/53 (52%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           RN  N  Q  +  V   +++L+DD+YTTG+T    +  LK +G   +  +  S
Sbjct: 191 RNLKNAFQLTADIVEYKRVVLVDDIYTTGSTMDEVSKVLKASGVENIYYICIS 243


>gi|23465309|ref|NP_695912.1| adenine phosphoribosyltransferase [Bifidobacterium longum NCC2705]
 gi|38257342|sp|Q8G6B5|APT_BIFLO RecName: Full=Adenine phosphoribosyltransferase; Short=APRT
 gi|23325947|gb|AAN24548.1| adenine phosphoribosyltransferase [Bifidobacterium longum NCC2705]
          Length = 193

 Score = 33.5 bits (75), Expect = 9.6,   Method: Composition-based stats.
 Identities = 15/33 (45%), Positives = 22/33 (66%)

Query: 16  AGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           AG ++L++DD+  TG TAK A   ++KAG   V
Sbjct: 131 AGKRVLIVDDLIATGGTAKAATDLIEKAGGTVV 163


>gi|23335121|ref|ZP_00120359.1| COG0503: Adenine/guanine phosphoribosyltransferases and related
           PRPP-binding proteins [Bifidobacterium longum DJO10A]
 gi|189439318|ref|YP_001954399.1| adenine phosphoribosyltransferase [Bifidobacterium longum DJO10A]
 gi|227547255|ref|ZP_03977304.1| adenine phosphoribosyltransferase [Bifidobacterium longum subsp.
           infantis ATCC 55813]
 gi|239621477|ref|ZP_04664508.1| adenine phosphoribosyltransferase [Bifidobacterium longum subsp.
           infantis CCUG 52486]
 gi|312132692|ref|YP_004000031.1| apt1 [Bifidobacterium longum subsp. longum BBMN68]
 gi|317483241|ref|ZP_07942236.1| adenine phosphoribosyltransferase [Bifidobacterium sp. 12_1_47BFAA]
 gi|322689205|ref|YP_004208939.1| adenine phosphoribosyltransferase [Bifidobacterium longum subsp.
           infantis 157F]
 gi|322691271|ref|YP_004220841.1| adenine phosphoribosyltransferase [Bifidobacterium longum subsp.
           longum JCM 1217]
 gi|238692058|sp|B3DRY2|APT_BIFLD RecName: Full=Adenine phosphoribosyltransferase; Short=APRT
 gi|189427753|gb|ACD97901.1| Adenine/guanine phosphoribosyltransferase [Bifidobacterium longum
           DJO10A]
 gi|227212214|gb|EEI80110.1| adenine phosphoribosyltransferase [Bifidobacterium longum subsp.
           infantis ATCC 55813]
 gi|239515938|gb|EEQ55805.1| adenine phosphoribosyltransferase [Bifidobacterium longum subsp.
           infantis CCUG 52486]
 gi|291516877|emb|CBK70493.1| adenine phosphoribosyltransferase [Bifidobacterium longum subsp.
           longum F8]
 gi|311773650|gb|ADQ03138.1| Apt1 [Bifidobacterium longum subsp. longum BBMN68]
 gi|316915310|gb|EFV36737.1| adenine phosphoribosyltransferase [Bifidobacterium sp. 12_1_47BFAA]
 gi|320456127|dbj|BAJ66749.1| adenine phosphoribosyltransferase [Bifidobacterium longum subsp.
           longum JCM 1217]
 gi|320460541|dbj|BAJ71161.1| adenine phosphoribosyltransferase [Bifidobacterium longum subsp.
           infantis 157F]
          Length = 193

 Score = 33.5 bits (75), Expect = 9.6,   Method: Composition-based stats.
 Identities = 15/33 (45%), Positives = 22/33 (66%)

Query: 16  AGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           AG ++L++DD+  TG TAK A   ++KAG   V
Sbjct: 131 AGKRVLIVDDLIATGGTAKAATDLIEKAGGTVV 163


>gi|312951190|ref|ZP_07770093.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX0102]
 gi|310630855|gb|EFQ14138.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX0102]
 gi|315152676|gb|EFT96692.1| ribose-phosphate diphosphokinase [Enterococcus faecalis TX0031]
          Length = 338

 Score = 33.5 bits (75), Expect = 9.9,   Method: Composition-based stats.
 Identities = 18/39 (46%), Positives = 22/39 (56%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
           YV  +V G K +L+DD+  TG T   AA  L K GA  V
Sbjct: 225 YVIGNVVGKKCILVDDILNTGQTLATAAEVLMKNGAQEV 263


>gi|295085502|emb|CBK67025.1| Predicted amidophosphoribosyltransferases [Bacteroides
           xylanisolvens XB1A]
          Length = 235

 Score = 33.5 bits (75), Expect = 9.9,   Method: Composition-based stats.
 Identities = 17/40 (42%), Positives = 24/40 (60%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +AG  IL++DDV TTG+T    A  L     + +SILT +
Sbjct: 193 LAGKHILIVDDVLTTGSTTLACASCLVDVEDIRISILTLA 232


>gi|284174867|ref|ZP_06388836.1| glutamine phosphoribosylpyrophosphate amidotransferase [Sulfolobus
           solfataricus 98/2]
 gi|261602309|gb|ACX91912.1| Amidophosphoribosyltransferase [Sulfolobus solfataricus 98/2]
          Length = 401

 Score = 33.5 bits (75), Expect = 9.9,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +   V G +I+LIDD   TG T K     L+K GA  + +L  S  L
Sbjct: 292 IKSAVKGKRIILIDDSMVTGTTLKNTIFNLRKLGAKEIHVLIGSPKL 338


>gi|229585040|ref|YP_002843542.1| Amidophosphoribosyltransferase [Sulfolobus islandicus M.16.27]
 gi|238619941|ref|YP_002914767.1| Amidophosphoribosyltransferase [Sulfolobus islandicus M.16.4]
 gi|228020090|gb|ACP55497.1| Amidophosphoribosyltransferase [Sulfolobus islandicus M.16.27]
 gi|238381011|gb|ACR42099.1| Amidophosphoribosyltransferase [Sulfolobus islandicus M.16.4]
          Length = 401

 Score = 33.5 bits (75), Expect = 9.9,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +   V G +I+LIDD   TG T K     L+K GA  + +L  S  L
Sbjct: 292 IKSAVKGKRIILIDDSMVTGTTLKNTIFNLRKLGAKEIHVLIGSPKL 338


>gi|315226408|ref|ZP_07868196.1| conserved hypothetical protein [Parascardovia denticolens DSM
           10105]
 gi|315120540|gb|EFT83672.1| conserved hypothetical protein [Parascardovia denticolens DSM
           10105]
          Length = 238

 Score = 33.5 bits (75), Expect = 9.9,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 25/38 (65%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           G  ++L+DD+ TTG+T +    AL++AG   ++ LT S
Sbjct: 192 GRPLVLVDDIMTTGSTLRTCHQALEEAGGELLACLTLS 229


>gi|294786783|ref|ZP_06752037.1| conserved hypothetical protein [Parascardovia denticolens F0305]
 gi|294485616|gb|EFG33250.1| conserved hypothetical protein [Parascardovia denticolens F0305]
          Length = 230

 Score = 33.5 bits (75), Expect = 9.9,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 25/38 (65%)

Query: 17  GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           G  ++L+DD+ TTG+T +    AL++AG   ++ LT S
Sbjct: 184 GRPLVLVDDIMTTGSTLRTCHQALEEAGGELLACLTLS 221


>gi|152989823|ref|YP_001355545.1| phosphoribosyltransferase [Nitratiruptor sp. SB155-2]
 gi|151421684|dbj|BAF69188.1| phosphoribosyltransferase [Nitratiruptor sp. SB155-2]
          Length = 208

 Score = 33.5 bits (75), Expect = 9.9,   Method: Composition-based stats.
 Identities = 18/36 (50%), Positives = 23/36 (63%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
           VAG +++L+DD   TGA+   AA ALK  GA  V I
Sbjct: 119 VAGKRVILVDDGVATGASMYLAARALKDEGAKEVVI 154


Searching..................................................done


Results from round 2




>gi|319406072|emb|CBI79702.1| competence protein ComF [Bartonella sp. AR 15-3]
          Length = 225

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++NAF VP+ V KH+ G  ILLIDDV TTG T   AA  LK AG   V++LTFSR LKD
Sbjct: 160 VQNAFKVPKEVKKHLKGRSILLIDDVLTTGVTVTAAAKTLKHAGTRQVNVLTFSRVLKD 218


>gi|319408180|emb|CBI81833.1| competence protein ComF [Bartonella schoenbuchensis R1]
          Length = 247

 Score = 90.2 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 33/59 (55%), Positives = 40/59 (67%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +++ F VP  + KH+ G  ILLIDDV TTG T   AA  LK+AGA  V +LTFSR LKD
Sbjct: 182 VQSTFKVPHKIKKHLKGRSILLIDDVLTTGETITAAAATLKRAGAQQVDVLTFSRVLKD 240


>gi|239832955|ref|ZP_04681284.1| competence protein F [Ochrobactrum intermedium LMG 3301]
 gi|239825222|gb|EEQ96790.1| competence protein F [Ochrobactrum intermedium LMG 3301]
          Length = 288

 Score = 89.4 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 39/59 (66%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VPQ    H+ G ++LLIDDVYTTGAT K    AL + GA +V +LTFSR L D
Sbjct: 230 VDGAFRVPQEHEIHIRGRRVLLIDDVYTTGATVKAVTRALLRGGARSVDVLTFSRVLPD 288


>gi|225628082|ref|ZP_03786117.1| protein gntX [Brucella ceti str. Cudo]
 gi|225616907|gb|EEH13954.1| protein gntX [Brucella ceti str. Cudo]
          Length = 290

 Score = 88.6 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 232 VDGAFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 290


>gi|153008363|ref|YP_001369578.1| competence protein F [Ochrobactrum anthropi ATCC 49188]
 gi|151560251|gb|ABS13749.1| competence protein F, putative [Ochrobactrum anthropi ATCC 49188]
          Length = 262

 Score = 88.6 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 33/59 (55%), Positives = 39/59 (66%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VPQ    HV G ++LLIDDVYTTGAT K    AL + GA +V +LTFSR L D
Sbjct: 204 VDGAFRVPQEHEIHVRGRRVLLIDDVYTTGATVKAVTRALLRGGAKSVDVLTFSRVLPD 262


>gi|148560259|ref|YP_001259705.1| putative competence protein F [Brucella ovis ATCC 25840]
 gi|148371516|gb|ABQ61495.1| putative competence protein F [Brucella ovis ATCC 25840]
          Length = 262

 Score = 88.6 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 204 VDGAFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 262


>gi|237816244|ref|ZP_04595237.1| competence protein F [Brucella abortus str. 2308 A]
 gi|237788311|gb|EEP62526.1| competence protein F [Brucella abortus str. 2308 A]
          Length = 290

 Score = 88.6 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 232 VDGAFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 290


>gi|161619796|ref|YP_001593683.1| protein gntX [Brucella canis ATCC 23365]
 gi|260567631|ref|ZP_05838101.1| competence protein F [Brucella suis bv. 4 str. 40]
 gi|161336607|gb|ABX62912.1| Protein gntX [Brucella canis ATCC 23365]
 gi|260157149|gb|EEW92229.1| competence protein F [Brucella suis bv. 4 str. 40]
          Length = 262

 Score = 88.3 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 204 VDGAFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 262


>gi|306842968|ref|ZP_07475602.1| competence protein F [Brucella sp. BO2]
 gi|306286896|gb|EFM58421.1| competence protein F [Brucella sp. BO2]
          Length = 262

 Score = 88.3 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 204 VDGAFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 262


>gi|121601823|ref|YP_988686.1| comF family protein [Bartonella bacilliformis KC583]
 gi|120614000|gb|ABM44601.1| comF family protein [Bartonella bacilliformis KC583]
          Length = 251

 Score = 88.3 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 33/59 (55%), Positives = 42/59 (71%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++NAF+VP+ + K + G  ILL+DDV TTG T   AA  LK+AGA  V +LTFSR LKD
Sbjct: 186 VQNAFSVPRKIKKRMQGCSILLVDDVLTTGVTVTIAAATLKRAGARQVDVLTFSRVLKD 244


>gi|315122266|ref|YP_004062755.1| competence protein F, putative [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495668|gb|ADR52267.1| competence protein F, putative [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 214

 Score = 88.3 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 45/59 (76%), Positives = 53/59 (89%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           + NAF+VPQY  K++AG KILLIDDVYTTGATA+ AAIALKKAGA ++SILTFSRSLK+
Sbjct: 156 LHNAFHVPQYAQKYIAGFKILLIDDVYTTGATAQYAAIALKKAGAKSISILTFSRSLKN 214


>gi|254717947|ref|ZP_05179758.1| protein gntX [Brucella sp. 83/13]
 gi|265982890|ref|ZP_06095625.1| phosphoribosyltransferase [Brucella sp. 83/13]
 gi|306838253|ref|ZP_07471103.1| competence protein F [Brucella sp. NF 2653]
 gi|264661482|gb|EEZ31743.1| phosphoribosyltransferase [Brucella sp. 83/13]
 gi|306406656|gb|EFM62885.1| competence protein F [Brucella sp. NF 2653]
          Length = 262

 Score = 88.3 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 204 VDGAFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 262


>gi|256158382|ref|ZP_05456280.1| putative competence protein F [Brucella ceti M490/95/1]
 gi|256253801|ref|ZP_05459337.1| putative competence protein F [Brucella ceti B1/94]
 gi|260169308|ref|ZP_05756119.1| putative competence protein F [Brucella sp. F5/99]
 gi|261220934|ref|ZP_05935215.1| phosphoribosyltransferase [Brucella ceti B1/94]
 gi|261758821|ref|ZP_06002530.1| competence protein F [Brucella sp. F5/99]
 gi|265996894|ref|ZP_06109451.1| phosphoribosyltransferase [Brucella ceti M490/95/1]
 gi|260919518|gb|EEX86171.1| phosphoribosyltransferase [Brucella ceti B1/94]
 gi|261738805|gb|EEY26801.1| competence protein F [Brucella sp. F5/99]
 gi|262551362|gb|EEZ07352.1| phosphoribosyltransferase [Brucella ceti M490/95/1]
          Length = 262

 Score = 88.3 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 204 VDGAFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 262


>gi|23502731|ref|NP_698858.1| competence protein F [Brucella suis 1330]
 gi|254704895|ref|ZP_05166723.1| putative competence protein F [Brucella suis bv. 3 str. 686]
 gi|261755589|ref|ZP_05999298.1| phosphoribosyltransferase [Brucella suis bv. 3 str. 686]
 gi|23348747|gb|AAN30773.1| competence protein F, putative [Brucella suis 1330]
 gi|261745342|gb|EEY33268.1| phosphoribosyltransferase [Brucella suis bv. 3 str. 686]
          Length = 262

 Score = 88.3 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 204 VDGAFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 262


>gi|163843904|ref|YP_001628308.1| protein gntX [Brucella suis ATCC 23445]
 gi|254707589|ref|ZP_05169417.1| putative competence protein F [Brucella pinnipedialis M163/99/10]
 gi|254708873|ref|ZP_05170684.1| putative competence protein F [Brucella pinnipedialis B2/94]
 gi|254713704|ref|ZP_05175515.1| putative competence protein F [Brucella ceti M644/93/1]
 gi|254715946|ref|ZP_05177757.1| putative competence protein F [Brucella ceti M13/05/1]
 gi|256030399|ref|ZP_05444013.1| putative competence protein F [Brucella pinnipedialis M292/94/1]
 gi|256059857|ref|ZP_05450044.1| putative competence protein F [Brucella neotomae 5K33]
 gi|256370278|ref|YP_003107789.1| competence protein F, putative [Brucella microti CCM 4915]
 gi|261217709|ref|ZP_05931990.1| phosphoribosyltransferase [Brucella ceti M13/05/1]
 gi|261315076|ref|ZP_05954273.1| phosphoribosyltransferase [Brucella pinnipedialis M163/99/10]
 gi|261316366|ref|ZP_05955563.1| phosphoribosyltransferase [Brucella pinnipedialis B2/94]
 gi|261321444|ref|ZP_05960641.1| phosphoribosyltransferase [Brucella ceti M644/93/1]
 gi|261323827|ref|ZP_05963024.1| phosphoribosyltransferase [Brucella neotomae 5K33]
 gi|265987438|ref|ZP_06099995.1| phosphoribosyltransferase [Brucella pinnipedialis M292/94/1]
 gi|163674627|gb|ABY38738.1| Protein gntX [Brucella suis ATCC 23445]
 gi|256000441|gb|ACU48840.1| competence protein F, putative [Brucella microti CCM 4915]
 gi|260922798|gb|EEX89366.1| phosphoribosyltransferase [Brucella ceti M13/05/1]
 gi|261294134|gb|EEX97630.1| phosphoribosyltransferase [Brucella ceti M644/93/1]
 gi|261295589|gb|EEX99085.1| phosphoribosyltransferase [Brucella pinnipedialis B2/94]
 gi|261299807|gb|EEY03304.1| phosphoribosyltransferase [Brucella neotomae 5K33]
 gi|261304102|gb|EEY07599.1| phosphoribosyltransferase [Brucella pinnipedialis M163/99/10]
 gi|264659635|gb|EEZ29896.1| phosphoribosyltransferase [Brucella pinnipedialis M292/94/1]
          Length = 262

 Score = 87.9 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 204 VDGAFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 262


>gi|62290737|ref|YP_222530.1| competence protein F [Brucella abortus bv. 1 str. 9-941]
 gi|82700649|ref|YP_415223.1| competence protein F [Brucella melitensis biovar Abortus 2308]
 gi|189024949|ref|YP_001935717.1| competence protein F [Brucella abortus S19]
 gi|254690026|ref|ZP_05153280.1| putative competence protein F [Brucella abortus bv. 6 str. 870]
 gi|254694515|ref|ZP_05156343.1| putative competence protein F [Brucella abortus bv. 3 str. Tulya]
 gi|254696140|ref|ZP_05157968.1| putative competence protein F [Brucella abortus bv. 2 str. 86/8/59]
 gi|254731058|ref|ZP_05189636.1| putative competence protein F [Brucella abortus bv. 4 str. 292]
 gi|256258280|ref|ZP_05463816.1| putative competence protein F [Brucella abortus bv. 9 str. C68]
 gi|260546000|ref|ZP_05821740.1| competence protein F [Brucella abortus NCTC 8038]
 gi|260755561|ref|ZP_05867909.1| phosphoribosyltransferase [Brucella abortus bv. 6 str. 870]
 gi|260758784|ref|ZP_05871132.1| phosphoribosyltransferase [Brucella abortus bv. 4 str. 292]
 gi|260760508|ref|ZP_05872851.1| phosphoribosyltransferase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884585|ref|ZP_05896199.1| phosphoribosyltransferase [Brucella abortus bv. 9 str. C68]
 gi|261214832|ref|ZP_05929113.1| phosphoribosyltransferase [Brucella abortus bv. 3 str. Tulya]
 gi|297247124|ref|ZP_06930842.1| competence protein ComFC [Brucella abortus bv. 5 str. B3196]
 gi|62196869|gb|AAX75169.1| competence protein F, hypothetical [Brucella abortus bv. 1 str.
           9-941]
 gi|82616750|emb|CAJ11836.1| competence protein F [Brucella melitensis biovar Abortus 2308]
 gi|189020521|gb|ACD73243.1| competence protein F [Brucella abortus S19]
 gi|260096107|gb|EEW79983.1| competence protein F [Brucella abortus NCTC 8038]
 gi|260669102|gb|EEX56042.1| phosphoribosyltransferase [Brucella abortus bv. 4 str. 292]
 gi|260670940|gb|EEX57761.1| phosphoribosyltransferase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675669|gb|EEX62490.1| phosphoribosyltransferase [Brucella abortus bv. 6 str. 870]
 gi|260874113|gb|EEX81182.1| phosphoribosyltransferase [Brucella abortus bv. 9 str. C68]
 gi|260916439|gb|EEX83300.1| phosphoribosyltransferase [Brucella abortus bv. 3 str. Tulya]
 gi|297174293|gb|EFH33640.1| competence protein ComFC [Brucella abortus bv. 5 str. B3196]
          Length = 262

 Score = 87.9 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 204 VDGAFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 262


>gi|17986467|ref|NP_539101.1| competence protein F [Brucella melitensis bv. 1 str. 16M]
 gi|225853317|ref|YP_002733550.1| competence protein F [Brucella melitensis ATCC 23457]
 gi|256045489|ref|ZP_05448372.1| putative competence protein F [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256263196|ref|ZP_05465728.1| competence protein F [Brucella melitensis bv. 2 str. 63/9]
 gi|260562798|ref|ZP_05833284.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|265991911|ref|ZP_06104468.1| phosphoribosyltransferase [Brucella melitensis bv. 1 str. Rev.1]
 gi|17982065|gb|AAL51365.1| competence protein f [Brucella melitensis bv. 1 str. 16M]
 gi|225641682|gb|ACO01596.1| competence protein F [Brucella melitensis ATCC 23457]
 gi|260152814|gb|EEW87906.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|263002977|gb|EEZ15270.1| phosphoribosyltransferase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093118|gb|EEZ17253.1| competence protein F [Brucella melitensis bv. 2 str. 63/9]
 gi|326409880|gb|ADZ66945.1| competence protein F [Brucella melitensis M28]
          Length = 262

 Score = 87.9 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 204 VDGAFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 262


>gi|326539594|gb|ADZ87809.1| competence protein F [Brucella melitensis M5-90]
          Length = 251

 Score = 87.5 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 193 VDGAFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 251


>gi|306844850|ref|ZP_07477433.1| competence protein F [Brucella sp. BO1]
 gi|306274782|gb|EFM56563.1| competence protein F [Brucella sp. BO1]
          Length = 262

 Score = 87.5 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 31/59 (52%), Positives = 39/59 (66%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VP+    H+ G ++LLIDDVYTTGAT K A  AL + GA +V +LT SR L D
Sbjct: 204 VDGAFRVPKEHEIHIRGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTLSRVLPD 262


>gi|256112214|ref|ZP_05453135.1| competence protein F [Brucella melitensis bv. 3 str. Ether]
 gi|265993642|ref|ZP_06106199.1| phosphoribosyltransferase [Brucella melitensis bv. 3 str. Ether]
 gi|262764623|gb|EEZ10544.1| phosphoribosyltransferase [Brucella melitensis bv. 3 str. Ether]
          Length = 262

 Score = 87.5 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 204 VDGAFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 262


>gi|254700524|ref|ZP_05162352.1| putative competence protein F [Brucella suis bv. 5 str. 513]
 gi|261751028|ref|ZP_05994737.1| phosphoribosyltransferase [Brucella suis bv. 5 str. 513]
 gi|261740781|gb|EEY28707.1| phosphoribosyltransferase [Brucella suis bv. 5 str. 513]
          Length = 262

 Score = 87.1 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 40/57 (70%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 206 GAFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 262


>gi|227823196|ref|YP_002827168.1| putative competence protein F [Sinorhizobium fredii NGR234]
 gi|227342197|gb|ACP26415.1| putative competence protein F [Sinorhizobium fredii NGR234]
          Length = 281

 Score = 84.8 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 27/58 (46%), Positives = 39/58 (67%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF VP+     + G +I+L+DDVYTTGAT   A  ALK+A A  +++LTF+ +L 
Sbjct: 221 VRGAFAVPESARSGIEGKRIVLVDDVYTTGATVSAATRALKRARAGDITVLTFAMALS 278


>gi|13472985|ref|NP_104552.1| hypothetical protein mll3453 [Mesorhizobium loti MAFF303099]
 gi|14023733|dbj|BAB50338.1| mll3453 [Mesorhizobium loti MAFF303099]
          Length = 240

 Score = 84.8 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 39/58 (67%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF VP      +AG ++LLIDDVYTTGAT + A  ALK+ GA  V +LTF+R L 
Sbjct: 172 VRAAFRVPAEAEIEIAGRRVLLIDDVYTTGATVRAATKALKRGGASAVDVLTFARVLP 229


>gi|319781332|ref|YP_004140808.1| phosphoribosyltransferase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317167220|gb|ADV10758.1| phosphoribosyltransferase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 266

 Score = 84.8 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 39/58 (67%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF VP      +AG ++LLIDDVYTTGAT + A  ALK+ GA  V +LTF+R L 
Sbjct: 198 VRAAFRVPAEAEIEIAGRRVLLIDDVYTTGATVRSATKALKRGGAAAVDVLTFARVLP 255


>gi|260467149|ref|ZP_05813327.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259029073|gb|EEW30371.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 266

 Score = 84.4 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 39/58 (67%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF VP      +AG ++LL+DDVYTTGAT + A  ALKK GA  V +LTF+R L 
Sbjct: 198 VRAAFRVPAEAEIEIAGRRVLLVDDVYTTGATVRSATKALKKGGAAAVDVLTFARVLP 255


>gi|222149922|ref|YP_002550879.1| competence protein F [Agrobacterium vitis S4]
 gi|221736904|gb|ACM37867.1| competence protein F [Agrobacterium vitis S4]
          Length = 236

 Score = 83.6 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 39/57 (68%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF V +     V G  ++L+DDVYTTGAT   A  ALK+AGA+ V++LTF+ +L
Sbjct: 176 VRGAFKVAENRRDQVFGRHLVLVDDVYTTGATVSAATRALKRAGAVEVTVLTFAMAL 232


>gi|86359347|ref|YP_471239.1| competence protein F (phosphoribosyltransferase protein) [Rhizobium
           etli CFN 42]
 gi|86283449|gb|ABC92512.1| competence protein F (phosphoribosyltransferase protein) [Rhizobium
           etli CFN 42]
          Length = 258

 Score = 83.6 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 42/59 (71%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF + +     ++G +I+L+DDVYTTGAT   A+  L+KAGA  +++LTF+R+L +
Sbjct: 198 VRGAFAIAKGRENDISGKRIVLVDDVYTTGATVAAASRTLRKAGAAEITVLTFARALSE 256


>gi|91974589|ref|YP_567248.1| phosphoribosyltransferase [Rhodopseudomonas palustris BisB5]
 gi|91681045|gb|ABE37347.1| phosphoribosyltransferase [Rhodopseudomonas palustris BisB5]
          Length = 272

 Score = 83.6 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF VP      V G +I+L+DDV T+GAT    A AL +A A +V +L F+R +
Sbjct: 209 VQGAFKVPPECKAEVQGRRIVLVDDVLTSGATVDACARALLRAKARSVDVLVFARVV 265


>gi|327193402|gb|EGE60302.1| competence protein F (phosphoribosyltransferase protein) [Rhizobium
           etli CNPAF512]
          Length = 258

 Score = 83.6 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF + +     + G +I+LIDDVYTTGAT   A+  L+KAGA  +++LTF+R+L +
Sbjct: 198 VRGAFAIAKGRENDIFGKRIVLIDDVYTTGATVAAASRTLRKAGAAEITVLTFARALSE 256


>gi|209551108|ref|YP_002283025.1| competence protein F (phosphoribosyltransferase protein) [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209536864|gb|ACI56799.1| competence protein F (phosphoribosyltransferase protein) [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 258

 Score = 83.3 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF + +     + G +I+LIDDVYTTGAT   A+  L+KAGA  +++LTF+R+L +
Sbjct: 198 VRGAFAIAKGCENDIFGKRIVLIDDVYTTGATVAAASRTLRKAGAAEITVLTFARALSE 256


>gi|116751311|ref|YP_847998.1| phosphoribosyltransferase [Syntrophobacter fumaroxidans MPOB]
 gi|116700375|gb|ABK19563.1| phosphoribosyltransferase [Syntrophobacter fumaroxidans MPOB]
          Length = 259

 Score = 83.3 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++NAF V       V G  IL++DDV+TTG T    A ALKK GA +V  LT +R+L D
Sbjct: 191 VKNAFRVKDETR--VEGKSILIVDDVFTTGTTLSECARALKKGGAASVHALTVARALPD 247


>gi|190893598|ref|YP_001980140.1| competence protein F (phosphoribosyltransferase) [Rhizobium etli
           CIAT 652]
 gi|190698877|gb|ACE92962.1| competence protein F (phosphoribosyltransferase protein) [Rhizobium
           etli CIAT 652]
          Length = 258

 Score = 82.9 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF + +     + G +I+LIDDVYTTGAT   A+  L+KAGA  +++LTF+R+L +
Sbjct: 198 VRGAFAIAKGRENDIFGKRIVLIDDVYTTGATVAAASRTLRKAGAAEITVLTFARALSE 256


>gi|254472326|ref|ZP_05085726.1| phosphoribosyltransferase [Pseudovibrio sp. JE062]
 gi|211958609|gb|EEA93809.1| phosphoribosyltransferase [Pseudovibrio sp. JE062]
          Length = 281

 Score = 82.9 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 34/59 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ AF V ++    V+G  ++L+DDV TTGAT +     LK AGA  V +L F+    +
Sbjct: 216 VKGAFEVSEHFLAKVSGAHVVLVDDVLTTGATVEECTRVLKAAGAKQVDVLVFALVDPE 274


>gi|86747153|ref|YP_483649.1| phosphoribosyltransferase [Rhodopseudomonas palustris HaA2]
 gi|86570181|gb|ABD04738.1| Phosphoribosyltransferase [Rhodopseudomonas palustris HaA2]
          Length = 254

 Score = 82.9 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF VP      V G +I+L+DDV T+GAT    A AL +A A +V +L F+R +
Sbjct: 191 VQGAFKVPAERKAEVQGRRIVLVDDVLTSGATVDACARALLRAKAQSVDVLVFARVV 247


>gi|241206509|ref|YP_002977605.1| competence protein F (phosphoribosyltransferase protein) [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240860399|gb|ACS58066.1| competence protein F (phosphoribosyltransferase protein) [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 258

 Score = 82.9 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF + +     + G +I+LIDDVYTTGAT   A+  L+KAGA  +++LTF+R+L +
Sbjct: 198 VRGAFAIAKGCENDIFGKRIVLIDDVYTTGATVAAASRTLRKAGATDITVLTFARALSE 256


>gi|160897117|ref|YP_001562699.1| ComF family protein [Delftia acidovorans SPH-1]
 gi|160362701|gb|ABX34314.1| ComF family protein [Delftia acidovorans SPH-1]
          Length = 244

 Score = 81.7 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 26/57 (45%), Positives = 34/57 (59%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R  F VP     HV G ++LLIDDV TTGA+    A  L++AGA  VS L  +R+ 
Sbjct: 188 LRGVFAVPPAQLPHVRGRRVLLIDDVMTTGASLHALATCLRRAGAAEVSALVLARTP 244


>gi|254293167|ref|YP_003059190.1| phosphoribosyltransferase [Hirschia baltica ATCC 49814]
 gi|254041698|gb|ACT58493.1| phosphoribosyltransferase [Hirschia baltica ATCC 49814]
          Length = 232

 Score = 81.7 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 40/58 (68%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +  AF++ +   K +AG ++LL+DDVYTTGAT +    ALK++GA +V ++T SR + 
Sbjct: 169 VEGAFHIAERHRKKLAGKRVLLVDDVYTTGATVEACCRALKRSGATSVDVITLSRVVS 226


>gi|85713804|ref|ZP_01044794.1| phosphoribosyltransferase [Nitrobacter sp. Nb-311A]
 gi|85699708|gb|EAQ37575.1| phosphoribosyltransferase [Nitrobacter sp. Nb-311A]
          Length = 269

 Score = 81.7 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 34/57 (59%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF V    S HV G +++LIDDV T+GAT    A  L +A A  V +L F+R +
Sbjct: 206 VQGAFKVAAERSSHVQGRRVILIDDVLTSGATVDACARVLLRAKAAQVDVLVFARVV 262


>gi|254780309|ref|YP_003064722.1| comF family protein [Candidatus Liberibacter asiaticus str.
          psy62]
 gi|254039986|gb|ACT56782.1| comF family protein [Candidatus Liberibacter asiaticus str.
          psy62]
          Length = 59

 Score = 80.9 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 59/59 (100%), Positives = 59/59 (100%)

Query: 1  MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
          MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD
Sbjct: 1  MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59


>gi|261884092|ref|ZP_06008131.1| competence protein F [Campylobacter fetus subsp. venerealis str.
           Azul-94]
          Length = 127

 Score = 80.9 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 31/59 (52%), Positives = 40/59 (67%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VP+    H++G ++LLIDD YTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 69  VDGAFRVPKEHEIHISGRRVLLIDDGYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 127


>gi|114704317|ref|ZP_01437225.1| hypothetical protein FP2506_05271 [Fulvimarina pelagi HTCC2506]
 gi|114539102|gb|EAU42222.1| hypothetical protein FP2506_05271 [Fulvimarina pelagi HTCC2506]
          Length = 249

 Score = 80.6 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 36/56 (64%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF V       V    +LLIDDV+TTG+T   A  ALK+AGA +V++LTF+R 
Sbjct: 189 VRGAFRVAPERYDRVMAKTVLLIDDVFTTGSTVASATKALKRAGAKSVNVLTFARV 244


>gi|332529993|ref|ZP_08405943.1| phosphoribosyltransferase [Hylemonella gracilis ATCC 19624]
 gi|332040466|gb|EGI76842.1| phosphoribosyltransferase [Hylemonella gracilis ATCC 19624]
          Length = 249

 Score = 80.6 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 24/59 (40%), Positives = 38/59 (64%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +++AF VP    + + G ++LLIDDV TTGAT   AA  L++AGA+ +  L  +R+  +
Sbjct: 189 VQDAFGVPPGKRRRIEGQRLLLIDDVMTTGATLNAAAAVLREAGAVEICALVLARTPLE 247


>gi|182678125|ref|YP_001832271.1| phosphoribosyltransferase [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182634008|gb|ACB94782.1| phosphoribosyltransferase [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 264

 Score = 80.6 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 33/57 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           M+ AF VP+     V G  I+L+DDV T+GAT   AA  L +  A  V +L F+R +
Sbjct: 208 MQGAFVVPEEARSRVEGRSIVLVDDVLTSGATLNAAARVLLRHRAARVDVLVFARVI 264


>gi|116254026|ref|YP_769864.1| hypothetical protein RL4290 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258674|emb|CAK09778.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 246

 Score = 80.6 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF + +     + G +I+LIDDVYTTGAT   A+  L+KAGA  +++LTF+R+L +
Sbjct: 186 VRGAFAIAKGSENDIFGKRIVLIDDVYTTGATVAAASRTLRKAGATDITVLTFARALSE 244


>gi|115522182|ref|YP_779093.1| phosphoribosyltransferase [Rhodopseudomonas palustris BisA53]
 gi|115516129|gb|ABJ04113.1| phosphoribosyltransferase [Rhodopseudomonas palustris BisA53]
          Length = 273

 Score = 80.2 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 33/57 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF VP      + G +ILL+DDV T+GAT    A AL +A A  V +  F+R +
Sbjct: 210 VQGAFKVPAERRAELQGRRILLVDDVLTSGATVDACARALLRAKAKAVDVAVFARVV 266


>gi|90420200|ref|ZP_01228108.1| competence protein F [Aurantimonas manganoxydans SI85-9A1]
 gi|90335534|gb|EAS49284.1| competence protein F [Aurantimonas manganoxydans SI85-9A1]
          Length = 249

 Score = 79.4 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 37/56 (66%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF V +     + G ++LL+DDVYTTGAT   A  ALK+AGA  V +LTF+R 
Sbjct: 189 VRGAFQVVETRRDELDGKRVLLVDDVYTTGATVASATRALKRAGARDVDVLTFARV 244


>gi|308273050|emb|CBX29654.1| hypothetical protein N47_J06350 [uncultured Desulfobacterium sp.]
          Length = 276

 Score = 79.4 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/57 (45%), Positives = 37/57 (64%), Gaps = 2/57 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF V ++    V   +ILLIDDVYTTGATA   A AL +AG  +V +LT + ++
Sbjct: 222 IKGAFTVNKHCK--VKKTRILLIDDVYTTGATADECAKALFEAGVQSVDVLTIAGAI 276


>gi|329847920|ref|ZP_08262948.1| phosphoribosyl transferase domain protein [Asticcacaulis
           biprosthecum C19]
 gi|328842983|gb|EGF92552.1| phosphoribosyl transferase domain protein [Asticcacaulis
           biprosthecum C19]
          Length = 272

 Score = 79.0 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 38/59 (64%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF V    +K VAG +++LIDDV+TTGAT K     L KAGA  V +   +R++++
Sbjct: 212 VRKAFAVSASGAKAVAGKRVVLIDDVFTTGATLKACTRELLKAGAAQVDVAVLARAVQE 270


>gi|75674583|ref|YP_317004.1| phosphoribosyltransferase [Nitrobacter winogradskyi Nb-255]
 gi|74419453|gb|ABA03652.1| phosphoribosyltransferase [Nitrobacter winogradskyi Nb-255]
          Length = 271

 Score = 79.0 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 34/57 (59%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF V    + HV G +++LIDDV T+GAT    A  L +A A  V +L F+R +
Sbjct: 208 VQGAFKVTAERAGHVQGRRVILIDDVLTSGATVDACARVLLRAKAAQVDVLVFARVV 264


>gi|114797458|ref|YP_761845.1| ComF family protein [Hyphomonas neptunium ATCC 15444]
 gi|114737632|gb|ABI75757.1| ComF family protein [Hyphomonas neptunium ATCC 15444]
          Length = 252

 Score = 79.0 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 34/58 (58%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +  AF+V     K   G +ILL+DDV TTGAT      ALK+AGA  + +L  +R ++
Sbjct: 189 VTGAFDVRASRRKLEEGRRILLVDDVLTTGATLNACTRALKRAGARQIDVLVLARVVR 246


>gi|225873655|ref|YP_002755114.1| ComF family protein [Acidobacterium capsulatum ATCC 51196]
 gi|225792065|gb|ACO32155.1| ComF family protein [Acidobacterium capsulatum ATCC 51196]
          Length = 310

 Score = 79.0 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 40/59 (67%), Gaps = 1/59 (1%)

Query: 1   MRNAFNVPQYV-SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF VP+      V G  +LLIDD+YTTGATA   ++AL++AGA +V + T +R+ +
Sbjct: 201 VRGAFFVPEGRAQAAVKGRDVLLIDDIYTTGATAHACSLALRRAGAASVRVATVARAQR 259


>gi|222053719|ref|YP_002536081.1| amidophosphoribosyltransferase-like protein [Geobacter sp. FRC-32]
 gi|221563008|gb|ACM18980.1| amidophosphoribosyltransferase-like protein [Geobacter sp. FRC-32]
          Length = 239

 Score = 79.0 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 40/59 (67%), Gaps = 2/59 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ AF V +   + VA  +I+LIDDV+TTG+T +  A  LKKAGA  + I+T +R+L +
Sbjct: 183 VKGAFAVAE--PERVADRRIILIDDVFTTGSTVEECAKTLKKAGAAEIFIITVARALSN 239


>gi|316932065|ref|YP_004107047.1| phosphoribosyltransferase [Rhodopseudomonas palustris DX-1]
 gi|315599779|gb|ADU42314.1| phosphoribosyltransferase [Rhodopseudomonas palustris DX-1]
          Length = 271

 Score = 78.6 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 38/57 (66%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF VP++    + G +I+LIDDV T+GAT    A AL +A A++V +L F+R +
Sbjct: 208 VQGAFKVPKHRKAEIHGRRIVLIDDVLTSGATVDACARALLRARAVSVEVLVFARVV 264


>gi|209965933|ref|YP_002298848.1| competence protein F [Rhodospirillum centenum SW]
 gi|209959399|gb|ACJ00036.1| competence protein F [Rhodospirillum centenum SW]
          Length = 263

 Score = 78.6 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 36/58 (62%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +  AF V       V G +I+L+DDV+TTGAT +  A  LK+AGA  V +LT +R ++
Sbjct: 201 VAGAFAVRAACRDRVRGARIVLLDDVFTTGATVEECARVLKRAGAARVDVLTLARVVR 258


>gi|148553483|ref|YP_001261065.1| phosphoribosyltransferase [Sphingomonas wittichii RW1]
 gi|148498673|gb|ABQ66927.1| phosphoribosyltransferase [Sphingomonas wittichii RW1]
          Length = 248

 Score = 78.2 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 38/59 (64%), Gaps = 2/59 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF V       V G  +LL+DDVYTTGATA   A AL++AGA  V ++ ++R ++D
Sbjct: 187 VRGAFAVRD--RGAVKGRAVLLVDDVYTTGATADACARALRRAGASRVDLICWARVVRD 243


>gi|56552061|ref|YP_162900.1| amidophosphoribosyltransferase [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|56543635|gb|AAV89789.1| amidophosphoribosyltransferase [Zymomonas mobilis subsp. mobilis
           ZM4]
          Length = 281

 Score = 78.2 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 37/60 (61%), Gaps = 1/60 (1%)

Query: 1   MRNAFNVPQYVSKH-VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++NAF +        +AG  I+LIDDV+T+GAT +  A  LKKAG  +V +L ++R +  
Sbjct: 218 VKNAFGLRIGKKDRPLAGRDIILIDDVFTSGATTESCARLLKKAGVKSVHVLCWARVIPQ 277


>gi|218528400|ref|YP_002419216.1| competence protein F [Methylobacterium chloromethanicum CM4]
 gi|218520703|gb|ACK81288.1| competence protein F [Methylobacterium chloromethanicum CM4]
          Length = 255

 Score = 78.2 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 38/59 (64%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ AF VP+     +AG ++LLIDDV TTGAT   AA  L + GA +V +LTF+   +D
Sbjct: 195 LQGAFRVPEDARSRIAGRRLLLIDDVATTGATGNAAARVLLRGGAASVDLLTFATVTRD 253


>gi|163849759|ref|YP_001637802.1| competence protein F [Methylobacterium extorquens PA1]
 gi|163661364|gb|ABY28731.1| competence protein F [Methylobacterium extorquens PA1]
          Length = 255

 Score = 78.2 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 37/59 (62%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ AF VP      +AG ++LLIDDV TTGAT   AA  L + GA +V +LTF+   +D
Sbjct: 195 LQGAFRVPDDARSRIAGRRLLLIDDVATTGATGNAAARVLLRGGAASVDLLTFATVTRD 253


>gi|254558820|ref|YP_003065915.1| phosphoribosyltransferase [Methylobacterium extorquens DM4]
 gi|254266098|emb|CAX21850.1| putative phosphoribosyltransferase [Methylobacterium extorquens
           DM4]
          Length = 255

 Score = 78.2 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 38/59 (64%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ AF VP+     +AG ++LLIDDV TTGAT   AA  L + GA +V +LTF+   +D
Sbjct: 195 LQGAFRVPEDARSRIAGRRLLLIDDVATTGATGNAAARVLLRGGAASVDLLTFATVTRD 253


>gi|163792772|ref|ZP_02186749.1| Phosphoribosyltransferase [alpha proteobacterium BAL199]
 gi|159182477|gb|EDP66986.1| Phosphoribosyltransferase [alpha proteobacterium BAL199]
          Length = 248

 Score = 77.9 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 35/57 (61%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF V       +A  ++LL+DDV T+GATA   A  L +AGA +V +LT +R +
Sbjct: 192 VQGAFRVDDRRRSEIADRRVLLVDDVLTSGATAGACARVLLRAGAASVDLLTLARVV 248


>gi|309379776|emb|CBX21552.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 165

 Score = 77.9 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 26/57 (45%), Positives = 35/57 (61%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF + + + K   G  ILLIDDV+TTGAT    A  LKK+GA  V   T +R+ 
Sbjct: 109 IKNAFEIREPLPK---GCNILLIDDVFTTGATLNELAKMLKKSGARRVCCWTLARTP 162


>gi|71906257|ref|YP_283844.1| phosphoribosyltransferase [Dechloromonas aromatica RCB]
 gi|71845878|gb|AAZ45374.1| Phosphoribosyltransferase [Dechloromonas aromatica RCB]
          Length = 247

 Score = 77.5 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 34/58 (58%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF         ++G ++LLIDDV TTGAT    A  LK  GA +V++   +R+L+
Sbjct: 193 VRGAFE----CRTDLSGRRLLLIDDVMTTGATVNECARVLKLHGAASVTVAVIARALR 246


>gi|218659666|ref|ZP_03515596.1| competence protein F (phosphoribosyltransferase protein) [Rhizobium
           etli IE4771]
          Length = 182

 Score = 77.5 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 42/59 (71%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF + +     + G +++LIDDVYTTGAT   A+ AL+KAGA  +++LTF+R+L +
Sbjct: 122 VRGAFAIAKGRENDIFGKRVVLIDDVYTTGATVAAASRALRKAGAAEITVLTFARALSE 180


>gi|269214467|ref|ZP_06158596.1| ComF/gntX family protein [Neisseria lactamica ATCC 23970]
 gi|269209759|gb|EEZ76214.1| ComF/gntX family protein [Neisseria lactamica ATCC 23970]
          Length = 165

 Score = 77.5 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 26/57 (45%), Positives = 35/57 (61%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF + + + K   G  ILLIDDV+TTGAT    A  LKK+GA  V   T +R+ 
Sbjct: 109 IKNAFEIREPLPK---GCNILLIDDVFTTGATLNELAKMLKKSGARRVCCWTLARTP 162


>gi|317154568|ref|YP_004122616.1| phosphoribosyltransferase [Desulfovibrio aespoeensis Aspo-2]
 gi|316944819|gb|ADU63870.1| phosphoribosyltransferase [Desulfovibrio aespoeensis Aspo-2]
          Length = 260

 Score = 77.1 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 37/59 (62%), Gaps = 3/59 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R+AF         VAG  ILL+DDVYTTGAT    A  L++AGA  +S+L  +R+ ++
Sbjct: 203 IRDAFAANP---AQVAGRSILLVDDVYTTGATLTECARTLRRAGAAGLSVLVLARARRE 258


>gi|218779784|ref|YP_002431102.1| phosphoribosyltransferase [Desulfatibacillum alkenivorans AK-01]
 gi|218761168|gb|ACL03634.1| phosphoribosyltransferase [Desulfatibacillum alkenivorans AK-01]
          Length = 252

 Score = 77.1 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 27/58 (46%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF V       V G  +LL+DDV+TTGATA   A AL KAGA  V +LT +  ++
Sbjct: 197 IRGAFAV--VRPDLVRGKNVLLVDDVFTTGATANECAKALLKAGAKKVDVLTLAVVVR 252


>gi|85859102|ref|YP_461304.1| amidophosphoribosyltransferase family protein [Syntrophus
           aciditrophicus SB]
 gi|85722193|gb|ABC77136.1| amidophosphoribosyltransferase family protein [Syntrophus
           aciditrophicus SB]
          Length = 239

 Score = 77.1 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 25/56 (44%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +RNAF V       + G +ILL+DDVYTTG+T    A  L + GA +VS+ T +R+
Sbjct: 186 VRNAFEV--VRKAEIEGSRILLVDDVYTTGSTVGECARVLLEGGARSVSVATLARA 239


>gi|320108567|ref|YP_004184157.1| phosphoribosyltransferase [Terriglobus saanensis SP1PR4]
 gi|319927088|gb|ADV84163.1| phosphoribosyltransferase [Terriglobus saanensis SP1PR4]
          Length = 281

 Score = 77.1 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF V       +AG  ILL+DD+YTTGATA+  +  L  AGA +V +LT +R+
Sbjct: 205 LRGAFRV--TRPGKIAGRDILLVDDIYTTGATARECSKTLLAAGAHSVHVLTLARA 258


>gi|240136967|ref|YP_002961436.1| putative phosphoribosyltransferase [Methylobacterium extorquens
           AM1]
 gi|240006933|gb|ACS38159.1| putative phosphoribosyltransferase [Methylobacterium extorquens
           AM1]
          Length = 255

 Score = 77.1 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 38/59 (64%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ AF VP+     +AG ++LLIDDV TTGAT   AA  L + GA +V +LTF+   +D
Sbjct: 195 LQGAFRVPEDARSRIAGRRLLLIDDVATTGATGNAAAPVLLRGGAASVDLLTFATVTRD 253


>gi|83859693|ref|ZP_00953213.1| phosphoribosyltransferase [Oceanicaulis alexandrii HTCC2633]
 gi|83852052|gb|EAP89906.1| phosphoribosyltransferase [Oceanicaulis alexandrii HTCC2633]
          Length = 185

 Score = 77.1 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 36/58 (62%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +  AF V +     V G + +L+DDV+TTGAT +  A  LK+AGA  V+ +T +R +K
Sbjct: 122 VAGAFMVREAAKPFVQGRRFVLVDDVHTTGATLQACARVLKRAGAEDVTAITLARVVK 179


>gi|297618073|ref|YP_003703232.1| phosphoribosyltransferase [Syntrophothermus lipocalidus DSM 12680]
 gi|297145910|gb|ADI02667.1| phosphoribosyltransferase [Syntrophothermus lipocalidus DSM 12680]
          Length = 239

 Score = 77.1 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 36/54 (66%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF+V     + + G  ILL+DDVYTTG+TAK  A  L  AGA  VS++T++
Sbjct: 183 LKGAFDVRD--CEKIRGKNILLVDDVYTTGSTAKECATVLLDAGANRVSVITWA 234


>gi|302342707|ref|YP_003807236.1| phosphoribosyltransferase [Desulfarculus baarsii DSM 2075]
 gi|301639320|gb|ADK84642.1| phosphoribosyltransferase [Desulfarculus baarsii DSM 2075]
          Length = 225

 Score = 76.7 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 36/59 (61%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF V   ++  V G ++LLIDDV TTGAT     +AL  AGA+ V  LT SR++ +
Sbjct: 162 VSGAFAVNPRLAAQVDGRRVLLIDDVQTTGATLHECTMALLAAGAVQVRALTVSRAMGE 220


>gi|242278332|ref|YP_002990461.1| phosphoribosyltransferase [Desulfovibrio salexigens DSM 2638]
 gi|242121226|gb|ACS78922.1| phosphoribosyltransferase [Desulfovibrio salexigens DSM 2638]
          Length = 247

 Score = 76.7 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/57 (45%), Positives = 34/57 (59%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +  AF     +   VA  +ILLIDDVYTTG+T    A  L +AGA  V ++T SR+L
Sbjct: 193 LHTAFTASPSI---VADKRILLIDDVYTTGSTVDECARTLLEAGAARVEVMTLSRAL 246


>gi|46201247|ref|ZP_00208026.1| COG1040: Predicted amidophosphoribosyltransferases
           [Magnetospirillum magnetotacticum MS-1]
          Length = 344

 Score = 76.7 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/59 (38%), Positives = 35/59 (59%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF V   +   + G +++LIDDV T+GAT    A  L KAGA+ V +LT  R +++
Sbjct: 285 VAGAFRVDDRLRPRLDGRRVVLIDDVMTSGATVGECARVLLKAGAVCVDVLTLGRVVRE 343


>gi|260752407|ref|YP_003225300.1| phosphoribosyltransferase [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|258551770|gb|ACV74716.1| phosphoribosyltransferase [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 281

 Score = 76.7 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/59 (38%), Positives = 36/59 (61%), Gaps = 1/59 (1%)

Query: 1   MRNAFNVPQYVSKH-VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++NAF +        +AG  I+LIDDV+T+GAT +  A  LK AG  +V +L ++R + 
Sbjct: 218 VKNAFGLRIGKKDRPLAGRDIILIDDVFTSGATTESCARLLKTAGVKSVHVLCWARVIP 276


>gi|241762015|ref|ZP_04760099.1| amidophosphoribosyltransferase [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|241373481|gb|EER63068.1| amidophosphoribosyltransferase [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
          Length = 281

 Score = 76.7 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/59 (38%), Positives = 36/59 (61%), Gaps = 1/59 (1%)

Query: 1   MRNAFNVPQYVSKH-VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++NAF +        +AG  I+LIDDV+T+GAT +  A  LK AG  +V +L ++R + 
Sbjct: 218 VKNAFGLRIGKKDRPLAGRDIILIDDVFTSGATTESCARLLKTAGVKSVHVLCWARVIP 276


>gi|313669260|ref|YP_004049544.1| hypothetical protein NLA_19950 [Neisseria lactamica ST-640]
 gi|313006722|emb|CBN88192.1| conserved hypothetical protein [Neisseria lactamica 020-06]
          Length = 241

 Score = 76.3 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/57 (45%), Positives = 35/57 (61%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF + + + K   G  ILLIDDV+TTGAT    A  LKK+GA  V   T +R+ 
Sbjct: 185 IKNAFEIREPLPK---GCNILLIDDVFTTGATLNELAKMLKKSGARRVCCWTLARTP 238


>gi|294085486|ref|YP_003552246.1| putative competence protein F [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292665061|gb|ADE40162.1| putative competence protein F (COMF) [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 238

 Score = 76.3 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 25/56 (44%), Positives = 33/56 (58%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF VP +    +A   I+LIDDV TTGAT   AA  L+ AGA ++  L  +R 
Sbjct: 182 VRGAFAVPAHQKPALANRPIMLIDDVMTTGATLFEAAKTLQMAGAGSICGLVIARV 237


>gi|296444589|ref|ZP_06886553.1| phosphoribosyltransferase [Methylosinus trichosporium OB3b]
 gi|296257857|gb|EFH04920.1| phosphoribosyltransferase [Methylosinus trichosporium OB3b]
          Length = 262

 Score = 76.3 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 33/57 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           M+ AF +    +  V G  I+L+DDV TTGAT   AA  L +AGA  V +L  +R +
Sbjct: 203 MQGAFRLKPERAAAVHGRNIVLVDDVLTTGATVNAAARVLLRAGAARVDVLVLARVV 259


>gi|158425919|ref|YP_001527211.1| competence protein F [Azorhizobium caulinodans ORS 571]
 gi|158332808|dbj|BAF90293.1| competence protein F [Azorhizobium caulinodans ORS 571]
          Length = 264

 Score = 76.3 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 36/57 (63%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +  AF+VP  +   V G  +LL+DDV TTGAT +  A  L+++ A  + +LTF+R +
Sbjct: 205 VAGAFDVPPPLRAAVEGRHLLLVDDVMTTGATLESCARVLRRSSAAAIDVLTFARVV 261


>gi|328953683|ref|YP_004371017.1| phosphoribosyltransferase [Desulfobacca acetoxidans DSM 11109]
 gi|328454007|gb|AEB09836.1| phosphoribosyltransferase [Desulfobacca acetoxidans DSM 11109]
          Length = 239

 Score = 76.3 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 38/56 (67%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF V +     + G  +LL+DDVYTTGAT K   +AL++AGA TV++LT +R 
Sbjct: 183 VKGAFAVAK--PDAIIGRSVLLLDDVYTTGATVKECTLALRRAGAHTVTVLTVARV 236


>gi|20806995|ref|NP_622166.1| amidophosphoribosyltransferase [Thermoanaerobacter tengcongensis
           MB4]
 gi|254478842|ref|ZP_05092207.1| Phosphoribosyl transferase domain protein [Carboxydibrachium
           pacificum DSM 12653]
 gi|20515478|gb|AAM23770.1| predicted amidophosphoribosyltransferases [Thermoanaerobacter
           tengcongensis MB4]
 gi|214035204|gb|EEB75913.1| Phosphoribosyl transferase domain protein [Carboxydibrachium
           pacificum DSM 12653]
          Length = 228

 Score = 76.3 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF V       + G  +LL+DDV TTGAT    A ALK+ GA  V ++T +
Sbjct: 173 VKGAFKV--TYKDTIEGKNVLLVDDVLTTGATLDECAKALKENGAKEVYVVTIA 224


>gi|163759885|ref|ZP_02166969.1| phosphoribosyltransferase [Hoeflea phototrophica DFL-43]
 gi|162282843|gb|EDQ33130.1| phosphoribosyltransferase [Hoeflea phototrophica DFL-43]
          Length = 187

 Score = 75.9 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 36/58 (62%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF VP      ++G K+LL+DDV TTG+T   A  AL +AGA  V ILTF+R   
Sbjct: 122 VRGAFAVPPSQMPRISGYKVLLVDDVLTTGSTVAAATRALNRAGAEQVCILTFARVAS 179


>gi|46204162|ref|ZP_00050412.2| COG1040: Predicted amidophosphoribosyltransferases
           [Magnetospirillum magnetotacticum MS-1]
          Length = 138

 Score = 75.9 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 37/59 (62%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ AF VP+     + G ++LLIDDV TTGAT   AA  L +AGA  V +LTF+   +D
Sbjct: 78  LQGAFRVPEGSRARIQGRRLLLIDDVSTTGATGNAAARVLLRAGAARVDLLTFATVTRD 136


>gi|4768852|gb|AAD29646.1|AF124757_6 competence protein F [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 258

 Score = 75.9 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/60 (38%), Positives = 36/60 (60%), Gaps = 1/60 (1%)

Query: 1   MRNAFNVPQYVSKH-VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++NAF +        +AG  I+ IDDV+T+GAT +  A  LKKAG  +V +L ++R +  
Sbjct: 195 VKNAFGLRIGKKDRPLAGRDIIFIDDVFTSGATTESCARLLKKAGVKSVHVLCWARVIPQ 254


>gi|302875858|ref|YP_003844491.1| phosphoribosyltransferase [Clostridium cellulovorans 743B]
 gi|307689291|ref|ZP_07631737.1| phosphoribosyltransferase [Clostridium cellulovorans 743B]
 gi|302578715|gb|ADL52727.1| phosphoribosyltransferase [Clostridium cellulovorans 743B]
          Length = 225

 Score = 75.5 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 33/56 (58%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF + +     +A   IL++DDV TTGAT+ C    LK AGA  + +LT  +S
Sbjct: 168 LQGAFEINEKYKDSIANKNILIVDDVVTTGATSYCCYQQLKSAGAKKIKLLTLCKS 223


>gi|197104234|ref|YP_002129611.1| predicted amidophosphoribosyltransferase [Phenylobacterium zucineum
           HLK1]
 gi|196477654|gb|ACG77182.1| predicted amidophosphoribosyltransferase [Phenylobacterium zucineum
           HLK1]
          Length = 259

 Score = 75.5 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 35/56 (62%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  AF VP      V GL IL++DDV TTGATA+  A ALK AGA +V++   +R 
Sbjct: 196 VAGAFAVPPRRRTQVEGLNILVVDDVLTTGATAEGCARALKAAGATSVNVAVVARV 251


>gi|159185776|ref|NP_357098.2| competence protein F [Agrobacterium tumefaciens str. C58]
 gi|159140910|gb|AAK89883.2| competence protein F [Agrobacterium tumefaciens str. C58]
          Length = 263

 Score = 75.2 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 41/58 (70%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF++       + G +++L+DDVYTTGAT   A+ AL+KAGA+ V++LTF+ ++ 
Sbjct: 203 VRGAFSLAPGREADIFGKRVVLVDDVYTTGATVGAASRALRKAGAVDVTVLTFAMAIS 260


>gi|300313450|ref|YP_003777542.1| amidophosphoribosyltransferase [Herbaspirillum seropedicae SmR1]
 gi|300076235|gb|ADJ65634.1| amidophosphoribosyltransferase protein [Herbaspirillum seropedicae
           SmR1]
          Length = 299

 Score = 75.2 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 26/58 (44%), Positives = 36/58 (62%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +P      V GL + ++DDV TTGAT    AI LK+ GA  V+ L F+R+L 
Sbjct: 241 VRSAFALPFATMDQVRGLHVGIVDDVMTTGATLNEVAIVLKRHGARRVTNLVFARTLP 298


>gi|325203384|gb|ADY98837.1| comF/gntX family protein [Neisseria meningitidis M01-240355]
          Length = 241

 Score = 75.2 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 25/57 (43%), Positives = 35/57 (61%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF + + + K   G  ILLIDDV+TTGAT    A  LKK+GA  +   T +R+ 
Sbjct: 185 IKNAFEIREPLPK---GCNILLIDDVFTTGATLDELAKMLKKSGANRICCWTLARTP 238


>gi|188579651|ref|YP_001923096.1| competence protein F [Methylobacterium populi BJ001]
 gi|179343149|gb|ACB78561.1| competence protein F [Methylobacterium populi BJ001]
          Length = 255

 Score = 74.8 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 36/59 (61%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ AF V       +AG ++LLIDDV TTGAT   AA  L +AGA  V +LTF+   +D
Sbjct: 195 LQGAFRVADRARLRIAGRRLLLIDDVSTTGATGNAAARVLLRAGAAGVDLLTFATVARD 253


>gi|121603784|ref|YP_981113.1| hypothetical protein Pnap_0875 [Polaromonas naphthalenivorans CJ2]
 gi|120592753|gb|ABM36192.1| conserved hypothetical protein [Polaromonas naphthalenivorans CJ2]
          Length = 255

 Score = 74.8 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 35/58 (60%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF V    +  + G +++L+DDV T+GA+   AA AL+ AGA  ++ +  +R+  
Sbjct: 197 VRGAFQVDPLRAPQLQGRRVVLVDDVMTSGASLFAAAQALRDAGAARITAVVLARTPP 254


>gi|92116101|ref|YP_575830.1| phosphoribosyltransferase [Nitrobacter hamburgensis X14]
 gi|91798995|gb|ABE61370.1| phosphoribosyltransferase [Nitrobacter hamburgensis X14]
          Length = 270

 Score = 74.4 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 33/57 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF +    +  + G ++++IDDV T+GAT    A  L +A A  V +L F+R +
Sbjct: 207 VQGAFKIATERTSRIQGRRVIVIDDVLTSGATVDACARVLLRAKAAQVDVLVFARVV 263


>gi|290969085|ref|ZP_06560618.1| ComF family protein [Megasphaera genomosp. type_1 str. 28L]
 gi|290780882|gb|EFD93477.1| ComF family protein [Megasphaera genomosp. type_1 str. 28L]
          Length = 220

 Score = 74.4 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 32/54 (59%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++NAF +    +  V G  I+++DD+YTTGAT    A  LKK GA  ++ L  +
Sbjct: 163 IKNAFAIKGNCASMVKGRHIIVVDDIYTTGATLDGCARVLKKHGAAMITGLVMA 216


>gi|302036453|ref|YP_003796775.1| putative phosphoribosyltransferase [Candidatus Nitrospira defluvii]
 gi|300604517|emb|CBK40849.1| putative Phosphoribosyltransferase [Candidatus Nitrospira defluvii]
          Length = 270

 Score = 74.4 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 26/57 (45%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +  AF +       V G +IL+IDDV+TTG TA   A  L  AGA  V++LT +RSL
Sbjct: 193 LHRAFALR--APGEVTGKRILIIDDVFTTGTTANECAKVLLNAGAKDVAVLTLARSL 247


>gi|90022782|ref|YP_528609.1| K+-dependent Na+/Ca+ exchanger related-protein [Saccharophagus
           degradans 2-40]
 gi|89952382|gb|ABD82397.1| phosphoribosyltransferase [Saccharophagus degradans 2-40]
          Length = 296

 Score = 74.4 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 34/58 (58%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R +F V   +   V G  I ++DDV TTGATA+  A  LK+AGA  V I   +R+ K
Sbjct: 237 LRQSFAVAPKLLTEVKGKHIAVVDDVVTTGATAEVIANLLKEAGASRVDIWALARTPK 294


>gi|260576133|ref|ZP_05844126.1| competence protein F, putative [Rhodobacter sp. SW2]
 gi|259021613|gb|EEW24916.1| competence protein F, putative [Rhodobacter sp. SW2]
          Length = 240

 Score = 74.4 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 31/57 (54%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            AF V       +AG ++LL+DDV T+GAT      A   AGA  VS+L  +R  KD
Sbjct: 183 GAFRVNPARDWQIAGRRVLLVDDVMTSGATLAACTEACLAAGATEVSVLALARVAKD 239


>gi|94501351|ref|ZP_01307871.1| amidophosphoribosyltransferase family protein [Oceanobacter sp.
           RED65]
 gi|94426464|gb|EAT11452.1| amidophosphoribosyltransferase family protein [Oceanobacter sp.
           RED65]
          Length = 148

 Score = 74.4 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 24/59 (40%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++NAF V     +++ G  +LLIDDV TTGATA  A++ L K+GA +V +   +R+   
Sbjct: 90  VKNAFEVNSA--QYIEGKNVLLIDDVMTTGATAHEASLTLIKSGAKSVCVACLARTPPQ 146


>gi|158521918|ref|YP_001529788.1| phosphoribosyltransferase [Desulfococcus oleovorans Hxd3]
 gi|158510744|gb|ABW67711.1| phosphoribosyltransferase [Desulfococcus oleovorans Hxd3]
          Length = 279

 Score = 74.0 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF +       VAG ++L++DDV+TTGAT    A  L   GA  V +LT +R 
Sbjct: 224 VKGAFALTD--PSAVAGKRVLVVDDVFTTGATVNECARVLLAGGAKQVDVLTLARV 277


>gi|149174134|ref|ZP_01852762.1| Phosphoribosyltransferase [Planctomyces maris DSM 8797]
 gi|148847114|gb|EDL61449.1| Phosphoribosyltransferase [Planctomyces maris DSM 8797]
          Length = 252

 Score = 74.0 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF V       V  L ILL+DDV TTG+TA  A  AL +AGA  +++   +R+ +
Sbjct: 196 LRDAFQVR--RPGRVKDLSILLVDDVMTTGSTANAATRALLQAGASEINVAVIARAPR 251


>gi|297537770|ref|YP_003673539.1| phosphoribosyltransferase [Methylotenera sp. 301]
 gi|297257117|gb|ADI28962.1| phosphoribosyltransferase [Methylotenera sp. 301]
          Length = 223

 Score = 74.0 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++ AF V      H+ G +I ++DDV TTGA+    A  LK+AGA  V     +R+L 
Sbjct: 169 IKGAFTVS----NHLNGKRIAIVDDVMTTGASLNELAKTLKQAGAAHVECWVVARTLP 222


>gi|114565757|ref|YP_752911.1| phosphoribosyltransferase [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|114336692|gb|ABI67540.1| phosphoribosyltransferase [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
          Length = 239

 Score = 74.0 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           AF V Q   + V G KILL+DDVYTTG+T +     L +AGA  VS++T++
Sbjct: 186 AFKVTQ--PQKVLGKKILLVDDVYTTGSTIRECTRVLLEAGAERVSVITWA 234


>gi|187250530|ref|YP_001875012.1| phosphoribosyltransferase [Elusimicrobium minutum Pei191]
 gi|186970690|gb|ACC97675.1| Phosphoribosyltransferase [Elusimicrobium minutum Pei191]
          Length = 245

 Score = 74.0 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 34/55 (61%), Gaps = 4/55 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           M+NAF      +  + G  ILLIDDV TTG+T +  A ALKKAGA  +  LT +R
Sbjct: 190 MKNAFK----AAGKITGKTILLIDDVATTGSTLEACAEALKKAGAKNIYALTIAR 240


>gi|260431723|ref|ZP_05785694.1| competence protein F [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415551|gb|EEX08810.1| competence protein F [Silicibacter lacuscaerulensis ITI-1157]
          Length = 254

 Score = 74.0 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 34/59 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R+A  V    +  + G  +LL+DDV T+GAT      A ++AGA  +S+L  +R  KD
Sbjct: 195 LRDAITVHPRRADRLTGRHVLLVDDVMTSGATLAACTHACQEAGAADISVLVLARVAKD 253


>gi|84500737|ref|ZP_00998986.1| competence protein F, putative [Oceanicola batsensis HTCC2597]
 gi|84391690|gb|EAQ04022.1| competence protein F, putative [Oceanicola batsensis HTCC2597]
          Length = 244

 Score = 74.0 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 39/58 (67%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           + +A  V    +  VAG  +LLIDDV T+GAT   A  ALK+AGA +VS+LT +R++K
Sbjct: 185 LHDAVTVNPRRAGRVAGGSVLLIDDVMTSGATLTAATGALKRAGAASVSVLTLARAVK 242


>gi|288956999|ref|YP_003447340.1| hypothetical protein AZL_001580 [Azospirillum sp. B510]
 gi|288909307|dbj|BAI70796.1| hypothetical protein AZL_001580 [Azospirillum sp. B510]
          Length = 255

 Score = 74.0 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++ AF +     + VAG +++LIDDV TTGAT       L +AGA  V +LT +R ++
Sbjct: 199 VKGAFCLRPG--QSVAGQRLVLIDDVMTTGATLAECTRVLLRAGAARVDVLTLARVVQ 254


>gi|226324394|ref|ZP_03799912.1| hypothetical protein COPCOM_02175 [Coprococcus comes ATCC 27758]
 gi|225206842|gb|EEG89196.1| hypothetical protein COPCOM_02175 [Coprococcus comes ATCC 27758]
          Length = 246

 Score = 73.6 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 29/54 (53%), Positives = 34/54 (62%), Gaps = 4/54 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +R AF V     K+V G  I+LIDD+YTTG+T   AA  LKKAGA  V  LT S
Sbjct: 192 IRGAFAV----QKNVKGENIVLIDDIYTTGSTLDEAARVLKKAGAEKVYFLTVS 241


>gi|254504618|ref|ZP_05116769.1| Phosphoribosyl transferase domain protein [Labrenzia alexandrii
           DFL-11]
 gi|222440689|gb|EEE47368.1| Phosphoribosyl transferase domain protein [Labrenzia alexandrii
           DFL-11]
          Length = 200

 Score = 73.6 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 35/54 (64%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +R AF V     + +AG +++L+DDVYTTG+T       LK AGA TV +LTF+
Sbjct: 133 VRRAFQVSGDQLQKLAGRRVVLVDDVYTTGSTVSACTKVLKSAGAGTVDVLTFA 186


>gi|320326429|gb|EFW82482.1| competence protein ComF [Pseudomonas syringae pv. glycinea str.
           B076]
          Length = 244

 Score = 73.6 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +       V G  + L+DDV TTG+TA+  A  L KAGA  V +   +R+ K
Sbjct: 186 LRDAFTLVD--PDRVQGKHLALVDDVLTTGSTAEVIARLLNKAGARRVDVYCLARTPK 241


>gi|167038183|ref|YP_001665761.1| phosphoribosyltransferase [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|167039108|ref|YP_001662093.1| phosphoribosyltransferase [Thermoanaerobacter sp. X514]
 gi|300913302|ref|ZP_07130619.1| phosphoribosyltransferase [Thermoanaerobacter sp. X561]
 gi|307723684|ref|YP_003903435.1| phosphoribosyltransferase [Thermoanaerobacter sp. X513]
 gi|320116592|ref|YP_004186751.1| phosphoribosyltransferase [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|166853348|gb|ABY91757.1| phosphoribosyltransferase [Thermoanaerobacter sp. X514]
 gi|166857017|gb|ABY95425.1| phosphoribosyltransferase [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|300889987|gb|EFK85132.1| phosphoribosyltransferase [Thermoanaerobacter sp. X561]
 gi|307580745|gb|ADN54144.1| phosphoribosyltransferase [Thermoanaerobacter sp. X513]
 gi|319929683|gb|ADV80368.1| phosphoribosyltransferase [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
          Length = 229

 Score = 73.6 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF V       + G  +LL+DDV TTGAT    A  LK+ GA  V + T +
Sbjct: 173 VKGAFKV--TYKDTIVGKNVLLVDDVLTTGATLDECAKVLKENGAKDVYVATIA 224


>gi|313496727|gb|ADR58093.1| Competence protein ComF, putative [Pseudomonas putida BIRD-1]
          Length = 243

 Score = 73.6 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 34/58 (58%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF V       + G  + ++DDV TTGATA+  A AL+KAGA  V +   +R+ K
Sbjct: 186 LRQAFAV----KGELEGKHVAIVDDVLTTGATAQAIAQALRKAGARRVDVYCLARTPK 239


>gi|311031944|ref|ZP_07710034.1| late competence protein [Bacillus sp. m3-13]
          Length = 237

 Score = 73.6 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 28/55 (50%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
            N F VP    + V G  ILLIDD+YTTG T + AA  LK AGA  +S  T  RS
Sbjct: 185 ENTFYVPN--PEQVKGKNILLIDDIYTTGTTVRMAAKVLKDAGAKEISSFTLVRS 237


>gi|85708603|ref|ZP_01039669.1| amidophosphoribosyltransferase [Erythrobacter sp. NAP1]
 gi|85690137|gb|EAQ30140.1| amidophosphoribosyltransferase [Erythrobacter sp. NAP1]
          Length = 287

 Score = 73.6 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R A  V       + G  ++L+DDV T+GAT+     AL  AGA++V I  F+R +
Sbjct: 202 LRGAIEVRANAKGSITGRNVILVDDVLTSGATSDACTKALLDAGAVSVRIACFARVV 258


>gi|209883247|ref|YP_002287104.1| phosphoribosyltransferase [Oligotropha carboxidovorans OM5]
 gi|209871443|gb|ACI91239.1| phosphoribosyltransferase [Oligotropha carboxidovorans OM5]
          Length = 278

 Score = 73.6 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 33/57 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF V       V G + +LIDDV T+GAT +    AL +A A +V +L F+R +
Sbjct: 215 VQGAFAVEADQRAAVKGRRFILIDDVLTSGATTQACTRALLRAKAASVDVLVFARVV 271


>gi|148545642|ref|YP_001265744.1| amidophosphoribosyltransferase-like protein [Pseudomonas putida F1]
 gi|148509700|gb|ABQ76560.1| amidophosphoribosyltransferase-like protein [Pseudomonas putida F1]
          Length = 243

 Score = 73.6 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 34/58 (58%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF V       + G  + ++DDV TTGATA+  A AL+KAGA  V +   +R+ K
Sbjct: 186 LRQAFAV----MGKLQGKHVAIVDDVLTTGATAQAIAQALRKAGARQVDVYCLARTPK 239


>gi|224368951|ref|YP_002603115.1| ComF [Desulfobacterium autotrophicum HRM2]
 gi|223691668|gb|ACN14951.1| ComF [Desulfobacterium autotrophicum HRM2]
          Length = 291

 Score = 73.2 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 39/56 (69%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF V     + + G +ILLIDDV+TTGAT+  AA+ L KAGA++V +L  +R+
Sbjct: 238 LRGAFTVRGT--EKIEGRRILLIDDVFTTGATSGEAALTLFKAGALSVDLLVLARA 291


>gi|77461398|ref|YP_350905.1| phosphoribosyltransferase [Pseudomonas fluorescens Pf0-1]
 gi|77385401|gb|ABA76914.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1]
          Length = 246

 Score = 73.2 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +       V G  + L+DDV TTGATA+  A  L  AGA  V +   +R+ K
Sbjct: 186 LRHAFALSAD--AQVQGRHLALVDDVLTTGATAQALARLLMDAGAARVDVYCLARTPK 241


>gi|118588528|ref|ZP_01545937.1| phosphoribosyltransferase [Stappia aggregata IAM 12614]
 gi|118439234|gb|EAV45866.1| phosphoribosyltransferase [Stappia aggregata IAM 12614]
          Length = 253

 Score = 73.2 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 33/56 (58%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R+AF V    +  V G  ++LIDDV TTG+T       L  +GA +V +LTF++ 
Sbjct: 188 VRSAFKVDSARADLVQGRHVVLIDDVLTTGSTVSACCKCLLSSGAASVDVLTFAQV 243


>gi|229592992|ref|YP_002875111.1| hypothetical protein PFLU5616 [Pseudomonas fluorescens SBW25]
 gi|229364858|emb|CAY52911.1| conserved hypothetical protein [Pseudomonas fluorescens SBW25]
          Length = 245

 Score = 73.2 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 27/56 (48%), Gaps = 2/56 (3%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            AF +       V G    L+DDV TTGATA   A  L  AGA  V +   +R+ K
Sbjct: 189 GAFALAPG--AQVQGRHFALVDDVLTTGATAHSLARLLINAGARQVDVYCLARTPK 242


>gi|289577708|ref|YP_003476335.1| phosphoribosyltransferase [Thermoanaerobacter italicus Ab9]
 gi|289527421|gb|ADD01773.1| phosphoribosyltransferase [Thermoanaerobacter italicus Ab9]
          Length = 229

 Score = 73.2 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF V       + G  +LL+DDV TTGAT    A  LK+ GA  V + T +
Sbjct: 173 VKGAFKV--TYKDTIIGKNVLLVDDVLTTGATLDECAKVLKENGAKDVYVATIA 224


>gi|297544021|ref|YP_003676323.1| phosphoribosyltransferase [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|296841796|gb|ADH60312.1| phosphoribosyltransferase [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
          Length = 229

 Score = 73.2 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF V       + G  +LL+DDV TTGAT    A  LK+ GA  V + T +
Sbjct: 173 VKGAFKV--TYKDTIIGRNVLLVDDVLTTGATLDECAKVLKENGAKDVYVATIA 224


>gi|221065311|ref|ZP_03541416.1| ComF family protein [Comamonas testosteroni KF-1]
 gi|220710334|gb|EED65702.1| ComF family protein [Comamonas testosteroni KF-1]
          Length = 254

 Score = 72.8 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 32/57 (56%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +RN F++       + G  ILL+DDV TTGAT    A  L  AGA +VS +  +R+ 
Sbjct: 198 LRNVFSLDPARKALIEGQAILLLDDVMTTGATLDALARCLLSAGAASVSAVVLARTP 254


>gi|162147687|ref|YP_001602148.1| phosphoribosyltransferase [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786264|emb|CAP55846.1| putative phosphoribosyltransferase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 276

 Score = 72.8 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 30/57 (52%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +  A  V       +A  +I+L+DDV TTGAT    A  L  AGA +V +L  +R+ 
Sbjct: 206 LHGAIAVRPSRRAAIANRRIVLVDDVMTTGATTGECARVLLAAGAASVDVLVAARAP 262


>gi|149182540|ref|ZP_01861012.1| late competence protein [Bacillus sp. SG-1]
 gi|148849732|gb|EDL63910.1| late competence protein [Bacillus sp. SG-1]
          Length = 237

 Score = 72.8 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 31/51 (60%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           F +   +   +    ILLIDD+YTTG T + AA  LK+AGA  ++ LT +R
Sbjct: 186 FGINPDLQPEINNKSILLIDDIYTTGTTLRQAARILKEAGAKEITSLTLAR 236


>gi|26987103|ref|NP_742528.1| competence protein ComF, putative [Pseudomonas putida KT2440]
 gi|24981731|gb|AAN65992.1|AE016228_5 competence protein ComF, putative [Pseudomonas putida KT2440]
          Length = 243

 Score = 72.8 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 34/58 (58%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF V       + G  + ++DDV TTGATA+  A AL+KAGA  V +   +R+ K
Sbjct: 186 LRQAFAV----QGELEGKHVAIVDDVLTTGATAQAIAQALRKAGARRVDVYCLARTPK 239


>gi|209542312|ref|YP_002274541.1| putative phosphoribosyltransferase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209529989|gb|ACI49926.1| putative phosphoribosyltransferase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 260

 Score = 72.8 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 30/57 (52%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +  A  V       +A  +I+L+DDV TTGAT    A  L  AGA +V +L  +R+ 
Sbjct: 190 LHGAIAVRPSRRAAIANRRIVLVDDVMTTGATTGECARVLLAAGAASVDVLVAARAP 246


>gi|83592076|ref|YP_425828.1| phosphoribosyltransferase [Rhodospirillum rubrum ATCC 11170]
 gi|83574990|gb|ABC21541.1| Phosphoribosyltransferase [Rhodospirillum rubrum ATCC 11170]
          Length = 246

 Score = 72.8 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF V       +AG +++LIDDV TTGATA   A AL  AGA  V +LT +R 
Sbjct: 188 VQGAFVV--VRPDEIAGRRVVLIDDVLTTGATANACARALLAAGATGVDVLTLARV 241


>gi|154247019|ref|YP_001417977.1| phosphoribosyltransferase [Xanthobacter autotrophicus Py2]
 gi|154161104|gb|ABS68320.1| phosphoribosyltransferase [Xanthobacter autotrophicus Py2]
          Length = 255

 Score = 72.8 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 25/57 (43%), Positives = 37/57 (64%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +  AF      + H+ G ++LL+DDV+TTGAT    A AL++AGA+ V  LTF+R +
Sbjct: 196 VAGAFAACGNAASHLEGRRVLLVDDVFTTGATLDACAQALRRAGAIQVDALTFARVV 252


>gi|328542087|ref|YP_004302196.1| phosphoribosyl transferase domain protein [polymorphum gilvum
           SL003B-26A1]
 gi|326411836|gb|ADZ68899.1| Phosphoribosyl transferase domain protein [Polymorphum gilvum
           SL003B-26A1]
          Length = 257

 Score = 72.8 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 32/54 (59%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +R AF +       VAG  ++L+DDV TTG+T    A  LK AGA  V +LTF+
Sbjct: 195 VRGAFRLRAGAEAQVAGRPVVLVDDVLTTGSTVTACARVLKAAGAAGVDVLTFA 248


>gi|152984307|ref|YP_001345987.1| putative phosphoribosyl transferase [Pseudomonas aeruginosa PA7]
 gi|150959465|gb|ABR81490.1| probable phosphoribosyl transferase [Pseudomonas aeruginosa PA7]
          Length = 241

 Score = 72.5 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 26/58 (44%), Positives = 37/58 (63%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +     K V GL + L+DDV TTGATA+C A  L++AGA  V +   +R+ K
Sbjct: 184 LRHAFALAPG--KEVRGLHLALVDDVLTTGATAECLARLLRRAGAARVDVYCLARTPK 239


>gi|327482505|gb|AEA85815.1| phosphoribosyl transferase [Pseudomonas stutzeri DSM 4166]
          Length = 234

 Score = 72.5 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +       V G  + L+DDV TTGATA+  A  LK+AGA  V +   +R+ K
Sbjct: 176 LRQAFAIATG--ADVKGRHLALVDDVLTTGATAEALARLLKRAGAERVDVYCLARTPK 231


>gi|94496926|ref|ZP_01303500.1| amidophosphoribosyltransferase [Sphingomonas sp. SKA58]
 gi|94423602|gb|EAT08629.1| amidophosphoribosyltransferase [Sphingomonas sp. SKA58]
          Length = 256

 Score = 72.5 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF +        AG ++LLIDDV T+GATA   A  LK+ GA  V +L ++R+L D
Sbjct: 190 VRGAFALAAGHG--FAGRRVLLIDDVRTSGATAAACARMLKRGGATNVRLLCWARALPD 246


>gi|299534094|ref|ZP_07047446.1| hypothetical protein CTS44_24793 [Comamonas testosteroni S44]
 gi|298718003|gb|EFI59008.1| hypothetical protein CTS44_24793 [Comamonas testosteroni S44]
          Length = 254

 Score = 72.5 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 32/57 (56%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R  F++       V G +ILL+DDV TTGAT    A  L  AGA +VS +  +R+ 
Sbjct: 198 LRGIFSLAPARQALVKGREILLLDDVMTTGATLDALAGCLLSAGAASVSAVVLARTP 254


>gi|327542904|gb|EGF29360.1| phosphoribosyl transferase [Rhodopirellula baltica WH47]
          Length = 302

 Score = 72.5 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 37/59 (62%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF V +   K +AG  ILL+DDV TTGATA   +  L  AGA  V +L  +R+++D
Sbjct: 241 VRGAFRVRRRWRKRLAGEHILLVDDVMTTGATADEISRVLLDAGAARVDLLVVARAIRD 299


>gi|330954916|gb|EGH55176.1| phosphoribosyltransferase [Pseudomonas syringae Cit 7]
          Length = 244

 Score = 72.5 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +       V G  + L+DDV TTG+TA+  A  L KAGA  V +   +R+ K
Sbjct: 186 LRGAFTLVD--PDWVQGKHLALVDDVLTTGSTAEVIARLLNKAGARRVDVYCLARTPK 241


>gi|146284179|ref|YP_001174332.1| phosphoribosyl transferase [Pseudomonas stutzeri A1501]
 gi|145572384|gb|ABP81490.1| probable phosphoribosyl transferase [Pseudomonas stutzeri A1501]
          Length = 234

 Score = 72.5 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +       V G  + L+DDV TTGATA+  A  LK+AGA  V +   +R+ K
Sbjct: 176 LRQAFAIATG--ADVKGRHLALVDDVLTTGATAEALARLLKRAGAERVDVYCLARTPK 231


>gi|32475560|ref|NP_868554.1| phosphoribosyl transferase [Rhodopirellula baltica SH 1]
 gi|32446102|emb|CAD75931.1| probable phosphoribosyl transferase [Rhodopirellula baltica SH 1]
          Length = 302

 Score = 72.5 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 37/59 (62%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF V +   K +AG  ILL+DDV TTGATA   +  L  AGA  V +L  +R+++D
Sbjct: 241 VRGAFRVRRRWRKRLAGEHILLVDDVMTTGATADEISRVLLDAGAARVDLLVVARAIRD 299


>gi|264680076|ref|YP_003279985.1| hypothetical protein CtCNB1_3943 [Comamonas testosteroni CNB-2]
 gi|262210591|gb|ACY34689.1| conserved hypothetical protein [Comamonas testosteroni CNB-2]
          Length = 254

 Score = 72.5 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 32/57 (56%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R  F++       V G +ILL+DDV TTGAT    A  L  AGA +VS +  +R+ 
Sbjct: 198 LRGIFSLAPARQALVKGREILLLDDVMTTGATLDALAGCLLSAGAASVSAVVLARTP 254


>gi|330967246|gb|EGH67506.1| competence protein ComF [Pseudomonas syringae pv. actinidiae str.
           M302091]
          Length = 244

 Score = 72.5 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF+V       V G  + LIDDV TTG+TA+  A  L  AGA  V +   +R+ K
Sbjct: 186 LRGAFSVIDA--DWVQGKHLALIDDVLTTGSTAEVIARLLNNAGARRVDVYCLARTPK 241


>gi|148266135|ref|YP_001232841.1| amidophosphoribosyltransferase-like protein [Geobacter
           uraniireducens Rf4]
 gi|146399635|gb|ABQ28268.1| amidophosphoribosyltransferase-like protein [Geobacter
           uraniireducens Rf4]
          Length = 238

 Score = 72.1 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 25/56 (44%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF V       VAG +++L+DDVYTTG+T    A  LK AGA  V ++T +R 
Sbjct: 184 VRGAFAVTD--KDAVAGKRVILVDDVYTTGSTVAECAKTLKCAGAEAVFVVTAARV 237


>gi|320331599|gb|EFW87537.1| competence protein ComF [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330872324|gb|EGH06473.1| competence protein ComF [Pseudomonas syringae pv. glycinea str.
           race 4]
          Length = 244

 Score = 72.1 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +       V G  + L+DDV TTG+TA+  A  L KAGA  V +   +R+ K
Sbjct: 186 LRDAFTLVD--PDWVQGKHLALVDDVLTTGSTAEVIARLLNKAGARRVDVYCLARTPK 241


>gi|71734602|ref|YP_276823.1| competence protein ComF [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|71555155|gb|AAZ34366.1| competence protein ComF [Pseudomonas syringae pv. phaseolicola
           1448A]
          Length = 244

 Score = 72.1 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +       V G  + L+DDV TTG+TA+  A  L KAGA  V +   +R+ K
Sbjct: 186 LRDAFTLVD--PDWVQGKHLALVDDVLTTGSTAEVIARLLNKAGARRVDVYCLARTPK 241


>gi|319407556|emb|CBI81206.1| competence protein ComF [Bartonella sp. 1-1C]
          Length = 247

 Score = 72.1 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 33/59 (55%), Positives = 40/59 (67%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++NAF VP  V K++ G  ILLIDDV TTG T   A   LK AGA  V++LTFSR LK+
Sbjct: 182 VQNAFKVPNEVKKYLEGRSILLIDDVLTTGVTVTAATKTLKHAGARQVNVLTFSRVLKN 240


>gi|307294581|ref|ZP_07574423.1| phosphoribosyltransferase [Sphingobium chlorophenolicum L-1]
 gi|306879055|gb|EFN10273.1| phosphoribosyltransferase [Sphingobium chlorophenolicum L-1]
          Length = 246

 Score = 72.1 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF +       + G  +LLIDDV+T+GATA   A  LK+ GA +V +L ++R L D
Sbjct: 187 VRGAFALTPDHG--LKGRAVLLIDDVHTSGATAAACARTLKRGGAASVHLLCWARVLPD 243


>gi|297569953|ref|YP_003691297.1| phosphoribosyltransferase [Desulfurivibrio alkaliphilus AHT2]
 gi|296925868|gb|ADH86678.1| phosphoribosyltransferase [Desulfurivibrio alkaliphilus AHT2]
          Length = 255

 Score = 72.1 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF  PQ     V    +LL+DDV+TTGAT    A  L++AGA  V + T +R 
Sbjct: 200 LKGAFVAPQPAM--VRKRSLLLVDDVFTTGATVNECAKVLRQAGAARVDVFTLARV 253


>gi|144900147|emb|CAM77011.1| competence protein F [Magnetospirillum gryphiswaldense MSR-1]
          Length = 244

 Score = 72.1 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF    +    V G  +LL+DDV TTGAT    +  L + GA  V +LT  R L
Sbjct: 186 VRGAFA--PHPRLDVCGKNVLLVDDVLTTGATLGECSRVLLRQGAARVDVLTLGRVL 240


>gi|298489185|ref|ZP_07007204.1| Competence protein F [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|298156267|gb|EFH97368.1| Competence protein F [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
          Length = 244

 Score = 72.1 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +       V G  + L+DDV TTG+TA+  A  L KAGA  V +   +R+ K
Sbjct: 186 LRDAFTLVD--PDWVQGKHLALVDDVLTTGSTAEVIARLLNKAGARRVDVYCLARTPK 241


>gi|302185790|ref|ZP_07262463.1| phosphoribosyltransferase [Pseudomonas syringae pv. syringae 642]
          Length = 244

 Score = 72.1 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +       V G  + LIDDV TTG+TA+  A  L KAGA  V +   +R+ K
Sbjct: 186 LRGAFTLVD--PDWVQGRHLALIDDVVTTGSTAEVIARLLNKAGARRVDVYCLARTPK 241


>gi|121595833|ref|YP_987729.1| ComF family protein [Acidovorax sp. JS42]
 gi|120607913|gb|ABM43653.1| ComF family protein [Acidovorax sp. JS42]
          Length = 242

 Score = 72.1 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 34/57 (59%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF      +  +AG ++LL+DDV TTGAT   AA  L+ AGA+ V  L  +R+ 
Sbjct: 186 LRGAFVPDPLRAAQLAGKRVLLVDDVMTTGATLHAAAAPLRDAGALQVCALVLARTP 242


>gi|94971228|ref|YP_593276.1| phosphoribosyltransferase [Candidatus Koribacter versatilis
           Ellin345]
 gi|94553278|gb|ABF43202.1| phosphoribosyltransferase [Candidatus Koribacter versatilis
           Ellin345]
          Length = 213

 Score = 71.7 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 25/57 (43%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +  AF VP      V G  ++L+DDV TTGATA   A  LK+AGA  V + T +R++
Sbjct: 136 LHGAFKVPD--KALVKGRNVILVDDVLTTGATADECARILKRAGAEQVLVATVARAV 190


>gi|319411246|emb|CBY91653.1| putative GntX-like protein [Neisseria meningitidis WUE 2594]
          Length = 202

 Score = 71.7 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+ 
Sbjct: 146 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLARTP 199


>gi|296840875|ref|ZP_06899408.1| ComF/gntX family protein [Neisseria polysaccharea ATCC 43768]
 gi|296839639|gb|EFH23577.1| ComF/gntX family protein [Neisseria polysaccharea ATCC 43768]
          Length = 165

 Score = 71.7 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+ 
Sbjct: 109 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLARTP 162


>gi|289624783|ref|ZP_06457737.1| competence protein ComF [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289650640|ref|ZP_06481983.1| competence protein ComF [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|330871186|gb|EGH05895.1| competence protein ComF [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 244

 Score = 71.7 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +       V G  + L+DDV TTG+TA+  A  L KAGA  V +   +R+ K
Sbjct: 186 LRDAFTLVD--PDWVQGKHLALVDDVLTTGSTAEVIARLLNKAGARRVDVYCLARTPK 241


>gi|326389598|ref|ZP_08211164.1| phosphoribosyltransferase [Thermoanaerobacter ethanolicus JW 200]
 gi|325994313|gb|EGD52739.1| phosphoribosyltransferase [Thermoanaerobacter ethanolicus JW 200]
          Length = 229

 Score = 71.7 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF V       + G   LL+DDV TTGAT    A  LK+ GA  V ++T +
Sbjct: 173 VKGAFKV--TYKDTIVGKNALLVDDVLTTGATLDECAKVLKENGAKDVYVVTIA 224


>gi|330985850|gb|EGH83953.1| competence protein ComF [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 244

 Score = 71.7 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +       V G  + L+DDV TTG+TA+  A  L KAGA  V +   +R+ K
Sbjct: 186 LRDAFTLVD--PDWVQGKHLALVDDVLTTGSTAEVIARLLNKAGARRVDVYCLARTPK 241


>gi|330979909|gb|EGH78209.1| phosphoribosyltransferase [Pseudomonas syringae pv. aptata str. DSM
           50252]
          Length = 244

 Score = 71.7 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +       V G  + L+DDV TTG+TA   A  L  AGA  V +   +R+ K
Sbjct: 186 LRGAFTLID--PDWVQGRHLALVDDVLTTGSTADVIARLLSNAGARRVDVYCLARTPK 241


>gi|307265486|ref|ZP_07547041.1| phosphoribosyltransferase [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306919440|gb|EFN49659.1| phosphoribosyltransferase [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 229

 Score = 71.7 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF V       + G   LL+DDV TTGAT    A  LK+ GA  V ++T +
Sbjct: 173 VKGAFKV--TYKDTIVGKNALLVDDVLTTGATLDECAKVLKENGAKDVYVVTIA 224


>gi|161870794|ref|YP_001599967.1| competence protein [Neisseria meningitidis 053442]
 gi|161596347|gb|ABX74007.1| competence protein [Neisseria meningitidis 053442]
          Length = 179

 Score = 71.7 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +     K      ILLIDDV+TTGAT    A  LKK+GA  +   T +R+ 
Sbjct: 123 IKNAFEIRTPPPK---NCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLARTP 176


>gi|194099619|ref|YP_002002750.1| Competence protein [Neisseria gonorrhoeae NCCP11945]
 gi|193934909|gb|ACF30733.1| Competence protein [Neisseria gonorrhoeae NCCP11945]
 gi|317165108|gb|ADV08649.1| hypothetical protein NGTW08_1692 [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 202

 Score = 71.7 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+ 
Sbjct: 146 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLARTP 199


>gi|256750931|ref|ZP_05491815.1| phosphoribosyltransferase [Thermoanaerobacter ethanolicus CCSD1]
 gi|256750266|gb|EEU63286.1| phosphoribosyltransferase [Thermoanaerobacter ethanolicus CCSD1]
          Length = 229

 Score = 71.7 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF V       + G   LL+DDV TTGAT    A  LK+ GA  V ++T +
Sbjct: 173 VKGAFKV--TYKDTIVGKNALLVDDVLTTGATLDECAKVLKENGAKDVYVVTIA 224


>gi|154252188|ref|YP_001413012.1| phosphoribosyltransferase [Parvibaculum lavamentivorans DS-1]
 gi|154156138|gb|ABS63355.1| phosphoribosyltransferase [Parvibaculum lavamentivorans DS-1]
          Length = 258

 Score = 71.7 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 34/58 (58%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +  AF +   V+  V   +I+LIDDV TTGATA+  A  L  AGA  VS+L  +R + 
Sbjct: 195 VAGAFRLAPGVAPLVKDRRIVLIDDVMTTGATAEACARVLTGAGAREVSVLCLARVVP 252


>gi|222112033|ref|YP_002554297.1| phosphoribosyltransferase [Acidovorax ebreus TPSY]
 gi|221731477|gb|ACM34297.1| phosphoribosyltransferase [Acidovorax ebreus TPSY]
          Length = 242

 Score = 71.3 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 34/57 (59%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF      +  +AG ++LL+DDV TTGAT   AA  L+ AGA+ V  L  +R+ 
Sbjct: 186 LRGAFVPDPLRAAQLAGKRVLLVDDVMTTGATLHAAAAPLRDAGALQVCALVLARTP 242


>gi|237747426|ref|ZP_04577906.1| gntX protein [Oxalobacter formigenes HOxBLS]
 gi|229378777|gb|EEO28868.1| gntX protein [Oxalobacter formigenes HOxBLS]
          Length = 199

 Score = 71.3 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 33/58 (56%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           + NAF++ +     +    I ++DDV TTG T +  A  LKK+GA  V+   F+R+L 
Sbjct: 136 VHNAFDLAETGRFSIKEKHIGIVDDVMTTGHTLEEIARLLKKSGAKRVTNFVFARTLP 193


>gi|329888704|ref|ZP_08267302.1| phosphoribosyl transferase domain protein [Brevundimonas diminuta
           ATCC 11568]
 gi|328847260|gb|EGF96822.1| phosphoribosyl transferase domain protein [Brevundimonas diminuta
           ATCC 11568]
          Length = 268

 Score = 71.3 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 35/56 (62%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF V +   + + G ++LLIDDV TTGATA+  A AL +AGA  V +   +R 
Sbjct: 205 VKAAFAVTEVGRRRIKGRRLLLIDDVLTTGATAEACARALIEAGARAVDLAVIARV 260


>gi|70732979|ref|YP_262752.1| competence protein ComF [Pseudomonas fluorescens Pf-5]
 gi|68347278|gb|AAY94884.1| competence protein ComF [Pseudomonas fluorescens Pf-5]
          Length = 246

 Score = 71.3 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +       VAG  + L+DDV TTGATA+  A  L  AGA  V I   +R+  
Sbjct: 186 LRQAFALAD--QAQVAGRHLALVDDVLTTGATAQALARLLINAGARRVDIYCLARTPS 241


>gi|330938548|gb|EGH42131.1| phosphoribosyltransferase [Pseudomonas syringae pv. pisi str.
           1704B]
          Length = 244

 Score = 71.3 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +       V G  + L+DDV TTG+TA   A  L  AGA  V +   +R+ K
Sbjct: 186 LRGAFTLID--PDWVQGRHLALVDDVLTTGSTADVIARLLSNAGARRVDVYCLARTPK 241


>gi|302391038|ref|YP_003826858.1| phosphoribosyltransferase [Acetohalobium arabaticum DSM 5501]
 gi|302203115|gb|ADL11793.1| phosphoribosyltransferase [Acetohalobium arabaticum DSM 5501]
          Length = 238

 Score = 71.3 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 30/54 (55%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           + N F         V   +ILLIDD+YTTGAT    A  L +AGA +VS LT +
Sbjct: 177 VSNIFYCEPDKLGVVEDKEILLIDDIYTTGATVNECAKVLLRAGAESVSALTLA 230


>gi|330898835|gb|EGH30254.1| phosphoribosyltransferase [Pseudomonas syringae pv. japonica str.
           M301072PT]
          Length = 244

 Score = 71.3 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +       V G  + L+DDV TTG+TA   A  L  AGA  V +   +R+ K
Sbjct: 186 LRGAFTLID--PDWVQGRHLALVDDVLTTGSTADVIARLLSNAGARRVDVYCLARTPK 241


>gi|319899208|ref|YP_004159301.1| competence protein ComF [Bartonella clarridgeiae 73]
 gi|319403172|emb|CBI76731.1| competence protein ComF [Bartonella clarridgeiae 73]
          Length = 247

 Score = 71.3 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 33/58 (56%), Positives = 39/58 (67%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++NAF VP  V K++ G  ILLIDDV TTG T   A   LK AGA  V++LTFSR LK
Sbjct: 182 VQNAFKVPNKVKKYLEGRSILLIDDVLTTGVTVTAATKTLKHAGARQVNVLTFSRVLK 239


>gi|271502335|ref|YP_003335361.1| phosphoribosyltransferase [Dickeya dadantii Ech586]
 gi|270345890|gb|ACZ78655.1| phosphoribosyltransferase [Dickeya dadantii Ech586]
          Length = 239

 Score = 71.3 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 24/59 (40%), Positives = 35/59 (59%), Gaps = 1/59 (1%)

Query: 1   MRNAFNVPQYV-SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF   Q   S+ VAG +++L+DDV TTG+TA   +  L +AGA  V +    R+L 
Sbjct: 181 LRGAFRCRQDAISQRVAGKRLVLLDDVVTTGSTAAEVSRTLLRAGAQHVQVWCVCRTLS 239


>gi|59802047|ref|YP_208759.1| hypothetical protein NGO1726 [Neisseria gonorrhoeae FA 1090]
 gi|59718942|gb|AAW90347.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
          Length = 241

 Score = 71.3 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+ 
Sbjct: 185 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLARTP 238


>gi|317130319|ref|YP_004096601.1| phosphoribosyltransferase [Bacillus cellulosilyticus DSM 2522]
 gi|315475267|gb|ADU31870.1| phosphoribosyltransferase [Bacillus cellulosilyticus DSM 2522]
          Length = 253

 Score = 71.3 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 37/58 (63%), Gaps = 1/58 (1%)

Query: 1   MRNAFNVPQYVSK-HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +  AF + +      +A  KILL+DD+YTTGAT + AA  L +AGA +V  +T +RS+
Sbjct: 191 LDGAFTLSKDGQGLTIANKKILLVDDIYTTGATLRSAATVLYRAGAKSVGAVTVARSV 248


>gi|196230002|ref|ZP_03128865.1| competence protein F, putative [Chthoniobacter flavus Ellin428]
 gi|196225599|gb|EDY20106.1| competence protein F, putative [Chthoniobacter flavus Ellin428]
          Length = 243

 Score = 71.3 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +RNAF V       V    ++L+DDV+TTG+T    A  L++AGA +V ++T +R
Sbjct: 190 LRNAFRVRHA--SRVQSRHLILVDDVFTTGSTVAECARVLRQAGAASVRVVTVAR 242


>gi|167644905|ref|YP_001682568.1| phosphoribosyltransferase [Caulobacter sp. K31]
 gi|167347335|gb|ABZ70070.1| phosphoribosyltransferase [Caulobacter sp. K31]
          Length = 215

 Score = 70.9 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 34/56 (60%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  AF VP+     V G K+LLIDDV TTGATA+  A AL  AGA  V++   +R 
Sbjct: 152 VAAAFAVPEARRHRVTGRKVLLIDDVLTTGATAEGCARALLAAGATQVTLAVVARV 207


>gi|15676193|ref|NP_273325.1| competence protein [Neisseria meningitidis MC58]
 gi|7225493|gb|AAF40723.1| competence protein [Neisseria meningitidis MC58]
 gi|316985199|gb|EFV64151.1| competence protein [Neisseria meningitidis H44/76]
 gi|325141105|gb|EGC63608.1| comF/gntX family protein [Neisseria meningitidis CU385]
 gi|325199472|gb|ADY94927.1| comF/gntX family protein [Neisseria meningitidis H44/76]
          Length = 241

 Score = 70.9 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+ 
Sbjct: 185 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLARTP 238


>gi|218768948|ref|YP_002343460.1| hypothetical protein NMA2217 [Neisseria meningitidis Z2491]
 gi|121052956|emb|CAM09310.1| hypothetical protein NMA2217 [Neisseria meningitidis Z2491]
          Length = 241

 Score = 70.9 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+ 
Sbjct: 185 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLARTP 238


>gi|85706922|ref|ZP_01038012.1| competence protein F, putative [Roseovarius sp. 217]
 gi|85668533|gb|EAQ23404.1| competence protein F, putative [Roseovarius sp. 217]
          Length = 232

 Score = 70.9 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 35/59 (59%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           + +A  V       +AG  IL++DDV T+GAT   AA A   AGA  VSILT +R+ KD
Sbjct: 173 LADAIRVHPRHRARMAGRFILIVDDVMTSGATLSVAAQACFSAGAGEVSILTLARAAKD 231


>gi|325145262|gb|EGC67541.1| comF/gntX family protein [Neisseria meningitidis M01-240013]
          Length = 241

 Score = 70.9 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+ 
Sbjct: 185 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLARTP 238


>gi|317472164|ref|ZP_07931496.1| comF family protein [Anaerostipes sp. 3_2_56FAA]
 gi|316900568|gb|EFV22550.1| comF family protein [Anaerostipes sp. 3_2_56FAA]
          Length = 234

 Score = 70.9 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 21/44 (47%), Positives = 28/44 (63%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
            S  V G ++LL+DD+YTTGATA+    ALK AGA  V +   +
Sbjct: 186 ASDEVKGKRVLLVDDIYTTGATAESCTRALKAAGAEDVWVFCVA 229


>gi|239999818|ref|ZP_04719742.1| hypothetical protein Ngon3_10123 [Neisseria gonorrhoeae 35/02]
 gi|254494599|ref|ZP_05107770.1| competence protein [Neisseria gonorrhoeae 1291]
 gi|268595627|ref|ZP_06129794.1| competence protein [Neisseria gonorrhoeae 35/02]
 gi|293398086|ref|ZP_06642291.1| hypothetical protein NGNG_01641 [Neisseria gonorrhoeae F62]
 gi|226513639|gb|EEH62984.1| competence protein [Neisseria gonorrhoeae 1291]
 gi|268549016|gb|EEZ44434.1| competence protein [Neisseria gonorrhoeae 35/02]
 gi|291611349|gb|EFF40419.1| hypothetical protein NGNG_01641 [Neisseria gonorrhoeae F62]
          Length = 241

 Score = 70.9 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+ 
Sbjct: 185 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLARTP 238


>gi|255659147|ref|ZP_05404556.1| putative competence protein F [Mitsuokella multacida DSM 20544]
 gi|260848597|gb|EEX68604.1| putative competence protein F [Mitsuokella multacida DSM 20544]
          Length = 218

 Score = 70.9 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 22/54 (40%), Positives = 34/54 (62%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +++AF++       V+G  ILL+DD+ TTGAT    A  L++AGA  V +L F+
Sbjct: 163 LKDAFSMA--RDADVSGKHILLLDDILTTGATLSACAAVLRRAGAARVDVLVFA 214


>gi|213967736|ref|ZP_03395883.1| competence protein ComF [Pseudomonas syringae pv. tomato T1]
 gi|301382373|ref|ZP_07230791.1| competence protein ComF, putative [Pseudomonas syringae pv. tomato
           Max13]
 gi|302062356|ref|ZP_07253897.1| competence protein ComF, putative [Pseudomonas syringae pv. tomato
           K40]
 gi|302130674|ref|ZP_07256664.1| competence protein ComF, putative [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|213927512|gb|EEB61060.1| competence protein ComF [Pseudomonas syringae pv. tomato T1]
          Length = 244

 Score = 70.9 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +       V G  + L+DDV TTG+TA+  A  L  AGA  V +   +R+ K
Sbjct: 186 LRGAFALID--PDWVHGKHLALVDDVLTTGSTAEVIARLLNSAGARRVDVYCLARTPK 241


>gi|254805688|ref|YP_003083909.1| competence protein [Neisseria meningitidis alpha14]
 gi|254669229|emb|CBA08067.1| competence protein [Neisseria meningitidis alpha14]
          Length = 241

 Score = 70.9 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+ 
Sbjct: 185 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLARTP 238


>gi|323698874|ref|ZP_08110786.1| phosphoribosyltransferase [Desulfovibrio sp. ND132]
 gi|323458806|gb|EGB14671.1| phosphoribosyltransferase [Desulfovibrio desulfuricans ND132]
          Length = 246

 Score = 70.9 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 34/59 (57%), Gaps = 3/59 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ AF     +   V G ++LL+DDVYTTG+T    A  L +AG   + +L  +R+ ++
Sbjct: 186 IKGAFAADPAL---VRGRRLLLVDDVYTTGSTLNECARTLLRAGCTGLDVLVLARTQRE 241


>gi|121634139|ref|YP_974384.1| hypothetical protein NMC0263 [Neisseria meningitidis FAM18]
 gi|120865845|emb|CAM09577.1| hypothetical protein NMC0263 [Neisseria meningitidis FAM18]
 gi|325131587|gb|EGC54294.1| comF/gntX family protein [Neisseria meningitidis M6190]
 gi|325139158|gb|EGC61704.1| comF/gntX family protein [Neisseria meningitidis ES14902]
          Length = 241

 Score = 70.9 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+ 
Sbjct: 185 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLARTP 238


>gi|325205353|gb|ADZ00806.1| comF/gntX family protein [Neisseria meningitidis M04-240196]
          Length = 241

 Score = 70.9 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+ 
Sbjct: 185 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLARTP 238


>gi|240014974|ref|ZP_04721887.1| hypothetical protein NgonD_10105 [Neisseria gonorrhoeae DGI18]
 gi|240081564|ref|ZP_04726107.1| hypothetical protein NgonF_09685 [Neisseria gonorrhoeae FA19]
 gi|240116577|ref|ZP_04730639.1| hypothetical protein NgonPID1_10148 [Neisseria gonorrhoeae PID18]
 gi|240122043|ref|ZP_04735005.1| hypothetical protein NgonPI_09815 [Neisseria gonorrhoeae PID24-1]
 gi|240129014|ref|ZP_04741675.1| hypothetical protein NgonS_10394 [Neisseria gonorrhoeae SK-93-1035]
 gi|268597659|ref|ZP_06131826.1| competence protein [Neisseria gonorrhoeae FA19]
 gi|268602245|ref|ZP_06136412.1| competence protein [Neisseria gonorrhoeae PID18]
 gi|268687393|ref|ZP_06154255.1| competence protein [Neisseria gonorrhoeae SK-93-1035]
 gi|268551447|gb|EEZ46466.1| competence protein [Neisseria gonorrhoeae FA19]
 gi|268586376|gb|EEZ51052.1| competence protein [Neisseria gonorrhoeae PID18]
 gi|268627677|gb|EEZ60077.1| competence protein [Neisseria gonorrhoeae SK-93-1035]
          Length = 241

 Score = 70.9 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+ 
Sbjct: 185 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLARTP 238


>gi|28867723|ref|NP_790342.1| competence protein ComF [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|28850958|gb|AAO54037.1| competence protein ComF, putative [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|331015040|gb|EGH95096.1| competence protein ComF, putative [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 244

 Score = 70.9 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +       V G  + L+DDV TTG+TA+  A  L  AGA  V +   +R+ K
Sbjct: 186 LRGAFALID--PDWVHGKHLALVDDVLTTGSTAEVIARLLNSAGARRVDVYCLARTPK 241


>gi|320352701|ref|YP_004194040.1| phosphoribosyltransferase [Desulfobulbus propionicus DSM 2032]
 gi|320121203|gb|ADW16749.1| phosphoribosyltransferase [Desulfobulbus propionicus DSM 2032]
          Length = 239

 Score = 70.5 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +++AF +   +   V G ++LLIDDV+TTG+T    +  L+  GA  + + T +RSL 
Sbjct: 183 LKDAFIL--SMPASVQGKRVLLIDDVFTTGSTVNECSKVLRAGGATRIEVFTLARSLS 238


>gi|304389097|ref|ZP_07371141.1| ComF/gntX family protein [Neisseria meningitidis ATCC 13091]
 gi|304336970|gb|EFM03160.1| ComF/gntX family protein [Neisseria meningitidis ATCC 13091]
          Length = 241

 Score = 70.5 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+ 
Sbjct: 185 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLARTP 238


>gi|5921548|emb|CAB56477.1| competence protein ComF [Pseudomonas stutzeri]
          Length = 235

 Score = 70.5 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF + +   + + G  + +IDDV+TTGATA+  A  LK+AGA  V I   +R+ K
Sbjct: 177 LRQAFALAEG--QVLHGQHLAVIDDVFTTGATAEALARLLKRAGAARVDIYCLARTPK 232


>gi|325143108|gb|EGC65455.1| comF/gntX family protein [Neisseria meningitidis 961-5945]
 gi|325197553|gb|ADY93009.1| comF/gntX family protein [Neisseria meningitidis G2136]
          Length = 241

 Score = 70.5 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+ 
Sbjct: 185 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKMLKKSGANRICCWTLARTP 238


>gi|269213904|ref|ZP_05983088.2| ComF/gntX family protein [Neisseria cinerea ATCC 14685]
 gi|269145064|gb|EEZ71482.1| ComF/gntX family protein [Neisseria cinerea ATCC 14685]
          Length = 165

 Score = 70.5 bits (172), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+ 
Sbjct: 109 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLGELAKMLKKSGANRICCWTLARTP 162


>gi|298528419|ref|ZP_07015823.1| phosphoribosyltransferase [Desulfonatronospira thiodismutans
           ASO3-1]
 gi|298512071|gb|EFI35973.1| phosphoribosyltransferase [Desulfonatronospira thiodismutans
           ASO3-1]
          Length = 262

 Score = 70.5 bits (172), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF   +  +  V G  ILL+DD+YTTG+T +     L KAGA  V +L  +R +
Sbjct: 208 LKGAF---EAHAGVVRGQSILLVDDIYTTGSTLEECTRTLIKAGASRVQVLFLARGV 261


>gi|218960908|ref|YP_001740683.1| putative gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Candidatus Cloacamonas acidaminovorans]
 gi|167729565|emb|CAO80477.1| putative gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Candidatus Cloacamonas acidaminovorans]
          Length = 240

 Score = 70.2 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  AF V       VAG KI+LIDDV+TTG+T    A  L+ AGA  +  +T +R+
Sbjct: 187 LAGAFQV--KNKNLVAGKKIILIDDVFTTGSTLNEIAKTLRSAGADKICAITVARA 240


>gi|319764159|ref|YP_004128096.1| phosphoribosyltransferase [Alicycliphilus denitrificans BC]
 gi|330826484|ref|YP_004389787.1| phosphoribosyltransferase [Alicycliphilus denitrificans K601]
 gi|317118720|gb|ADV01209.1| phosphoribosyltransferase [Alicycliphilus denitrificans BC]
 gi|329311856|gb|AEB86271.1| phosphoribosyltransferase [Alicycliphilus denitrificans K601]
          Length = 245

 Score = 70.2 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 36/57 (63%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF +   ++   +G ++LL+DDV TTGAT   AA  L++AGA  V+ +  +R+ 
Sbjct: 189 LRGAFMLDPLLAAQASGRRVLLVDDVMTTGATLHAAAAPLREAGARHVAAIVLARTP 245


>gi|116054218|ref|YP_788662.1| putative phosphoribosyl transferase [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|296386989|ref|ZP_06876488.1| putative phosphoribosyl transferase [Pseudomonas aeruginosa PAb1]
 gi|115589439|gb|ABJ15454.1| putative phosphoribosyltransferase [Pseudomonas aeruginosa
           UCBPP-PA14]
          Length = 241

 Score = 70.2 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +       V GL + L+DDV TTGATA+C +  L++AGA  V +   +R+ K
Sbjct: 184 LRHAFALAPA--SDVRGLHLALVDDVLTTGATAECLSRLLRRAGAARVDVYCLARTPK 239


>gi|325135072|gb|EGC57700.1| comF/gntX family protein [Neisseria meningitidis M13399]
          Length = 241

 Score = 70.2 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+ 
Sbjct: 185 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLARTP 238


>gi|187735075|ref|YP_001877187.1| competence protein F, [Akkermansia muciniphila ATCC BAA-835]
 gi|187425127|gb|ACD04406.1| competence protein F, putative [Akkermansia muciniphila ATCC
           BAA-835]
          Length = 249

 Score = 70.2 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 21/45 (46%), Positives = 30/45 (66%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
              V G  +LL+DDV+TTGATA   A  L ++GA +V +LT +R+
Sbjct: 199 RSPVRGRDVLLVDDVFTTGATADSCARLLLRSGAASVCVLTLART 243


>gi|240017422|ref|ZP_04723962.1| hypothetical protein NgonFA_09723 [Neisseria gonorrhoeae FA6140]
 gi|240113843|ref|ZP_04728333.1| hypothetical protein NgonM_09808 [Neisseria gonorrhoeae MS11]
 gi|240118801|ref|ZP_04732863.1| hypothetical protein NgonPID_10159 [Neisseria gonorrhoeae PID1]
 gi|240126552|ref|ZP_04739438.1| hypothetical protein NgonSK_10160 [Neisseria gonorrhoeae SK-92-679]
 gi|260439662|ref|ZP_05793478.1| hypothetical protein NgonDG_00973 [Neisseria gonorrhoeae DGI2]
 gi|268599910|ref|ZP_06134077.1| competence protein [Neisseria gonorrhoeae MS11]
 gi|268604511|ref|ZP_06138678.1| competence protein [Neisseria gonorrhoeae PID1]
 gi|268685131|ref|ZP_06151993.1| competence protein [Neisseria gonorrhoeae SK-92-679]
 gi|291042904|ref|ZP_06568645.1| competence protein [Neisseria gonorrhoeae DGI2]
 gi|268584041|gb|EEZ48717.1| competence protein [Neisseria gonorrhoeae MS11]
 gi|268588642|gb|EEZ53318.1| competence protein [Neisseria gonorrhoeae PID1]
 gi|268625415|gb|EEZ57815.1| competence protein [Neisseria gonorrhoeae SK-92-679]
 gi|291013338|gb|EFE05304.1| competence protein [Neisseria gonorrhoeae DGI2]
          Length = 241

 Score = 70.2 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+ 
Sbjct: 185 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLARTP 238


>gi|261391800|emb|CAX49255.1| putative GntX-like protein [Neisseria meningitidis 8013]
          Length = 241

 Score = 70.2 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +     K      ILLIDDV+TTGAT    A  LKK+GA  +   T +R+ 
Sbjct: 185 IKNAFEIRTPPPK---NCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLARTP 238


>gi|48428733|gb|AAT42382.1| putative amidophosphoribosyltransferase [Collimonas fungivorans
           Ter331]
          Length = 236

 Score = 70.2 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 30/57 (52%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF VP      + G  I ++DDV TTG T    A  L++ GA  ++   F+R+ 
Sbjct: 180 LRQAFIVPPAAMMQIRGRHIGVVDDVMTTGETLHALAQTLRRHGASRITNFVFARTP 236


>gi|254483220|ref|ZP_05096453.1| hypothetical protein GPB2148_406 [marine gamma proteobacterium
           HTCC2148]
 gi|214036591|gb|EEB77265.1| hypothetical protein GPB2148_406 [marine gamma proteobacterium
           HTCC2148]
          Length = 240

 Score = 70.2 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 26/58 (44%), Positives = 32/58 (55%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +  AF V          L++ LIDDV TTGATA  AA ALK+AGA  V I   +R+  
Sbjct: 180 LSGAFTVSSGC----DNLRVALIDDVLTTGATAGEAARALKQAGAARVEIWCLARTPP 233


>gi|150388558|ref|YP_001318607.1| phosphoribosyltransferase [Alkaliphilus metalliredigens QYMF]
 gi|149948420|gb|ABR46948.1| phosphoribosyltransferase [Alkaliphilus metalliredigens QYMF]
          Length = 242

 Score = 70.2 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++ AF V       +   K+LLIDD+ TTGAT K  +  L +AGA +V+ LT +R
Sbjct: 185 VKQAFMV--KNPGLIVNQKLLLIDDIVTTGATLKACSRVLLEAGAQSVTALTLAR 237


>gi|330874793|gb|EGH08942.1| competence protein ComF [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
          Length = 244

 Score = 70.2 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +       V G  + LIDDV TTG+TA+  A  L  AGA  V +   +R+ K
Sbjct: 186 LRGAFVLIDA--DWVQGKHLALIDDVLTTGSTAEVIARLLNSAGAQRVDVYCLARTPK 241


>gi|257483057|ref|ZP_05637098.1| competence protein ComF [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|331011709|gb|EGH91765.1| competence protein ComF [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 244

 Score = 70.2 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +         G  + L+DDV TTG+TA+  A  L KAGA  V +   +R+ K
Sbjct: 186 LRDAFTLVDPDWAQ--GKHLALVDDVLTTGSTAEVIARLLNKAGARRVDVYCLARTPK 241


>gi|325128978|gb|EGC51829.1| comF/gntX family protein [Neisseria meningitidis N1568]
          Length = 241

 Score = 70.2 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +     K      ILLIDDV+TTGAT    A  LKK+GA  +   T +R+ 
Sbjct: 185 IKNAFEIRTPPPK---NCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLARTP 238


>gi|254671567|emb|CBA09213.1| competence protein F [Neisseria meningitidis alpha153]
          Length = 241

 Score = 70.2 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +     K      ILLIDDV+TTGAT    A  LKK+GA  +   T +R+ 
Sbjct: 185 IKNAFEIRTPPPK---NCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLARTP 238


>gi|171910308|ref|ZP_02925778.1| Phosphoribosyltransferase [Verrucomicrobium spinosum DSM 4136]
          Length = 255

 Score = 70.2 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 1   MRNAFNVPQY--VSKHVAGLKILLIDDVYTTGATAKCAAIALK-KAGAMTVSILTFSR 55
           ++ AF V         + G  ILLIDDV TTG+TA   A  L  +AGA  V +LT +R
Sbjct: 197 LKRAFRVKPSLVRRGRLKGKTILLIDDVLTTGSTASECAKVLLQEAGAARVWVLTVAR 254


>gi|325130995|gb|EGC53722.1| comF/gntX family protein [Neisseria meningitidis OX99.30304]
 gi|325137094|gb|EGC59690.1| comF/gntX family protein [Neisseria meningitidis M0579]
 gi|325202904|gb|ADY98358.1| comF/gntX family protein [Neisseria meningitidis M01-240149]
 gi|325207297|gb|ADZ02749.1| comF/gntX family protein [Neisseria meningitidis NZ-05/33]
          Length = 241

 Score = 70.2 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+ 
Sbjct: 185 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLARTP 238


>gi|49475199|ref|YP_033240.1| competence protein comF [Bartonella henselae str. Houston-1]
 gi|49238004|emb|CAF27209.1| Competence protein comF [Bartonella henselae str. Houston-1]
          Length = 262

 Score = 69.8 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 43/59 (72%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           + NAF VP+ V K++ G  ILLIDDV+TTGAT   AA  LK+AGA  V +LTFSR LK+
Sbjct: 197 VLNAFEVPRKVKKYLKGRSILLIDDVFTTGATVTAAAATLKRAGARQVDVLTFSRVLKE 255


>gi|330956967|gb|EGH57227.1| competence protein ComF [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 244

 Score = 69.8 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +       V G  + ++DDV TTG+TA+  A  L  AGA  V +   +R+ K
Sbjct: 186 LRGAFTLRD--PDWVHGKHLAVVDDVLTTGSTAEVIARLLNSAGARRVDVYCLARTPK 241


>gi|120612548|ref|YP_972226.1| ComF family protein [Acidovorax citrulli AAC00-1]
 gi|120591012|gb|ABM34452.1| ComF family protein [Acidovorax citrulli AAC00-1]
          Length = 238

 Score = 69.8 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 30/56 (53%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +   F V    +  V G  I+L+DDV TTGAT   AA  L +AGA  V  +  +R+
Sbjct: 182 LDGVFAVAPDRAARVRGQGIVLVDDVMTTGATLHAAARVLLQAGAARVDAVVLART 237


>gi|325271487|ref|ZP_08138005.1| competence protein ComF, putative [Pseudomonas sp. TJI-51]
 gi|324103377|gb|EGC00706.1| competence protein ComF, putative [Pseudomonas sp. TJI-51]
          Length = 243

 Score = 69.8 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF V   +     G  + ++DDV TTGATA+  A  L+KAGA  V +   +R+ K
Sbjct: 186 LRQAFAVAGDLP----GKHVAIVDDVLTTGATAQAIAQVLRKAGAQRVDVYCLARTPK 239


>gi|167031407|ref|YP_001666638.1| phosphoribosyltransferase [Pseudomonas putida GB-1]
 gi|166857895|gb|ABY96302.1| phosphoribosyltransferase [Pseudomonas putida GB-1]
          Length = 243

 Score = 69.8 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF V       + G  + ++DDV TTGATA+  A  L+KAGA  V +   +R+ K
Sbjct: 186 LRQAFAVT----GKLTGKHVAVVDDVLTTGATAQAIAQVLRKAGARQVDVYCLARTPK 239


>gi|326796484|ref|YP_004314304.1| phosphoribosyltransferase [Marinomonas mediterranea MMB-1]
 gi|326547248|gb|ADZ92468.1| phosphoribosyltransferase [Marinomonas mediterranea MMB-1]
          Length = 243

 Score = 69.8 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 17/40 (42%), Positives = 24/40 (60%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            ++LIDDV TTGAT +     L KAGA +V +   +R+  
Sbjct: 202 HVVLIDDVMTTGATLEACTKTLLKAGASSVDVWVIARTPP 241


>gi|114570814|ref|YP_757494.1| phosphoribosyltransferase [Maricaulis maris MCS10]
 gi|114341276|gb|ABI66556.1| phosphoribosyltransferase [Maricaulis maris MCS10]
          Length = 255

 Score = 69.4 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/59 (40%), Positives = 35/59 (59%), Gaps = 2/59 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VP      VAG  ++L+DDV TTGAT    A  LK+AGA +V ++   R +++
Sbjct: 194 VAAAFTVPD--RNAVAGKHLVLVDDVITTGATVSACAYQLKRAGAASVRVVALCRVVRE 250


>gi|312109468|ref|YP_003987784.1| phosphoribosyltransferase [Geobacillus sp. Y4.1MC1]
 gi|311214569|gb|ADP73173.1| phosphoribosyltransferase [Geobacillus sp. Y4.1MC1]
          Length = 235

 Score = 69.4 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 34/54 (62%), Gaps = 2/54 (3%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
            N F + +  S  + G  I+LIDD+YTTG T + AA  L KAGA +VS LT +R
Sbjct: 183 ENVFRLSEQTS--LQGKPIVLIDDIYTTGTTLRHAAKVLLKAGAASVSSLTLAR 234


>gi|332186893|ref|ZP_08388635.1| hypothetical protein SUS17_1939 [Sphingomonas sp. S17]
 gi|332013226|gb|EGI55289.1| hypothetical protein SUS17_1939 [Sphingomonas sp. S17]
          Length = 216

 Score = 69.4 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/57 (45%), Positives = 38/57 (66%), Gaps = 2/57 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           + +AF V  +  + V G  I+L+DDVYTTGATA     AL +AGA +V+IL ++R +
Sbjct: 154 VTSAFRV--HDREAVVGRHIVLVDDVYTTGATAGACVRALLRAGAASVAILCWARVI 208


>gi|94264829|ref|ZP_01288605.1| competence protein F-like protein [delta proteobacterium MLMS-1]
 gi|93454710|gb|EAT04971.1| competence protein F-like protein [delta proteobacterium MLMS-1]
          Length = 251

 Score = 69.4 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           R AF + Q     V   ++LL+DDV+TTG+T    A  LK AGA  V +LT +R 
Sbjct: 197 RGAFALSQ--PHLVKRRRVLLVDDVFTTGSTVNECAGVLKAAGAAEVQVLTLARV 249


>gi|319945284|ref|ZP_08019546.1| competence protein F [Lautropia mirabilis ATCC 51599]
 gi|319741854|gb|EFV94279.1| competence protein F [Lautropia mirabilis ATCC 51599]
          Length = 262

 Score = 69.4 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF+VP    K V+G  + L+DDV T+G T   AA  L  AGA +V  L  +R+ 
Sbjct: 208 LRGAFSVPD--PKRVSGQHLALVDDVMTSGNTLNEAAQTLLAAGAASVMALVVARTP 262


>gi|78355831|ref|YP_387280.1| ComF family protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78218236|gb|ABB37585.1| ComF family protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 251

 Score = 69.4 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF         V G  +LL+DDV TTGAT +  A AL  AGA  V  +  +R+  
Sbjct: 191 LRDAFE----ADSCVRGRNVLLVDDVMTTGATLEHCAQALYHAGAQQVHAVVAARTPP 244


>gi|307243841|ref|ZP_07525970.1| ComF family protein [Peptostreptococcus stomatis DSM 17678]
 gi|306492779|gb|EFM64803.1| ComF family protein [Peptostreptococcus stomatis DSM 17678]
          Length = 256

 Score = 69.4 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 22/53 (41%), Positives = 32/53 (60%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           ++N+F + + +   +    ILL+DDV+TTG+T    A  LK AGA  V  LTF
Sbjct: 193 LKNSFLIKEEMKDLIVNKNILLVDDVFTTGSTVDEMAKVLKLAGAQEVVSLTF 245


>gi|296284059|ref|ZP_06862057.1| amidophosphoribosyltransferase [Citromicrobium bathyomarinum JL354]
          Length = 161

 Score = 69.4 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 34/59 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R A  V     + + G  ++L+DDV T+GAT+     AL +AGA +V I  F+R  ++
Sbjct: 91  LRGAIRVRPRCREDIEGRHVILVDDVLTSGATSTACTAALLEAGAKSVRIACFARVPEN 149


>gi|119946807|ref|YP_944487.1| amidophosphoribosyltransferase [Psychromonas ingrahamii 37]
 gi|119865411|gb|ABM04888.1| amidophosphoribosyltransferase [Psychromonas ingrahamii 37]
          Length = 226

 Score = 69.0 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 31/56 (55%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  AF++   + + + G  I++IDDV TTGAT       L +AGA  + I   SR+
Sbjct: 164 LNGAFSICPSMQQEIIGAYIVIIDDVVTTGATVNSLCHTLLEAGAQRIDIWCISRT 219


>gi|304317615|ref|YP_003852760.1| phosphoribosyltransferase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302779117|gb|ADL69676.1| phosphoribosyltransferase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 229

 Score = 69.0 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF V       V    ILL+DDV TTG+T    A  LK+ GA  V   T +
Sbjct: 173 LKGAFKV--VYEDMVKNKIILLVDDVLTTGSTLDECAKVLKEGGAKDVFATTIA 224


>gi|149184493|ref|ZP_01862811.1| amidophosphoribosyltransferase [Erythrobacter sp. SD-21]
 gi|148831813|gb|EDL50246.1| amidophosphoribosyltransferase [Erythrobacter sp. SD-21]
          Length = 262

 Score = 69.0 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  A  V     + +AG  +LL+DDV T+GAT+     ALK+AGA TV+I  F+R L +
Sbjct: 200 LAGAIEV--SRPERIAGRNVLLVDDVLTSGATSTACVRALKRAGARTVTISCFARVLDE 256


>gi|299140246|ref|ZP_07033412.1| phosphoribosyltransferase [Acidobacterium sp. MP5ACTX8]
 gi|298597785|gb|EFI53957.1| phosphoribosyltransferase [Acidobacterium sp. MP5ACTX8]
          Length = 359

 Score = 69.0 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/59 (38%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF V    +  + G ++LL+DD+ TTGATA+  A  L +AGA  V + T +R+  +
Sbjct: 276 LRGAFRV--ERADEIRGREVLLVDDILTTGATARECARVLMRAGASKVWVATVARAQAE 332


>gi|254486071|ref|ZP_05099276.1| competence protein F [Roseobacter sp. GAI101]
 gi|214042940|gb|EEB83578.1| competence protein F [Roseobacter sp. GAI101]
          Length = 242

 Score = 69.0 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 34/59 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  A  V    ++ + G  +L++DDV T+GAT   AA A   AGA ++ ++T +R  KD
Sbjct: 183 LEGAITVHPKRAERLQGRSVLIVDDVMTSGATLCSAAKACIDAGAGSIRVVTLARVAKD 241


>gi|146309104|ref|YP_001189569.1| amidophosphoribosyltransferase-like protein [Pseudomonas mendocina
           ymp]
 gi|145577305|gb|ABP86837.1| amidophosphoribosyltransferase-like protein [Pseudomonas mendocina
           ymp]
          Length = 246

 Score = 69.0 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +       VAG  + L+DDV TTGATA   A  L+ AGA  V +   +R+ +
Sbjct: 187 LRQAFTL--DAKAQVAGCHLALVDDVLTTGATAGTLARLLRHAGAQRVDVYCLARTPR 242


>gi|331084363|ref|ZP_08333467.1| hypothetical protein HMPREF0992_02391 [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|330401627|gb|EGG81208.1| hypothetical protein HMPREF0992_02391 [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 234

 Score = 69.0 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 35/54 (64%), Gaps = 4/54 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           M+NAF V + + +      ILL+DD+YTTG+T + AA  LKKAGA  +  LT +
Sbjct: 180 MKNAFIVRKKLKEE----NILLVDDIYTTGSTIEEAAKELKKAGAQNIFFLTIA 229


>gi|260590047|ref|ZP_05855960.1| ComF family protein [Blautia hansenii DSM 20583]
 gi|260539559|gb|EEX20128.1| ComF family protein [Blautia hansenii DSM 20583]
          Length = 212

 Score = 69.0 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 35/54 (64%), Gaps = 4/54 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           M+NAF V + + +      ILL+DD+YTTG+T + AA  LKKAGA  +  LT +
Sbjct: 158 MKNAFIVRKKLKEE----NILLVDDIYTTGSTIEEAAKELKKAGAQNIFFLTIA 207


>gi|218889229|ref|YP_002438093.1| putative phosphoribosyl transferase [Pseudomonas aeruginosa LESB58]
 gi|218769452|emb|CAW25212.1| probable phosphoribosyl transferase [Pseudomonas aeruginosa LESB58]
          Length = 241

 Score = 69.0 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +       V GL + L+DDV TTGAT +  +  L++AGA  V +   +R+ K
Sbjct: 184 LRHAFALAPA--SDVRGLHLALVDDVLTTGATTEHLSRLLRRAGAARVDVYCLARTPK 239


>gi|66047912|ref|YP_237753.1| phosphoribosyltransferase [Pseudomonas syringae pv. syringae B728a]
 gi|63258619|gb|AAY39715.1| Phosphoribosyltransferase [Pseudomonas syringae pv. syringae B728a]
 gi|330970893|gb|EGH70959.1| phosphoribosyltransferase [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 244

 Score = 69.0 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +       V G  + L+DDV TTG+TA+  A  L  AGA  V +   +R+ +
Sbjct: 186 LRGAFTLID--PDWVKGRHLALVDDVLTTGSTAEVIAGLLNTAGARRVDVYCLARTPR 241


>gi|58038532|ref|YP_190496.1| competence protein F [Gluconobacter oxydans 621H]
 gi|58000946|gb|AAW59840.1| Competence protein F [Gluconobacter oxydans 621H]
          Length = 228

 Score = 69.0 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 34/56 (60%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           M +A  V +     + G  +LL+DDV TTG+TA    +AL KAGA +V IL  +R+
Sbjct: 160 MEHAVRVRKGRGARIEGQAVLLVDDVLTTGSTASACTMALMKAGAASVDILVAART 215


>gi|302390143|ref|YP_003825964.1| phosphoribosyltransferase [Thermosediminibacter oceani DSM 16646]
 gi|302200771|gb|ADL08341.1| phosphoribosyltransferase [Thermosediminibacter oceani DSM 16646]
          Length = 240

 Score = 69.0 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +  AF V       +    +LLIDDVYTTG+TA   + AL +AGA  V +LT +R
Sbjct: 187 VAGAFAVKDG--SAIKEKTLLLIDDVYTTGSTADECSKALLQAGASGVYVLTAAR 239


>gi|148260495|ref|YP_001234622.1| phosphoribosyltransferase [Acidiphilium cryptum JF-5]
 gi|146402176|gb|ABQ30703.1| phosphoribosyltransferase [Acidiphilium cryptum JF-5]
          Length = 217

 Score = 68.6 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 32/56 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ A  + +    H+AG  ILL+DDV TTGATA   A  L  AGA  V +L  +R 
Sbjct: 156 LKGAIGIREGREAHIAGRTILLVDDVLTTGATASACADTLYAAGAAAVDVLAIARV 211


>gi|167748296|ref|ZP_02420423.1| hypothetical protein ANACAC_03040 [Anaerostipes caccae DSM 14662]
 gi|167652288|gb|EDR96417.1| hypothetical protein ANACAC_03040 [Anaerostipes caccae DSM 14662]
          Length = 158

 Score = 68.6 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/44 (47%), Positives = 28/44 (63%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
            S  V G ++LL+DD+YTTGATA+    ALK AGA  V +   +
Sbjct: 110 ASDEVKGKRVLLVDDIYTTGATAESCTRALKAAGAEDVWVFCVA 153


>gi|254243583|ref|ZP_04936905.1| hypothetical protein PA2G_04406 [Pseudomonas aeruginosa 2192]
 gi|126196961|gb|EAZ61024.1| hypothetical protein PA2G_04406 [Pseudomonas aeruginosa 2192]
          Length = 241

 Score = 68.6 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +       V GL + L+DDV TTGAT +  +  L++AGA  V +   +R+ K
Sbjct: 184 LRHAFALAPA--SDVRGLHLALVDDVLTTGATTEHLSRLLRRAGAARVDVYCLARTPK 239


>gi|170749082|ref|YP_001755342.1| competence protein F [Methylobacterium radiotolerans JCM 2831]
 gi|170655604|gb|ACB24659.1| competence protein F [Methylobacterium radiotolerans JCM 2831]
          Length = 253

 Score = 68.6 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 33/54 (61%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +  AF V       + G ++LL+DDV TTGAT   AA AL + GA +V +LTF+
Sbjct: 193 LSGAFRVTAAEQHRIRGRRVLLVDDVMTTGATGNAAARALLRGGATSVDLLTFA 246


>gi|325111311|ref|YP_004272379.1| phosphoribosyltransferase [Planctomyces brasiliensis DSM 5305]
 gi|324971579|gb|ADY62357.1| phosphoribosyltransferase [Planctomyces brasiliensis DSM 5305]
          Length = 254

 Score = 68.6 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 37/58 (63%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R A++V  + +  + G ++LL+DD+ TTG+TA+    AL +AGA  V +   +R LK
Sbjct: 197 VRGAYSV--HRATGLQGARVLLVDDILTTGSTAQVCTRALLEAGAAEVFVAVLARGLK 252


>gi|78224524|ref|YP_386271.1| phosphoribosyltransferase [Geobacter metallireducens GS-15]
 gi|78195779|gb|ABB33546.1| Phosphoribosyltransferase [Geobacter metallireducens GS-15]
          Length = 242

 Score = 68.6 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF V       +AG ++LL+DDV TTG+T    A  LK AGA  V ++T + +  
Sbjct: 185 VRGAFAV--SGPAGIAGRRVLLMDDVVTTGSTVAECARVLKDAGASAVFVITVALAPP 240


>gi|251787886|ref|YP_003002607.1| gluconate periplasmic binding protein [Dickeya zeae Ech1591]
 gi|247536507|gb|ACT05128.1| gluconate periplasmic binding protein [Dickeya zeae Ech1591]
          Length = 239

 Score = 68.6 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 23/59 (38%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 1   MRNAFNVPQYVSKH-VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF     V    VAG +++L+DDV TTG+TA   +  L  AGA  V +    R+L 
Sbjct: 181 LRGAFRCRHTVVNQWVAGKRLVLLDDVVTTGSTAAEISRTLLNAGAQQVQVWCVCRTLS 239


>gi|296116147|ref|ZP_06834765.1| competence protein F [Gluconacetobacter hansenii ATCC 23769]
 gi|295977253|gb|EFG84013.1| competence protein F [Gluconacetobacter hansenii ATCC 23769]
          Length = 282

 Score = 68.6 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 30/56 (53%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  A  V  +    + G  ++L+DDV TTG+T     +AL+  GA  V +L+ +R 
Sbjct: 214 LHGAITVRSHRMAALRGRHVILVDDVMTTGSTLAACTVALRDHGAARVDVLSATRV 269


>gi|332798810|ref|YP_004460309.1| phosphoribosyltransferase [Tepidanaerobacter sp. Re1]
 gi|332696545|gb|AEE91002.1| phosphoribosyltransferase [Tepidanaerobacter sp. Re1]
          Length = 238

 Score = 68.6 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +  AF V +     +    +LLIDDVYTTGAT      +L +AGA  V ++T +R
Sbjct: 185 LEGAFKVVKN--NKIHDKIVLLIDDVYTTGATTGECTKSLLEAGAKAVYVMTCAR 237


>gi|218507724|ref|ZP_03505602.1| competence protein F (phosphoribosyltransferase protein)
          [Rhizobium etli Brasil 5]
          Length = 61

 Score = 68.2 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 41/59 (69%)

Query: 1  MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
          +R AF + +   K + G +I+LIDDVY TGAT   A+  L+KAGA  +++LTF+R+L +
Sbjct: 1  VRGAFAIAKGREKDIFGRRIVLIDDVYRTGATVAAASRTLRKAGAAEITVLTFARALSE 59


>gi|312963457|ref|ZP_07777939.1| phosphoribosyltransferase [Pseudomonas fluorescens WH6]
 gi|311282263|gb|EFQ60862.1| phosphoribosyltransferase [Pseudomonas fluorescens WH6]
          Length = 245

 Score = 68.2 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 26/56 (46%), Gaps = 2/56 (3%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            AF +       V      L+DDV TTGATA   A  L  AGA  V +   +R+ K
Sbjct: 189 GAFALAAD--AQVQDRHFALVDDVLTTGATAHSLARLLINAGARQVDVYCLARTPK 242


>gi|15595686|ref|NP_249180.1| phosphoribosyl transferase [Pseudomonas aeruginosa PAO1]
 gi|9946352|gb|AAG03878.1|AE004486_7 probable phosphoribosyl transferase [Pseudomonas aeruginosa PAO1]
          Length = 241

 Score = 68.2 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +       V GL + L+DDV TTGATA+  +  L++AGA  V +   +R+ K
Sbjct: 184 LRHAFALAPA--SDVRGLHLALVDDVLTTGATAERLSRLLRRAGAARVDVYCLARTPK 239


>gi|118581139|ref|YP_902389.1| competence protein F [Pelobacter propionicus DSM 2379]
 gi|118503849|gb|ABL00332.1| competence protein F, putative [Pelobacter propionicus DSM 2379]
          Length = 245

 Score = 68.2 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R+AF V    +  V+G ++LL+DDV+TTG+T +  +  L +AG   + ++T SR 
Sbjct: 190 VRDAFRV--KNASLVSGKRVLLVDDVFTTGSTVEECSRILMQAGTGELLVVTVSRV 243


>gi|323706361|ref|ZP_08117926.1| phosphoribosyltransferase [Thermoanaerobacterium xylanolyticum
           LX-11]
 gi|323534323|gb|EGB24109.1| phosphoribosyltransferase [Thermoanaerobacterium xylanolyticum
           LX-11]
          Length = 229

 Score = 68.2 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF V       V    ILL+DDV TTG+T    A  L+++GA  V   T +
Sbjct: 173 LKGAFKV--VYGDLVKDKTILLVDDVLTTGSTLDECAKVLRESGAKDVFAATIA 224


>gi|107099475|ref|ZP_01363393.1| hypothetical protein PaerPA_01000487 [Pseudomonas aeruginosa PACS2]
          Length = 229

 Score = 68.2 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +       V GL + L+DDV TTGAT +  +  L++AGA  V +   +R+ K
Sbjct: 172 LRHAFALAPA--SDVRGLHLALVDDVLTTGATTEHLSRLLRRAGAARVDVYCLARTPK 227


>gi|172058472|ref|YP_001814932.1| competence protein F [Exiguobacterium sibiricum 255-15]
 gi|171990993|gb|ACB61915.1| competence protein F [Exiguobacterium sibiricum 255-15]
          Length = 215

 Score = 68.2 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 32/50 (64%)

Query: 8   PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           P +V + V G  ILL+DDVYTTG T   AA  L +AGA  +S +T  RS+
Sbjct: 166 PYHVMQPVTGKTILLVDDVYTTGTTLHQAASRLYEAGAKEISAVTLFRSV 215


>gi|312897985|ref|ZP_07757394.1| ComF family protein [Megasphaera micronuciformis F0359]
 gi|310620910|gb|EFQ04461.1| ComF family protein [Megasphaera micronuciformis F0359]
          Length = 217

 Score = 68.2 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 25/56 (44%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF V     K V   ++LL+DDVYTTGAT +  A ALK+ GA+ V+ L  + S
Sbjct: 162 LKAAFTV--VAGKTVKDCRLLLVDDVYTTGATLQACAAALKRNGAVEVTGLVIASS 215


>gi|78044328|ref|YP_359025.1| putative competence protein [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|77996443|gb|ABB15342.1| putative competence protein [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 229

 Score = 68.2 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 3/58 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++  F V +  +      KILL+DDV+TTGATA+     L  AGA  V ++T + ++K
Sbjct: 174 LKGNFAVKERFTGR---EKILLVDDVFTTGATAQECTRTLLLAGADKVYVITMATAVK 228


>gi|163867840|ref|YP_001609044.1| competence protein ComF [Bartonella tribocorum CIP 105476]
 gi|161017491|emb|CAK01049.1| competence protein ComF [Bartonella tribocorum CIP 105476]
          Length = 261

 Score = 67.8 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 34/59 (57%), Positives = 42/59 (71%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++NAF V   V K++ G  +LLIDDV+TTGAT   AA ALK AGA  V +LTFSR LK+
Sbjct: 196 VKNAFKVSHKVKKYLKGCSVLLIDDVFTTGATVTAAASALKYAGARQVDVLTFSRVLKE 254


>gi|51244132|ref|YP_064016.1| competence protein F [Desulfotalea psychrophila LSv54]
 gi|50875169|emb|CAG35009.1| related to competence protein F [Desulfotalea psychrophila LSv54]
          Length = 238

 Score = 67.8 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           AF +       + G KI L+DDV+TTG T    +  L+K GA  V +LT +R +
Sbjct: 184 AFTLRDAEM--IRGRKICLVDDVFTTGTTVDECSKVLRKNGAAEVEVLTLARVI 235


>gi|220904997|ref|YP_002480309.1| ComF family protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|219869296|gb|ACL49631.1| ComF family protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 299

 Score = 67.8 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 24/59 (40%), Positives = 34/59 (57%), Gaps = 4/59 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R++F         V G  + L+DDV TTG+T + A  AL+ AGA  V IL  +R+ KD
Sbjct: 233 VRHSFASSP----EVKGRCLWLVDDVMTTGSTLRAACRALRHAGAARVYILVAARTPKD 287


>gi|331005762|ref|ZP_08329121.1| Competence protein F [gamma proteobacterium IMCC1989]
 gi|330420399|gb|EGG94706.1| Competence protein F [gamma proteobacterium IMCC1989]
          Length = 249

 Score = 67.8 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +++ F V       +  L +++IDDV TTGAT      ALKKAGA  VS    +R  K
Sbjct: 196 LKHGFTVT----SPLNNLHVVIIDDVMTTGATVDAMTTALKKAGAGKVSAWVLARVPK 249


>gi|134096080|ref|YP_001101155.1| amidophosphoribosyltransferase [Herminiimonas arsenicoxydans]
 gi|133739983|emb|CAL63034.1| Putative amidophosphoribosyltransferase [Herminiimonas
           arsenicoxydans]
          Length = 247

 Score = 67.8 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 33/58 (56%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           MR+AF +P      V G  + ++DDV TTG T    A  LK+ GA+ V+ L F+R+  
Sbjct: 189 MRHAFVLPANADVLVRGRHVGVVDDVMTTGVTLNEIAATLKRHGAVRVTNLVFARTPP 246


>gi|56421681|ref|YP_148999.1| late competence protein [Geobacillus kaustophilus HTA426]
 gi|56381523|dbj|BAD77431.1| late competence protein [Geobacillus kaustophilus HTA426]
          Length = 230

 Score = 67.8 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 23/54 (42%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           N F +  +    + G +I+LIDD+YTTG T + AA  L +AGA  V  LT  R+
Sbjct: 179 NPFFLADH--PPLDGKRIVLIDDIYTTGITIRHAARVLLEAGAAEVWALTLVRA 230


>gi|261420591|ref|YP_003254273.1| late competence protein [Geobacillus sp. Y412MC61]
 gi|319768261|ref|YP_004133762.1| phosphoribosyltransferase [Geobacillus sp. Y412MC52]
 gi|261377048|gb|ACX79791.1| late competence protein [Geobacillus sp. Y412MC61]
 gi|317113127|gb|ADU95619.1| phosphoribosyltransferase [Geobacillus sp. Y412MC52]
          Length = 230

 Score = 67.8 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 22/45 (48%), Positives = 30/45 (66%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
              +AG +I+LIDD+YTTG T + AA+ L +AGA  V  LT  R+
Sbjct: 186 RPPLAGKRIVLIDDIYTTGITIRHAALVLLEAGAAEVWALTLVRA 230


>gi|288575565|ref|ZP_05977205.2| ComF/gntX family protein [Neisseria mucosa ATCC 25996]
 gi|288567578|gb|EFC89138.1| ComF/gntX family protein [Neisseria mucosa ATCC 25996]
          Length = 250

 Score = 67.5 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 34/55 (61%), Gaps = 3/55 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++NAF +  ++SK      ILLIDDV+TTG+T    A  LKK+GA  +   + +R
Sbjct: 194 IKNAFEINGHISK---NCNILLIDDVFTTGSTLDELARTLKKSGAGKIFCWSLAR 245


>gi|329902630|ref|ZP_08273189.1| Competence protein F [Oxalobacteraceae bacterium IMCC9480]
 gi|327548688|gb|EGF33333.1| Competence protein F [Oxalobacteraceae bacterium IMCC9480]
          Length = 210

 Score = 67.5 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 31/58 (53%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +  AF VP      V G  + ++DDV TTGAT    A  LK+ GA  V+ L F+R+  
Sbjct: 152 IHAAFVVPVQAMASVDGRHVGVVDDVMTTGATLHEVAATLKRYGARRVTNLVFARTPP 209


>gi|326318590|ref|YP_004236262.1| phosphoribosyltransferase [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|323375426|gb|ADX47695.1| phosphoribosyltransferase [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 238

 Score = 67.5 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 30/56 (53%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +   F V    +  V   +I+L+DDV TTGAT   AA  L +AGA  V  +  +R+
Sbjct: 182 LDGVFAVAPDRAARVRDKRIVLVDDVMTTGATLHAAAHVLLQAGASRVDAVVLART 237


>gi|241764400|ref|ZP_04762425.1| ComF family protein [Acidovorax delafieldii 2AN]
 gi|241366190|gb|EER60761.1| ComF family protein [Acidovorax delafieldii 2AN]
          Length = 186

 Score = 67.5 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 36/56 (64%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF V    +  + GL+++LIDDV TTGAT   AA  L++AGA  ++ L  +R+
Sbjct: 128 LRVAFAVEPARAAGLRGLRLVLIDDVMTTGATLDAAARVLREAGAAHITALVVART 183


>gi|125974733|ref|YP_001038643.1| phosphoribosyltransferase [Clostridium thermocellum ATCC 27405]
 gi|281418798|ref|ZP_06249817.1| phosphoribosyltransferase [Clostridium thermocellum JW20]
 gi|125714958|gb|ABN53450.1| phosphoribosyltransferase [Clostridium thermocellum ATCC 27405]
 gi|281407882|gb|EFB38141.1| phosphoribosyltransferase [Clostridium thermocellum JW20]
          Length = 220

 Score = 67.5 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +++AF +       V G  + L+DD+ TTG T    +  LK+AGA  + +   +
Sbjct: 165 VKDAFRITD--RSKVEGKAMFLVDDILTTGTTLNECSRVLKEAGAKKIVVAVIA 216


>gi|302381420|ref|YP_003817243.1| phosphoribosyltransferase [Brevundimonas subvibrioides ATCC 15264]
 gi|302192048|gb|ADK99619.1| phosphoribosyltransferase [Brevundimonas subvibrioides ATCC 15264]
          Length = 249

 Score = 67.5 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 36/56 (64%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +++AF++ +  ++ V G +ILL+DDV TTGATA+  A AL   GA  V +   +R 
Sbjct: 186 VKSAFDLTETGARRVRGRRILLVDDVLTTGATAEACATALLDGGARAVDLAVIARV 241


>gi|255994736|ref|ZP_05427871.1| putative competence protein F [Eubacterium saphenum ATCC 49989]
 gi|255993449|gb|EEU03538.1| putative competence protein F [Eubacterium saphenum ATCC 49989]
          Length = 254

 Score = 67.5 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 23/54 (42%), Positives = 31/54 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++    + +  +  V G  +LLIDDVYTTGATA   A  LK AGA+ V    F+
Sbjct: 198 IKGQILLSETKAHLVRGKTVLLIDDVYTTGATADECAKVLKSAGAIKVCFAGFA 251


>gi|332703113|ref|ZP_08423201.1| phosphoribosyltransferase [Desulfovibrio africanus str. Walvis Bay]
 gi|332553262|gb|EGJ50306.1| phosphoribosyltransferase [Desulfovibrio africanus str. Walvis Bay]
          Length = 280

 Score = 67.5 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 3/54 (5%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
            AF   +     V G ++LL+DD+ TTGAT +  A+ LK AGA  V +L  +R+
Sbjct: 230 GAFRADE---AQVEGRRVLLVDDIMTTGATIEQCALVLKAAGASVVDVLVLARA 280


>gi|104784036|ref|YP_610534.1| competence protein ComF [Pseudomonas entomophila L48]
 gi|95113023|emb|CAK17751.1| putative competence protein ComF [Pseudomonas entomophila L48]
          Length = 245

 Score = 67.5 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +       V  L + ++DDV TTGATA+  A  L+KAGA  V I   +R+ +
Sbjct: 186 LRHAFALAPGTE--VKDLHLAVVDDVMTTGATAQAIAALLRKAGARRVDIYCLARTPR 241


>gi|91787139|ref|YP_548091.1| hypothetical protein Bpro_1242 [Polaromonas sp. JS666]
 gi|91696364|gb|ABE43193.1| conserved hypothetical protein [Polaromonas sp. JS666]
          Length = 271

 Score = 67.5 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  AF V       + G ++LL+DDV T+GA+   AA AL++AGA  ++ +  +R+
Sbjct: 215 VEGAFLVDPLRVGELEGRRVLLVDDVMTSGASLFTAARALREAGAAHITAVVLART 270


>gi|325690461|gb|EGD32464.1| hypothetical protein HMPREF9382_0397 [Streptococcus sanguinis
           SK115]
          Length = 410

 Score = 67.1 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 31/54 (57%), Gaps = 4/54 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           + N F V     K + G  IL+IDDV TTGAT K  A AL +AGA  VS   F+
Sbjct: 301 VENVFTVT----KDLTGKNILVIDDVVTTGATLKACAEALFQAGAENVSFFVFA 350


>gi|256005256|ref|ZP_05430223.1| phosphoribosyltransferase [Clostridium thermocellum DSM 2360]
 gi|255990807|gb|EEU00922.1| phosphoribosyltransferase [Clostridium thermocellum DSM 2360]
 gi|316941867|gb|ADU75901.1| phosphoribosyltransferase [Clostridium thermocellum DSM 1313]
          Length = 220

 Score = 67.1 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +++AF +       V G  + L+DD+ TTG T    +  LK+AGA  + +   +
Sbjct: 165 VKDAFRITD--RSKVEGKAMFLVDDILTTGTTLNECSRVLKEAGAKKIVVAVIA 216


>gi|196249411|ref|ZP_03148109.1| phosphoribosyltransferase [Geobacillus sp. G11MC16]
 gi|196211168|gb|EDY05929.1| phosphoribosyltransferase [Geobacillus sp. G11MC16]
          Length = 230

 Score = 67.1 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 21/44 (47%), Positives = 29/44 (65%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
             + G +I+LIDD+YTTG T + AA  L++AGA  V  LT  R+
Sbjct: 187 PPLTGKRIVLIDDIYTTGITVRHAARVLREAGATEVGSLTLVRA 230


>gi|332971725|gb|EGK10673.1| putative competence protein F [Desmospora sp. 8437]
          Length = 157

 Score = 67.1 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 30/55 (54%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +  AF +    +      K L++DDVYTTG+T    A  LK AGA  V  LT++R
Sbjct: 103 LSGAFRLNPRSAGTAMDKKWLVVDDVYTTGSTLAECAKTLKAAGAKQVCSLTWAR 157


>gi|307132918|ref|YP_003884934.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system [Dickeya
           dadantii 3937]
 gi|306530447|gb|ADN00378.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system [Dickeya
           dadantii 3937]
          Length = 234

 Score = 67.1 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF         V G +++L+DDV TTG+TA   + AL+ AGA  V +    R+L 
Sbjct: 181 LRGAFA----CRHDVDGKRLVLLDDVVTTGSTAAEVSRALRHAGARQVQVWCLCRTLS 234


>gi|331090124|ref|ZP_08339013.1| hypothetical protein HMPREF1025_02596 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|330402586|gb|EGG82155.1| hypothetical protein HMPREF1025_02596 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 191

 Score = 67.1 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 29/54 (53%), Positives = 36/54 (66%), Gaps = 3/54 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +R+AF + +   K VA   +LLIDD+YTTGAT + AA  LKKAGA  V  LT S
Sbjct: 136 LRDAFALSE-RWKPVA--NVLLIDDIYTTGATVEQAAKILKKAGAQNVYFLTIS 186


>gi|297531385|ref|YP_003672660.1| phosphoribosyltransferase [Geobacillus sp. C56-T3]
 gi|297254637|gb|ADI28083.1| phosphoribosyltransferase [Geobacillus sp. C56-T3]
          Length = 230

 Score = 67.1 bits (163), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 23/54 (42%), Positives = 33/54 (61%), Gaps = 2/54 (3%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           N F +  +    + G +I+LIDD+YTTG T + AA+ L +AGA  V  LT  R+
Sbjct: 179 NPFFLSGH--PPIDGKRIVLIDDIYTTGITVRHAALVLLEAGAAEVGALTLIRA 230


>gi|295401188|ref|ZP_06811161.1| phosphoribosyltransferase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|294976781|gb|EFG52386.1| phosphoribosyltransferase [Geobacillus thermoglucosidasius
           C56-YS93]
          Length = 235

 Score = 66.7 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 2/54 (3%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
            N F + +  S  +    I+LIDD+YTTG T + AA  L KAGA +VS LT +R
Sbjct: 183 ENVFRLSEQTS--LQDKPIVLIDDIYTTGTTLRHAAKVLLKAGAASVSSLTLAR 234


>gi|146313458|ref|YP_001178532.1| gluconate periplasmic binding protein [Enterobacter sp. 638]
 gi|145320334|gb|ABP62481.1| putative competence protein [Enterobacter sp. 638]
          Length = 227

 Score = 66.7 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF    ++   V G  I ++DDV TTG+T    +  L ++GA +V +    R+L
Sbjct: 175 LKNAF----HLELSVKGRHIAIVDDVVTTGSTVAELSRLLLQSGAASVQVWCLCRTL 227


>gi|110677794|ref|YP_680801.1| competence protein F, putative [Roseobacter denitrificans OCh 114]
 gi|109453910|gb|ABG30115.1| competence protein F, putative [Roseobacter denitrificans OCh 114]
          Length = 243

 Score = 66.7 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 32/59 (54%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ A          +AG  +LL+DDV+T+GAT   A  A   AG+  V ++T +R  K+
Sbjct: 184 VKGAIRAHPKRRHRMAGRPVLLVDDVFTSGATLSSATDACLAAGSGPVYVVTLARVTKN 242


>gi|241760595|ref|ZP_04758687.1| competence protein [Neisseria flavescens SK114]
 gi|241318776|gb|EER55302.1| competence protein [Neisseria flavescens SK114]
          Length = 238

 Score = 66.7 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++NAF +   + K      ILLIDDV+TTG+T    A  LKK+GA  +   + +R
Sbjct: 182 IKNAFEIKAELPKA---CNILLIDDVFTTGSTLNELAKTLKKSGAGKIFCWSLAR 233


>gi|225077353|ref|ZP_03720552.1| hypothetical protein NEIFLAOT_02413 [Neisseria flavescens
           NRL30031/H210]
 gi|224951345|gb|EEG32554.1| hypothetical protein NEIFLAOT_02413 [Neisseria flavescens
           NRL30031/H210]
          Length = 165

 Score = 66.7 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++NAF +   + K      ILLIDDV+TTG+T    A  LKK+GA  +   + +R
Sbjct: 109 IKNAFKIKAELPKA---CNILLIDDVFTTGSTLNELAKTLKKSGAGKIFCWSLAR 160


>gi|229826214|ref|ZP_04452283.1| hypothetical protein GCWU000182_01586 [Abiotrophia defectiva ATCC
           49176]
 gi|229789084|gb|EEP25198.1| hypothetical protein GCWU000182_01586 [Abiotrophia defectiva ATCC
           49176]
          Length = 177

 Score = 66.7 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 1   MRNAFNVPQYVS-KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF +        +    ILLIDD+YTTG+TA   +  LK+AG   V +L  +  
Sbjct: 118 LREAFRINHNSKFYEIQLKNILLIDDIYTTGSTADACSAVLKEAGTEKVYVLCVASV 174


>gi|138896708|ref|YP_001127161.1| competence protein F [Geobacillus thermodenitrificans NG80-2]
 gi|134268221|gb|ABO68416.1| Competence protein F [Geobacillus thermodenitrificans NG80-2]
          Length = 230

 Score = 66.7 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/44 (47%), Positives = 29/44 (65%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
             + G +I+LIDD+YTTG T + AA  L++AGA  V  LT  R+
Sbjct: 187 PPLTGKRIVLIDDIYTTGITVRHAARVLREAGATEVGSLTLVRA 230


>gi|49473949|ref|YP_031991.1| competence protein comF [Bartonella quintana str. Toulouse]
 gi|49239452|emb|CAF25803.1| Competence protein comF [Bartonella quintana str. Toulouse]
          Length = 261

 Score = 66.7 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 43/59 (72%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           + NAF VP+ V K++ G  +LL+DDV+TTGAT   AA  LK+AGA  V +LTFSR+ K+
Sbjct: 196 VLNAFEVPRKVKKYLKGCSVLLVDDVFTTGATVTAAAATLKQAGARQVDVLTFSRAFKE 254


>gi|153814658|ref|ZP_01967326.1| hypothetical protein RUMTOR_00873 [Ruminococcus torques ATCC 27756]
 gi|317501132|ref|ZP_07959338.1| hypothetical protein HMPREF1026_01281 [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|145848152|gb|EDK25070.1| hypothetical protein RUMTOR_00873 [Ruminococcus torques ATCC 27756]
 gi|316897519|gb|EFV19584.1| hypothetical protein HMPREF1026_01281 [Lachnospiraceae bacterium
           8_1_57FAA]
          Length = 191

 Score = 66.7 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 29/54 (53%), Positives = 36/54 (66%), Gaps = 3/54 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +R+AF + +   K VA   +LLIDD+YTTGAT + AA  LKKAGA  V  LT S
Sbjct: 136 LRDAFALSE-RWKPVA--NVLLIDDIYTTGATVEQAAKILKKAGAQNVYFLTIS 186


>gi|257440338|ref|ZP_05616093.1| competence protein F-related protein [Faecalibacterium prausnitzii
           A2-165]
 gi|257197184|gb|EEU95468.1| competence protein F-related protein [Faecalibacterium prausnitzii
           A2-165]
          Length = 259

 Score = 66.7 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  AF V     + V G +ILL+DDV TTGATA   A AL  AGA +V  +  +  
Sbjct: 187 VAGAFRVA--RPEAVEGKRILLVDDVLTTGATASACAQALLDAGAQSVFAVALATV 240


>gi|192361736|ref|YP_001980949.1| competence protein ComF [Cellvibrio japonicus Ueda107]
 gi|190687901|gb|ACE85579.1| competence protein ComF [Cellvibrio japonicus Ueda107]
          Length = 252

 Score = 66.7 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 30/57 (52%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF         + G  + L+DDV TT ATA+C +  L +AGA  V I   +R+ 
Sbjct: 188 LRRAFAQEPKRCPAIQGKHLALVDDVVTTSATARCLSELLVRAGAARVDIWALARTP 244


>gi|116622521|ref|YP_824677.1| phosphoribosyltransferase [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116225683|gb|ABJ84392.1| phosphoribosyltransferase [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 224

 Score = 66.3 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 36/49 (73%)

Query: 8   PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
             + S+ VAG +ILLIDDV TTG+TA   A+ALK+AGA  V++LT +R 
Sbjct: 156 SAFRSRGVAGRRILLIDDVMTTGSTATSCALALKRAGAKRVALLTVARV 204


>gi|301059590|ref|ZP_07200502.1| ComF family protein [delta proteobacterium NaphS2]
 gi|300446355|gb|EFK10208.1| ComF family protein [delta proteobacterium NaphS2]
          Length = 246

 Score = 66.3 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +++AF +       V    ILL+DDV+TTG T    A  L + GA  V  +T +R++
Sbjct: 191 VQDAFVL--KNPSGVLKKNILLVDDVFTTGNTLNECAKVLMQGGAEAVFCVTLARAV 245


>gi|315923979|ref|ZP_07920207.1| competence protein F [Pseudoramibacter alactolyticus ATCC 23263]
 gi|315622819|gb|EFV02772.1| competence protein F [Pseudoramibacter alactolyticus ATCC 23263]
          Length = 248

 Score = 66.3 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 23/54 (42%), Positives = 34/54 (62%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +  AF V     + +AG +++L+DDV TTGAT +  A ALK +GA  V +LT +
Sbjct: 194 VAGAFRVNPD--QRIAGKRLVLVDDVMTTGATLRACASALKASGAAAVYVLTCA 245


>gi|219670750|ref|YP_002461185.1| phosphoribosyltransferase [Desulfitobacterium hafniense DCB-2]
 gi|219541010|gb|ACL22749.1| phosphoribosyltransferase [Desulfitobacterium hafniense DCB-2]
          Length = 276

 Score = 66.3 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVS--KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           + + F +       K + G ++ LIDDV TTGAT +  A  LK+ GA  V  L  +
Sbjct: 190 LESVFQIVSSSRGLKQIQGARVWLIDDVTTTGATLEHCAKVLKRGGAAQVYGLVLA 245


>gi|89897623|ref|YP_521110.1| hypothetical protein DSY4877 [Desulfitobacterium hafniense Y51]
 gi|89337071|dbj|BAE86666.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 276

 Score = 66.3 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVS--KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           + + F +       K + G ++ LIDDV TTGAT +  A  LK+ GA  V  L  +
Sbjct: 190 LESVFQIVSSSRGLKQIQGARVWLIDDVTTTGATLEHCAKVLKRGGAAQVYGLVLA 245


>gi|319650648|ref|ZP_08004788.1| hypothetical protein HMPREF1013_01393 [Bacillus sp. 2_A_57_CT2]
 gi|317397829|gb|EFV78527.1| hypothetical protein HMPREF1013_01393 [Bacillus sp. 2_A_57_CT2]
          Length = 110

 Score = 66.3 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 28/42 (66%)

Query: 14  HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           H+   KI+LIDD+YTTG+T   AA  LK  GA +V  LT +R
Sbjct: 68  HIENKKIILIDDIYTTGSTLYHAAKVLKAGGAASVCSLTLAR 109


>gi|237802414|ref|ZP_04590875.1| competence protein ComF [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331025271|gb|EGI05327.1| competence protein ComF [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 245

 Score = 66.3 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +  AF +       V    + L+DDV TTG+TA+  A  L  AGA  V +   +R+ K
Sbjct: 186 LHGAFTLIDA--DWVRDKHLALVDDVLTTGSTAEVIARLLNDAGARRVDVYCLARTPK 241


>gi|330994801|ref|ZP_08318723.1| Protein gntX [Gluconacetobacter sp. SXCC-1]
 gi|329758062|gb|EGG74584.1| Protein gntX [Gluconacetobacter sp. SXCC-1]
          Length = 236

 Score = 66.3 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 29/56 (51%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           M  A  V  +    + G  ++++DDV TTGAT      AL  AGA  V +L  +R+
Sbjct: 174 MHGAVGVRAHRQAAIQGRHMIVVDDVMTTGATLAACTRALLAAGAGRVDVLAAARA 229


>gi|326387515|ref|ZP_08209122.1| phosphoribosyltransferase [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326208004|gb|EGD58814.1| phosphoribosyltransferase [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 281

 Score = 66.3 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 30/59 (50%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +     V    +  + G  +LLIDDV T+GAT      AL +AGA  V I  F+R + +
Sbjct: 198 LAGTIRVNARRAARLKGANVLLIDDVLTSGATTNACMAALHRAGAARVRIACFARVVDE 256


>gi|255065466|ref|ZP_05317321.1| ComF/gntX family protein [Neisseria sicca ATCC 29256]
 gi|255050291|gb|EET45755.1| ComF/gntX family protein [Neisseria sicca ATCC 29256]
          Length = 268

 Score = 66.3 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 34/55 (61%), Gaps = 3/55 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++NAF +  ++SK      ILLIDDV+TTG+T    A  LKK+GA  +   + +R
Sbjct: 194 IKNAFEINGHISK---NCNILLIDDVFTTGSTLNELAQTLKKSGAGKIFCWSLAR 245


>gi|284799525|ref|ZP_05984223.2| ComF/gntX family protein [Neisseria subflava NJ9703]
 gi|284798135|gb|EFC53482.1| ComF/gntX family protein [Neisseria subflava NJ9703]
          Length = 165

 Score = 66.3 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++NAF +   + K      ILLIDDV+TTG+T    A  LKK+GA  +   + +R
Sbjct: 109 IKNAFKIKTELPKA---CNILLIDDVFTTGSTLNELAKTLKKSGAGKIFCWSLAR 160


>gi|114327260|ref|YP_744417.1| amidophosphoribosyltransferase family protein [Granulibacter
           bethesdensis CGDNIH1]
 gi|114315434|gb|ABI61494.1| amidophosphoribosyltransferase family protein [Granulibacter
           bethesdensis CGDNIH1]
          Length = 282

 Score = 66.3 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 30/56 (53%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           MR A        + +   +I+++DDV T+GAT      AL  AGA +V +LT +R 
Sbjct: 211 MRGAIQTRAARRQKLRAARIVVVDDVMTSGATISACVRALYAAGAASVDVLTAARV 266


>gi|56694999|ref|YP_165345.1| competence protein F, putative [Ruegeria pomeroyi DSS-3]
 gi|56676736|gb|AAV93402.1| competence protein F, putative [Ruegeria pomeroyi DSS-3]
          Length = 242

 Score = 66.3 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 31/59 (52%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  A +V       +   K+LLIDDV T+GAT   +A A   AGA  V +L  +R  ++
Sbjct: 183 LSGAISVHPKRRHRLTARKLLLIDDVMTSGATLAASAQACLNAGADQVFVLVLARVTRE 241


>gi|291280268|ref|YP_003497103.1| hypothetical protein DEFDS_1895 [Deferribacter desulfuricans SSM1]
 gi|290754970|dbj|BAI81347.1| conserved hypothetical protein [Deferribacter desulfuricans SSM1]
          Length = 221

 Score = 66.3 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 4/55 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +  AF        ++ GLKILL+DD+ TTGAT    +  L K GA  V +   ++
Sbjct: 167 ISGAFK----AKANLKGLKILLVDDIMTTGATINECSKVLLKNGAKKVDVFCLTK 217


>gi|253995944|ref|YP_003048008.1| hypothetical protein Mmol_0571 [Methylotenera mobilis JLW8]
 gi|253982623|gb|ACT47481.1| conserved hypothetical protein [Methylotenera mobilis JLW8]
          Length = 253

 Score = 66.3 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           MR AF    +    +  L I ++DDV TTG +    A  LK+AGA  V     +R+L 
Sbjct: 199 MRGAF----HCQPSLHNLNIAVVDDVMTTGTSLNELAKTLKQAGAARVECWVMARTLP 252


>gi|311745081|ref|ZP_07718866.1| competence protein F-related protein [Algoriphagus sp. PR1]
 gi|126577594|gb|EAZ81814.1| competence protein F-related protein [Algoriphagus sp. PR1]
          Length = 230

 Score = 66.3 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +   F +     + V+GL++LL+DDV TTGAT    A  L   GA  V ++T +
Sbjct: 176 VEGVFELKPG--QSVSGLRVLLVDDVMTTGATLCACANVLLANGAKMVDLVTIA 227


>gi|319638737|ref|ZP_07993496.1| competence protein [Neisseria mucosa C102]
 gi|317399978|gb|EFV80640.1| competence protein [Neisseria mucosa C102]
          Length = 238

 Score = 66.3 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++NAF +   + K      ILLIDDV+TTG+T    A  LKK+GA  +   + +R
Sbjct: 182 IKNAFKIKAELPKA---CNILLIDDVFTTGSTLDELAKTLKKSGAGKIFCWSLAR 233


>gi|229541556|ref|ZP_04430616.1| phosphoribosyltransferase [Bacillus coagulans 36D1]
 gi|229325976|gb|EEN91651.1| phosphoribosyltransferase [Bacillus coagulans 36D1]
          Length = 235

 Score = 66.3 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/42 (47%), Positives = 30/42 (71%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + G  +LL+DD+YTTG+T + AA  L++AGA  +  LT +RS
Sbjct: 194 IEGRSVLLVDDIYTTGSTVRHAAKVLREAGARKIVSLTVARS 235


>gi|322434181|ref|YP_004216393.1| phosphoribosyltransferase [Acidobacterium sp. MP5ACTX9]
 gi|321161908|gb|ADW67613.1| phosphoribosyltransferase [Acidobacterium sp. MP5ACTX9]
          Length = 239

 Score = 65.9 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 35/59 (59%), Gaps = 4/59 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF V       VA  ++LLIDD+ TTGATA+  A  L KAGA  V + T +R+  +
Sbjct: 156 LRGAFEV----RGDVANKEVLLIDDILTTGATARECARVLVKAGASKVWVATVARAQSE 210


>gi|260220118|emb|CBA27337.1| hypothetical protein Csp_A01770 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 253

 Score = 65.9 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 35/56 (62%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R+AF +       V+  +I+L+DDV T+GA+   AA  L+ AGA  ++ L F+R+
Sbjct: 191 VRHAFAMEPLRQGAVSDKRIVLLDDVMTSGASMSAAATTLRHAGAAHITALVFART 246


>gi|89900468|ref|YP_522939.1| ComF family protein [Rhodoferax ferrireducens T118]
 gi|89345205|gb|ABD69408.1| ComF family protein [Rhodoferax ferrireducens T118]
          Length = 230

 Score = 65.9 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 36/56 (64%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +++AF V   +   + G +++L+DDV T+GA+  CAA  L+ AGA  ++ L  +R+
Sbjct: 174 LKDAFAVDPLLVAQLKGARVVLVDDVMTSGASLFCAARTLRAAGAAHITGLVIART 229


>gi|149204345|ref|ZP_01881312.1| competence protein F, putative [Roseovarius sp. TM1035]
 gi|149142230|gb|EDM30277.1| competence protein F, putative [Roseovarius sp. TM1035]
          Length = 232

 Score = 65.9 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 35/59 (59%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           + +A  V       +AG  +L++DDV T+GAT   A  A   AG+  VS++T +R++KD
Sbjct: 173 LTDAIRVTARHRGLIAGRSVLIVDDVMTSGATLSVATQACFSAGSGEVSVVTLARAVKD 231


>gi|317049908|ref|YP_004117556.1| phosphoribosyltransferase [Pantoea sp. At-9b]
 gi|316951525|gb|ADU71000.1| phosphoribosyltransferase [Pantoea sp. At-9b]
          Length = 225

 Score = 65.9 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF +       V G  ILLIDDV TTG+T    +  L+ AGA +V I    R+L
Sbjct: 173 LRGAFRL----EIPVTGRHILLIDDVVTTGSTVAEISRMLQAAGAASVQIGCLCRTL 225


>gi|187777240|ref|ZP_02993713.1| hypothetical protein CLOSPO_00787 [Clostridium sporogenes ATCC
           15579]
 gi|187774168|gb|EDU37970.1| hypothetical protein CLOSPO_00787 [Clostridium sporogenes ATCC
           15579]
          Length = 225

 Score = 65.9 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 38/56 (67%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++++F V  Y  ++V   +ILLIDDV TTGAT+   A  LKK+GA  + ILT ++S
Sbjct: 170 VKDSFKV--YNERYVENKRILLIDDVLTTGATSFYCANELKKSGAKEIFILTAAKS 223


>gi|158321545|ref|YP_001514052.1| competence protein F, putative [Alkaliphilus oremlandii OhILAs]
 gi|158141744|gb|ABW20056.1| competence protein F, putative [Alkaliphilus oremlandii OhILAs]
          Length = 228

 Score = 65.9 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           + +AF V       +    ILL+DD+ TTG+T    +  L   GA TV++LTF+R
Sbjct: 175 VTDAFKVLNN--GVIINKNILLVDDILTTGSTVNECSKILLNFGAKTVTVLTFAR 227


>gi|261856677|ref|YP_003263960.1| phosphoribosyltransferase [Halothiobacillus neapolitanus c2]
 gi|261837146|gb|ACX96913.1| phosphoribosyltransferase [Halothiobacillus neapolitanus c2]
          Length = 247

 Score = 65.9 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 37/57 (64%), Gaps = 5/57 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF V +++ +HVA     ++DDV TTG++A   A ALK+AG   V++   +R+ 
Sbjct: 189 LKNAFEVREHLPQHVA-----IVDDVMTTGSSADALAYALKRAGVGRVTVWVLARTP 240


>gi|85374003|ref|YP_458065.1| amidophosphoribosyltransferase [Erythrobacter litoralis HTCC2594]
 gi|84787086|gb|ABC63268.1| amidophosphoribosyltransferase [Erythrobacter litoralis HTCC2594]
          Length = 263

 Score = 65.5 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 35/59 (59%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  A  +     + +AG  +LL+DDV T+GAT++     L KAGA +V I +F+R L +
Sbjct: 188 LSGAIAIAPAWQQKIAGRDVLLVDDVVTSGATSERCTRVLLKAGAKSVRIASFTRVLSE 246


>gi|304322117|ref|YP_003855760.1| competence protein F [Parvularcula bermudensis HTCC2503]
 gi|303301019|gb|ADM10618.1| competence protein F [Parvularcula bermudensis HTCC2503]
          Length = 284

 Score = 65.5 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 34/58 (58%), Gaps = 1/58 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +  AF V +     + G   +L+DDV TTGAT    A  L++AGA++VS +T +R L 
Sbjct: 216 VSGAFAVREN-DDIIRGRSFVLVDDVLTTGATLLSCARPLRQAGALSVSAVTLARVLP 272


>gi|148258762|ref|YP_001243347.1| putative competence protein F (COMF) [Bradyrhizobium sp. BTAi1]
 gi|146410935|gb|ABQ39441.1| putative competence protein F (COMF) [Bradyrhizobium sp. BTAi1]
          Length = 267

 Score = 65.5 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 34/57 (59%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF V       V G +I+++DDV TTGAT    A AL +A A  VS+L F+R +
Sbjct: 204 VQGAFQVSPDRLHEVQGRRIVIVDDVLTTGATVDACARALLRAKAAEVSVLVFARVV 260


>gi|82702257|ref|YP_411823.1| phosphoribosyltransferase [Nitrosospira multiformis ATCC 25196]
 gi|82410322|gb|ABB74431.1| Phosphoribosyltransferase [Nitrosospira multiformis ATCC 25196]
          Length = 239

 Score = 65.5 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +RNAF+      +++ G  I ++DDV TTGAT    A  L+K GA+ +S    +R+L 
Sbjct: 183 IRNAFD----CEENLDGKHIAIVDDVMTTGATLNELARVLRKCGAVHISAWVVARTLP 236


>gi|254512068|ref|ZP_05124135.1| competence protein F [Rhodobacteraceae bacterium KLH11]
 gi|221535779|gb|EEE38767.1| competence protein F [Rhodobacteraceae bacterium KLH11]
          Length = 192

 Score = 65.5 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 31/59 (52%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           + NA +V       + G  +LL+DDV T+GAT    A   + +GA  + +L  +R  KD
Sbjct: 133 LANAISVHPKRRHRMQGRDVLLVDDVMTSGATLAACARVCRASGANHIFVLALARVAKD 191


>gi|225023962|ref|ZP_03713154.1| hypothetical protein EIKCOROL_00829 [Eikenella corrodens ATCC
           23834]
 gi|224942987|gb|EEG24196.1| hypothetical protein EIKCOROL_00829 [Eikenella corrodens ATCC
           23834]
          Length = 302

 Score = 65.5 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +   F V       V    +LLIDDV T+GAT    A  L++AGA  V    F+R+
Sbjct: 248 VHGIFQVASA--ADVKNRHVLLIDDVVTSGATIGELARTLQRAGAAAVYGWVFARA 301


>gi|331649211|ref|ZP_08350297.1| protein GntX [Escherichia coli M605]
 gi|331041709|gb|EGI13853.1| protein GntX [Escherichia coli M605]
          Length = 243

 Score = 65.5 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 191 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 243


>gi|149912918|ref|ZP_01901452.1| competence protein F, putative [Roseobacter sp. AzwK-3b]
 gi|149813324|gb|EDM73150.1| competence protein F, putative [Roseobacter sp. AzwK-3b]
          Length = 190

 Score = 65.5 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 26/57 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
             F      + H+ G  ILL+DDV T+GAT           GA  V +L  +R  KD
Sbjct: 133 GVFRAHPGRAHHLKGRTILLVDDVMTSGATLSALTQICLAGGATDVRVLVLARVSKD 189


>gi|258591131|emb|CBE67426.1| putative competence protein F (COMF) (fragment) [NC10 bacterium
           'Dutch sediment']
          Length = 165

 Score = 65.5 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF V       V G K+LLIDDV+TTGATA   A  L  AGA  V + T +R 
Sbjct: 111 VKGAFVV--IRPDGVKGKKLLLIDDVFTTGATAAECARTLLAAGAADVGVYTLARV 164


>gi|242237774|ref|YP_002985955.1| gluconate periplasmic binding protein [Dickeya dadantii Ech703]
 gi|242129831|gb|ACS84133.1| gluconate periplasmic binding protein [Dickeya dadantii Ech703]
          Length = 233

 Score = 65.5 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF         + G ++ L+DDV TTG+T +  +  L  AGA  V I    R+L
Sbjct: 181 LKGAFE----CRMALDGKRVALLDDVVTTGSTVEEISRTLLAAGAAQVQIWCLCRTL 233


>gi|119475124|ref|ZP_01615477.1| competence protein ComF, putative [marine gamma proteobacterium
           HTCC2143]
 gi|119451327|gb|EAW32560.1| competence protein ComF, putative [marine gamma proteobacterium
           HTCC2143]
          Length = 243

 Score = 65.5 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           M+ AF     +   VAG  + ++DDV TTG T   A+  L KAGA  V I   +R+
Sbjct: 191 MKGAFQ----MCGDVAGKLVAVVDDVMTTGTTVSEASQCLLKAGATEVHIWCLART 242


>gi|189502636|ref|YP_001958353.1| hypothetical protein Aasi_1314 [Candidatus Amoebophilus asiaticus
           5a2]
 gi|189498077|gb|ACE06624.1| hypothetical protein Aasi_1314 [Candidatus Amoebophilus asiaticus
           5a2]
          Length = 226

 Score = 65.5 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
           +R+AF V       + G  +LL+DD+ TTGAT +  A+ L  AGA  VSI
Sbjct: 172 LRDAFYVVNT--SLIQGKHVLLVDDIITTGATLEACALPLLAAGAKEVSI 219


>gi|332982900|ref|YP_004464341.1| phosphoribosyltransferase [Mahella australiensis 50-1 BON]
 gi|332700578|gb|AEE97519.1| phosphoribosyltransferase [Mahella australiensis 50-1 BON]
          Length = 243

 Score = 65.5 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 23/52 (44%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
            AF+V     K + G  I+LIDD+ TTGATA   A AL   GA  V + T +
Sbjct: 189 GAFDVKDA--KDIKGKTIMLIDDILTTGATADACAQALLVGGANAVYVFTLA 238


>gi|189425986|ref|YP_001953163.1| competence protein F [Geobacter lovleyi SZ]
 gi|189422245|gb|ACD96643.1| competence protein F, putative [Geobacter lovleyi SZ]
          Length = 243

 Score = 65.5 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF V       V    ++L+DDV+TTG+T    A+ L++AG  TVS +T + + 
Sbjct: 189 LRGAFAV--TTPDSVNNRHVMLVDDVFTTGSTLAECALVLQRAGCHTVSAVTVAHAP 243


>gi|260599715|ref|YP_003212286.1| protein gntX [Cronobacter turicensis z3032]
 gi|260218892|emb|CBA34247.1| Protein gntX [Cronobacter turicensis z3032]
          Length = 251

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 25/57 (43%), Positives = 34/57 (59%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF V       VAGL I+++DDV TTG+T    A  LK+ GA TV +    R+L
Sbjct: 199 LKNAFRV----ELPVAGLHIVIVDDVVTTGSTVARIARLLKRNGAATVQVWCLCRTL 251


>gi|27375320|ref|NP_766849.1| competence protein F [Bradyrhizobium japonicum USDA 110]
 gi|27348456|dbj|BAC45474.1| competence protein F [Bradyrhizobium japonicum USDA 110]
          Length = 265

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 33/57 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF V       V G +I+LIDDV T+GAT    A AL +A A  V +L F+R +
Sbjct: 206 VQGAFQVSPDRQAEVQGRRIVLIDDVLTSGATLDACARALLRAKAAQVDVLVFARVV 262


>gi|254464782|ref|ZP_05078193.1| competence protein F [Rhodobacterales bacterium Y4I]
 gi|206685690|gb|EDZ46172.1| competence protein F [Rhodobacterales bacterium Y4I]
          Length = 242

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 24/50 (48%)

Query: 9   QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
                 + G  +L++DDV T+GAT      A  +AGA  V +   +R  +
Sbjct: 192 PGRLNRIRGRSVLIVDDVMTSGATLSACTDACLRAGASEVRVAVLARVTQ 241


>gi|331674901|ref|ZP_08375658.1| protein GntX [Escherichia coli TA280]
 gi|331067810|gb|EGI39208.1| protein GntX [Escherichia coli TA280]
          Length = 243

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 191 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 243


>gi|330505323|ref|YP_004382192.1| amidophosphoribosyltransferase-like protein [Pseudomonas mendocina
           NK-01]
 gi|328919609|gb|AEB60440.1| amidophosphoribosyltransferase-like protein [Pseudomonas mendocina
           NK-01]
          Length = 192

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF++   V   +AG  + LIDDV TTGATA   A  L++AGA+ V +   +R+ +
Sbjct: 133 LRQAFSL--QVQAAIAGAHLALIDDVLTTGATADMLAQLLRRAGALRVDVYCLARTPR 188


>gi|194435591|ref|ZP_03067694.1| protein GntX [Escherichia coli 101-1]
 gi|194425134|gb|EDX41118.1| protein GntX [Escherichia coli 101-1]
          Length = 248

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 196 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 248


>gi|319795688|ref|YP_004157328.1| phosphoribosyltransferase [Variovorax paradoxus EPS]
 gi|315598151|gb|ADU39217.1| phosphoribosyltransferase [Variovorax paradoxus EPS]
          Length = 238

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 34/56 (60%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF V    +  +   +I+L+DDV T+GA+   AA  L+ AGA+ ++ +  +R+
Sbjct: 179 LRGAFAVEPLRADRLREKRIVLVDDVMTSGASLFAAAGVLRMAGAVHITAVVLART 234


>gi|291615045|ref|YP_003525202.1| phosphoribosyltransferase [Sideroxydans lithotrophicus ES-1]
 gi|291585157|gb|ADE12815.1| phosphoribosyltransferase [Sideroxydans lithotrophicus ES-1]
          Length = 238

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 26/58 (44%), Positives = 33/58 (56%), Gaps = 3/58 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           MR AF      S  V G  I ++DDV TTGA+    A ALK+AGA  VS+   +R+L 
Sbjct: 181 MRQAFVCS---STDVRGKHIAIVDDVMTTGASTGELARALKQAGAREVSVWVVARTLP 235


>gi|187775692|ref|ZP_02992680.1| protein GntX [Escherichia coli O157:H7 str. EC4196]
 gi|188024504|ref|ZP_02772131.2| protein GntX [Escherichia coli O157:H7 str. EC4113]
 gi|189010096|ref|ZP_02804504.2| protein GntX [Escherichia coli O157:H7 str. EC4076]
 gi|189402773|ref|ZP_02790768.2| protein GntX [Escherichia coli O157:H7 str. EC4486]
 gi|189403746|ref|ZP_02784445.2| protein GntX [Escherichia coli O157:H7 str. EC4501]
 gi|189404697|ref|ZP_02810225.2| protein GntX [Escherichia coli O157:H7 str. EC869]
 gi|208809535|ref|ZP_03251872.1| protein GntX [Escherichia coli O157:H7 str. EC4206]
 gi|208813850|ref|ZP_03255179.1| protein GntX [Escherichia coli O157:H7 str. EC4045]
 gi|208821693|ref|ZP_03262013.1| protein GntX [Escherichia coli O157:H7 str. EC4042]
 gi|209396165|ref|YP_002272849.1| protein GntX [Escherichia coli O157:H7 str. EC4115]
 gi|217324234|ref|ZP_03440318.1| protein GntX [Escherichia coli O157:H7 str. TW14588]
 gi|187771691|gb|EDU35535.1| protein GntX [Escherichia coli O157:H7 str. EC4196]
 gi|188018351|gb|EDU56473.1| protein GntX [Escherichia coli O157:H7 str. EC4113]
 gi|189002345|gb|EDU71331.1| protein GntX [Escherichia coli O157:H7 str. EC4076]
 gi|189364761|gb|EDU83180.1| protein GntX [Escherichia coli O157:H7 str. EC4486]
 gi|189369879|gb|EDU88295.1| protein GntX [Escherichia coli O157:H7 str. EC4501]
 gi|189374500|gb|EDU92916.1| protein GntX [Escherichia coli O157:H7 str. EC869]
 gi|208729336|gb|EDZ78937.1| protein GntX [Escherichia coli O157:H7 str. EC4206]
 gi|208735127|gb|EDZ83814.1| protein GntX [Escherichia coli O157:H7 str. EC4045]
 gi|208741816|gb|EDZ89498.1| protein GntX [Escherichia coli O157:H7 str. EC4042]
 gi|209157565|gb|ACI34998.1| protein GntX [Escherichia coli O157:H7 str. EC4115]
 gi|217320455|gb|EEC28879.1| protein GntX [Escherichia coli O157:H7 str. TW14588]
          Length = 248

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 196 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 248


>gi|26110443|gb|AAN82628.1|AE016768_46 Hypothetical protein yhgH [Escherichia coli CFT073]
          Length = 248

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 196 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 248


>gi|110807248|ref|YP_690768.1| gluconate periplasmic binding protein [Shigella flexneri 5 str.
           8401]
 gi|332281959|ref|ZP_08394372.1| conserved hypothetical protein [Shigella sp. D9]
 gi|30043564|gb|AAP19284.1| hypothetical protein S4330 [Shigella flexneri 2a str. 2457T]
 gi|56383886|gb|AAN44897.2| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|110616796|gb|ABF05463.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|281602767|gb|ADA75751.1| gluconate periplasmic binding protein [Shigella flexneri 2002017]
 gi|332104311|gb|EGJ07657.1| conserved hypothetical protein [Shigella sp. D9]
          Length = 243

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 191 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 243


>gi|331654991|ref|ZP_08355990.1| protein GntX [Escherichia coli M718]
 gi|331047006|gb|EGI19084.1| protein GntX [Escherichia coli M718]
          Length = 243

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 191 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 243


>gi|110835082|ref|YP_693941.1| hypothetical protein ABO_2221 [Alcanivorax borkumensis SK2]
 gi|110648193|emb|CAL17669.1| conserved hypothetical protein [Alcanivorax borkumensis SK2]
          Length = 247

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 34/58 (58%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF         V GL+++L+DDV TTG++A+ AA  L   GA  V + T +R+L 
Sbjct: 190 LRQAFR----CQHSVTGLRLILVDDVMTTGSSARAAAQCLLDQGAKDVRVWTLARTLP 243


>gi|312115454|ref|YP_004013050.1| phosphoribosyltransferase [Rhodomicrobium vannielii ATCC 17100]
 gi|311220583|gb|ADP71951.1| phosphoribosyltransferase [Rhodomicrobium vannielii ATCC 17100]
          Length = 261

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 26/51 (50%), Positives = 32/51 (62%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           AFNV     + VAG ++LL+DDV TTGATA   + AL  AGA  V IL  +
Sbjct: 194 AFNVGASGRRAVAGKRVLLVDDVITTGATANACSTALLAAGARAVDILAVA 244


>gi|154499872|ref|ZP_02037910.1| hypothetical protein BACCAP_03529 [Bacteroides capillosus ATCC
           29799]
 gi|150271470|gb|EDM98727.1| hypothetical protein BACCAP_03529 [Bacteroides capillosus ATCC
           29799]
          Length = 220

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 27/45 (60%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
            + VAG +ILLIDDV TTGAT    A  L  AGA  V   T +R+
Sbjct: 172 PELVAGKRILLIDDVITTGATISECARTLLTAGAEKVVCATLARA 216


>gi|254784709|ref|YP_003072137.1| competence protein ComF [Teredinibacter turnerae T7901]
 gi|237683729|gb|ACR10993.1| competence protein ComF [Teredinibacter turnerae T7901]
          Length = 234

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 30/57 (52%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           + A      +++ V    ILL+DDV TTGAT    A  L+ AGA  V I   +R+ K
Sbjct: 177 QRAVRNSYAITRDVRHRHILLVDDVMTTGATVGAIAQLLRDAGANRVDIACLARTPK 233


>gi|301019566|ref|ZP_07183728.1| ComF family protein [Escherichia coli MS 69-1]
 gi|300399191|gb|EFJ82729.1| ComF family protein [Escherichia coli MS 69-1]
          Length = 227

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|284822068|gb|ADB98038.1| gluconate periplasmic binding protein [Escherichia coli]
          Length = 243

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 191 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 243


>gi|237703143|ref|ZP_04533624.1| gluconate periplasmic binding protein [Escherichia sp. 3_2_53FAA]
 gi|91074462|gb|ABE09343.1| hypothetical protein YhgH [Escherichia coli UTI89]
 gi|226902407|gb|EEH88666.1| gluconate periplasmic binding protein [Escherichia sp. 3_2_53FAA]
          Length = 248

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 196 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 248


>gi|331679477|ref|ZP_08380147.1| protein GntX [Escherichia coli H591]
 gi|73857392|gb|AAZ90099.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|331072649|gb|EGI43974.1| protein GntX [Escherichia coli H591]
          Length = 243

 Score = 64.8 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 191 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 243


>gi|303240176|ref|ZP_07326696.1| phosphoribosyltransferase [Acetivibrio cellulolyticus CD2]
 gi|302592267|gb|EFL61995.1| phosphoribosyltransferase [Acetivibrio cellulolyticus CD2]
          Length = 195

 Score = 64.8 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +++AF V       V G  IL++DD+ TTG T       LK AGA  ++    +
Sbjct: 139 VKDAFRVTNV--NAVDGKSILILDDILTTGTTLNECCKVLKNAGASKITAAVVA 190


>gi|325294534|ref|YP_004281048.1| phosphoribosyltransferase [Desulfurobacterium thermolithotrophum
           DSM 11699]
 gi|325064982|gb|ADY72989.1| phosphoribosyltransferase [Desulfurobacterium thermolithotrophum
           DSM 11699]
          Length = 245

 Score = 64.8 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++  F V +     V G +ILL DDV+TTG+T    +  LK+ GA  V + + +RS+
Sbjct: 193 IKGIFEVVE----KVWGKRILLFDDVFTTGSTVNEISRVLKENGASKVFVYSVARSI 245


>gi|90416989|ref|ZP_01224918.1| probable phosphoribosyl transferase [marine gamma proteobacterium
           HTCC2207]
 gi|90331336|gb|EAS46580.1| probable phosphoribosyl transferase [marine gamma proteobacterium
           HTCC2207]
          Length = 167

 Score = 64.8 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 25/56 (44%), Positives = 36/56 (64%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF      +K + GL + ++DDV TTGATA  AA AL +AGA  V I + +R+
Sbjct: 108 IKNAFI---AEAKDLKGLSVAIVDDVVTTGATANSAAKALLRAGAAQVDIWSIART 160


>gi|12518043|gb|AAG58514.1|AE005563_8 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|13363729|dbj|BAB37678.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|209756448|gb|ACI76536.1| hypothetical protein ECs4254 [Escherichia coli]
 gi|209756450|gb|ACI76537.1| hypothetical protein ECs4254 [Escherichia coli]
 gi|209756452|gb|ACI76538.1| hypothetical protein ECs4254 [Escherichia coli]
 gi|209756454|gb|ACI76539.1| hypothetical protein ECs4254 [Escherichia coli]
 gi|209756456|gb|ACI76540.1| hypothetical protein ECs4254 [Escherichia coli]
          Length = 243

 Score = 64.8 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 191 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 243


>gi|170766640|ref|ZP_02901093.1| protein GntX [Escherichia albertii TW07627]
 gi|170124078|gb|EDS93009.1| protein GntX [Escherichia albertii TW07627]
          Length = 227

 Score = 64.8 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|30250228|ref|NP_842298.1| hypothetical protein NE2301 [Nitrosomonas europaea ATCC 19718]
 gi|30181023|emb|CAD86213.1| conserved hypothetical protein [Nitrosomonas europaea ATCC 19718]
          Length = 258

 Score = 64.8 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 32/58 (55%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +RNAF      +++ +G ++ ++DDV T+GAT    A  +++ GA  V     +R+  
Sbjct: 182 VRNAFT----CNRNFSGKRVAIVDDVMTSGATLNELAKVIRRHGATDVRAWVIARAFP 235


>gi|91203265|emb|CAJ72904.1| similar to competence protein F [Candidatus Kuenenia
           stuttgartiensis]
          Length = 249

 Score = 64.8 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF +       + G ++LL+DDV TTG T +  A  LKK GA ++ +  F+
Sbjct: 192 VQKAFFI--KNPAIMKGKRVLLVDDVLTTGLTMRECAKKLKKTGAKSIHLFVFA 243


>gi|117625678|ref|YP_859001.1| gluconate periplasmic binding protein [Escherichia coli APEC O1]
 gi|81247180|gb|ABB67888.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|115514802|gb|ABJ02877.1| conserved hypothetical protein [Escherichia coli APEC O1]
          Length = 243

 Score = 64.8 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 191 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 243


>gi|215488694|ref|YP_002331125.1| gluconate periplasmic binding protein [Escherichia coli O127:H6
           str. E2348/69]
 gi|215266766|emb|CAS11206.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli O127:H6 str. E2348/69]
          Length = 227

 Score = 64.8 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|110643646|ref|YP_671376.1| gluconate periplasmic binding protein [Escherichia coli 536]
 gi|191171572|ref|ZP_03033120.1| protein GntX [Escherichia coli F11]
 gi|300987299|ref|ZP_07178107.1| ComF family protein [Escherichia coli MS 200-1]
 gi|110345238|gb|ABG71475.1| putative amidophosphoribosyltransferase [Escherichia coli 536]
 gi|190908199|gb|EDV67790.1| protein GntX [Escherichia coli F11]
 gi|300306167|gb|EFJ60687.1| ComF family protein [Escherichia coli MS 200-1]
 gi|324014595|gb|EGB83814.1| ComF family protein [Escherichia coli MS 60-1]
          Length = 227

 Score = 64.8 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|15966372|ref|NP_386725.1| hypothetical protein SMc02444 [Sinorhizobium meliloti 1021]
 gi|307313041|ref|ZP_07592668.1| phosphoribosyltransferase [Sinorhizobium meliloti BL225C]
 gi|307321047|ref|ZP_07600453.1| phosphoribosyltransferase [Sinorhizobium meliloti AK83]
 gi|15075643|emb|CAC47198.1| Putative competence protein F [Sinorhizobium meliloti 1021]
 gi|306893322|gb|EFN24102.1| phosphoribosyltransferase [Sinorhizobium meliloti AK83]
 gi|306899360|gb|EFN29994.1| phosphoribosyltransferase [Sinorhizobium meliloti BL225C]
          Length = 248

 Score = 64.8 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 30/58 (51%), Positives = 43/58 (74%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF VP+   + +AG +I+L+DDVYTTGAT   A  ALK+AGA  V++LTF+R++ 
Sbjct: 188 VRGAFAVPEGAKRELAGKRIVLVDDVYTTGATVAAATRALKRAGAGDVTVLTFARAMS 245


>gi|330909446|gb|EGH37960.1| hypothetical protein ECAA86_03648 [Escherichia coli AA86]
          Length = 227

 Score = 64.8 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|281180445|dbj|BAI56775.1| conserved hypothetical protein [Escherichia coli SE15]
          Length = 227

 Score = 64.8 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|254038580|ref|ZP_04872636.1| GntX [Escherichia sp. 1_1_43]
 gi|331644113|ref|ZP_08345242.1| protein GntX [Escherichia coli H736]
 gi|606348|gb|AAA58211.1| ORF_o243 [Escherichia coli str. K-12 substr. MG1655]
 gi|226839086|gb|EEH71109.1| GntX [Escherichia sp. 1_1_43]
 gi|331036407|gb|EGI08633.1| protein GntX [Escherichia coli H736]
          Length = 243

 Score = 64.8 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA  V +    R+L
Sbjct: 191 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAAAVQVWCLCRTL 243


>gi|126730067|ref|ZP_01745879.1| Competence protein F [Sagittula stellata E-37]
 gi|126709447|gb|EBA08501.1| Competence protein F [Sagittula stellata E-37]
          Length = 237

 Score = 64.8 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 30/59 (50%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +          +  +AG ++LL+DDV TTGAT    A A   AGA  V +   +R +KD
Sbjct: 178 LSGRIAARAGRAGLMAGRRVLLVDDVMTTGATLAACAEACLSAGAQQVCVSVLARVVKD 236


>gi|258406303|ref|YP_003199045.1| competence protein F [Desulfohalobium retbaense DSM 5692]
 gi|257798530|gb|ACV69467.1| competence protein F [Desulfohalobium retbaense DSM 5692]
          Length = 256

 Score = 64.8 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           MR+AF V   +S H     +LL+DDV+TTGAT    A  L +AG   + +LT +R+
Sbjct: 202 MRDAFAVFGEISWH--ERNVLLVDDVFTTGATLSACARRLCEAGVARLGVLTMARA 255


>gi|91776533|ref|YP_546289.1| hypothetical protein Mfla_2181 [Methylobacillus flagellatus KT]
 gi|91710520|gb|ABE50448.1| conserved hypothetical protein [Methylobacillus flagellatus KT]
          Length = 227

 Score = 64.8 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 4/59 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           M+ AF         +  ++++L+DDV TTGA+    A  +K AGA  V     +R++ +
Sbjct: 173 MQGAFA----CQAELTDMRVILLDDVMTTGASLNALAKTVKAAGASRVECWVIARTIAE 227


>gi|163732997|ref|ZP_02140441.1| competence protein F, putative [Roseobacter litoralis Och 149]
 gi|161393532|gb|EDQ17857.1| competence protein F, putative [Roseobacter litoralis Och 149]
          Length = 175

 Score = 64.4 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 33/59 (55%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ A          +AG  ILL+DDV+T+GAT   A  A   AG+  V ++T +R +K+
Sbjct: 116 VKGAIRAHPKRRHRLAGRPILLVDDVFTSGATLSSATDACLAAGSGPVYVVTLARVIKN 174


>gi|56964847|ref|YP_176578.1| late competence protein ComFC [Bacillus clausii KSM-K16]
 gi|56911090|dbj|BAD65617.1| late competence protein ComFC [Bacillus clausii KSM-K16]
          Length = 234

 Score = 64.4 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 33/55 (60%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +N F V    +  +AG   L++DD+YTTG T + AA  L   GA +VS LT +R+
Sbjct: 179 KNPFCVLSRKTSDIAGKDFLVVDDIYTTGTTVRQAAAILLAHGAKSVSSLTVARA 233


>gi|300919300|ref|ZP_07135814.1| ComF family protein [Escherichia coli MS 115-1]
 gi|300413615|gb|EFJ96925.1| ComF family protein [Escherichia coli MS 115-1]
          Length = 227

 Score = 64.4 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|218691689|ref|YP_002399901.1| gluconate periplasmic binding protein [Escherichia coli ED1a]
 gi|306816249|ref|ZP_07450387.1| gluconate periplasmic binding protein [Escherichia coli NC101]
 gi|218429253|emb|CAR10064.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli ED1a]
 gi|305850645|gb|EFM51102.1| gluconate periplasmic binding protein [Escherichia coli NC101]
 gi|320197372|gb|EFW71987.1| gluconate periplasmic binding protein [Escherichia coli WV_060327]
          Length = 227

 Score = 64.4 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|124009197|ref|ZP_01693878.1| competence protein [Microscilla marina ATCC 23134]
 gi|123985182|gb|EAY25116.1| competence protein [Microscilla marina ATCC 23134]
          Length = 241

 Score = 64.4 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           + N F V     + V G  +LL+DDV TTGAT +  A +L K G   VS+ T + +L
Sbjct: 187 VDNIFEV--LRPELVKGQHVLLVDDVVTTGATLEACANSLLKVGTAKVSVATIAVAL 241


>gi|110635335|ref|YP_675543.1| phosphoribosyltransferase [Mesorhizobium sp. BNC1]
 gi|110286319|gb|ABG64378.1| phosphoribosyltransferase [Chelativorans sp. BNC1]
          Length = 270

 Score = 64.4 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF VP    + + G +++LIDDV+TTGAT   A  ALK+ GA  V +LTF+R+LK+
Sbjct: 202 VRGAFVVPPAAERILTGKRVILIDDVFTTGATVAAATRALKRGGAGEVDVLTFARALKE 260


>gi|218707004|ref|YP_002414523.1| gluconate periplasmic binding protein [Escherichia coli UMN026]
 gi|300898898|ref|ZP_07117199.1| ComF family protein [Escherichia coli MS 198-1]
 gi|331665019|ref|ZP_08365920.1| protein GntX [Escherichia coli TA143]
 gi|218434101|emb|CAR15018.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli UMN026]
 gi|284923405|emb|CBG36499.1| putative competence protein [Escherichia coli 042]
 gi|300357460|gb|EFJ73330.1| ComF family protein [Escherichia coli MS 198-1]
 gi|331057529|gb|EGI29515.1| protein GntX [Escherichia coli TA143]
          Length = 227

 Score = 64.4 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|312968275|ref|ZP_07782485.1| protein gntX [Escherichia coli 2362-75]
 gi|312287100|gb|EFR15010.1| protein gntX [Escherichia coli 2362-75]
          Length = 215

 Score = 64.4 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|323188997|gb|EFZ74281.1| protein gntX [Escherichia coli RN587/1]
          Length = 215

 Score = 64.4 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|225568551|ref|ZP_03777576.1| hypothetical protein CLOHYLEM_04628 [Clostridium hylemonae DSM
           15053]
 gi|225162779|gb|EEG75398.1| hypothetical protein CLOHYLEM_04628 [Clostridium hylemonae DSM
           15053]
          Length = 235

 Score = 64.4 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 30/54 (55%), Gaps = 3/54 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +R AF V ++         +LLIDD+YTTG T   AA  LKKAG   V  LT S
Sbjct: 180 VRGAFAVTEHFRPV---PSVLLIDDIYTTGNTVDAAAEILKKAGVENVCFLTIS 230


>gi|293453719|ref|ZP_06664138.1| gluconate periplasmic binding protein [Escherichia coli B088]
 gi|291321845|gb|EFE61276.1| gluconate periplasmic binding protein [Escherichia coli B088]
          Length = 227

 Score = 64.4 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|161485822|ref|NP_709190.3| gluconate periplasmic binding protein [Shigella flexneri 2a str.
           301]
 gi|161486382|ref|NP_839473.2| gluconate periplasmic binding protein [Shigella flexneri 2a str.
           2457T]
 gi|193068814|ref|ZP_03049774.1| protein GntX [Escherichia coli E110019]
 gi|194431130|ref|ZP_03063423.1| protein GntX [Shigella dysenteriae 1012]
 gi|218550671|ref|YP_002384462.1| gluconate periplasmic binding protein [Escherichia fergusonii ATCC
           35469]
 gi|218697096|ref|YP_002404763.1| gluconate periplasmic binding protein [Escherichia coli 55989]
 gi|256020758|ref|ZP_05434623.1| gluconate periplasmic binding protein [Shigella sp. D9]
 gi|260857520|ref|YP_003231411.1| gluconate periplasmic binding protein GntX [Escherichia coli
           O26:H11 str. 11368]
 gi|260870139|ref|YP_003236541.1| gluconate periplasmic binding protein GntX [Escherichia coli
           O111:H- str. 11128]
 gi|307311922|ref|ZP_07591560.1| comF family protein [Escherichia coli W]
 gi|51701421|sp|Q83J92|GNTX_SHIFL RecName: Full=Protein GntX
 gi|192957890|gb|EDV88333.1| protein GntX [Escherichia coli E110019]
 gi|194420585|gb|EDX36661.1| protein GntX [Shigella dysenteriae 1012]
 gi|218353828|emb|CAV00184.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli 55989]
 gi|218358212|emb|CAQ90859.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia fergusonii ATCC 35469]
 gi|257756169|dbj|BAI27671.1| gluconate periplasmic binding protein GntX [Escherichia coli
           O26:H11 str. 11368]
 gi|257766495|dbj|BAI37990.1| gluconate periplasmic binding protein GntX [Escherichia coli
           O111:H- str. 11128]
 gi|306908066|gb|EFN38566.1| comF family protein [Escherichia coli W]
 gi|313647285|gb|EFS11737.1| protein gntX [Shigella flexneri 2a str. 2457T]
 gi|315062691|gb|ADT77018.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli W]
 gi|320199586|gb|EFW74176.1| gluconate periplasmic binding protein [Escherichia coli EC4100B]
 gi|323154248|gb|EFZ40451.1| protein gntX [Escherichia coli EPECa14]
 gi|323376721|gb|ADX48989.1| comF family protein [Escherichia coli KO11]
 gi|324111726|gb|EGC05706.1| comF family protein [Escherichia fergusonii B253]
 gi|332749485|gb|EGJ79902.1| protein gntX [Shigella flexneri K-671]
 gi|332750332|gb|EGJ80743.1| protein gntX [Shigella flexneri 4343-70]
 gi|332996396|gb|EGK16023.1| protein gntX [Shigella flexneri VA-6]
 gi|332997062|gb|EGK16678.1| protein gntX [Shigella flexneri K-218]
          Length = 227

 Score = 64.4 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|58697413|ref|ZP_00372723.1| competence protein F, interruption-N [Wolbachia endosymbiont of
           Drosophila simulans]
 gi|225630605|ref|YP_002727396.1| putative competence protein F [Wolbachia sp. wRi]
 gi|58536171|gb|EAL59759.1| competence protein F, interruption-N [Wolbachia endosymbiont of
           Drosophila simulans]
 gi|225592586|gb|ACN95605.1| putative competence protein F [Wolbachia sp. wRi]
          Length = 243

 Score = 64.4 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ AF       K +    ++L+DDV TTGAT +  +  +  +GA  V +L+ +R++ D
Sbjct: 180 LKKAFKTSN--KKIIENKIVILVDDVVTTGATVRSCSQEILNSGAKEVRVLSLARTVND 236


>gi|58699163|ref|ZP_00373983.1| putative amidophosphoribosyltransferase [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|58534319|gb|EAL58498.1| putative amidophosphoribosyltransferase [Wolbachia endosymbiont of
           Drosophila ananassae]
          Length = 194

 Score = 64.4 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ AF       K +    ++L+DDV TTGAT +  +  +  +GA  V +L+ +R++ D
Sbjct: 131 LKKAFKTSN--KKIIENKIVILVDDVVTTGATVRSCSQEILNSGAKEVRVLSLARTVND 187


>gi|39933674|ref|NP_945950.1| phosphoribosyltransferase [Rhodopseudomonas palustris CGA009]
 gi|192289031|ref|YP_001989636.1| phosphoribosyltransferase [Rhodopseudomonas palustris TIE-1]
 gi|39647520|emb|CAE26041.1| possible competence protein F (COMF) [Rhodopseudomonas palustris
           CGA009]
 gi|192282780|gb|ACE99160.1| phosphoribosyltransferase [Rhodopseudomonas palustris TIE-1]
          Length = 271

 Score = 64.4 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 37/57 (64%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF VP++    + G +I+LIDDV T+GAT    A AL +A A +V +L F+R +
Sbjct: 208 VQGAFKVPKHRKAEIQGRRIVLIDDVLTSGATVDACARALLRARAASVDVLVFARVV 264


>gi|323966226|gb|EGB61662.1| comF family protein [Escherichia coli M863]
 gi|327251049|gb|EGE62742.1| protein gntX [Escherichia coli STEC_7v]
          Length = 227

 Score = 64.4 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|320181905|gb|EFW56811.1| gluconate periplasmic binding protein [Shigella boydii ATCC 9905]
          Length = 227

 Score = 64.4 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|293412831|ref|ZP_06655499.1| gluconate periplasmic binding protein [Escherichia coli B354]
 gi|300907443|ref|ZP_07125090.1| ComF family protein [Escherichia coli MS 84-1]
 gi|301302292|ref|ZP_07208424.1| ComF family protein [Escherichia coli MS 124-1]
 gi|291468478|gb|EFF10971.1| gluconate periplasmic binding protein [Escherichia coli B354]
 gi|300400858|gb|EFJ84396.1| ComF family protein [Escherichia coli MS 84-1]
 gi|300842455|gb|EFK70215.1| ComF family protein [Escherichia coli MS 124-1]
 gi|315256004|gb|EFU35972.1| ComF family protein [Escherichia coli MS 85-1]
          Length = 227

 Score = 64.4 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|161505924|ref|YP_001573035.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160867271|gb|ABX23894.1| hypothetical protein SARI_04105 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 243

 Score = 64.4 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L ++GA TV +    R+L
Sbjct: 191 LKNAFRL----ELPVRGLHMVIVDDVVTTGSTVAEIAQLLLRSGAATVQVWCLCRTL 243


>gi|254520269|ref|ZP_05132325.1| ComF protein [Clostridium sp. 7_2_43FAA]
 gi|226914018|gb|EEH99219.1| ComF protein [Clostridium sp. 7_2_43FAA]
          Length = 214

 Score = 64.4 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  AF +    +K++    I+LIDDV TTGAT       LKK+GA ++ ILT ++S
Sbjct: 159 IEGAFGI--KSNKNIKDKNIILIDDVITTGATLLECEKLLKKSGANSIKILTVAKS 212


>gi|206890480|ref|YP_002248775.1| phosphoribosyltransferase [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|206742418|gb|ACI21475.1| phosphoribosyltransferase [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 219

 Score = 64.4 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NA+ V   + K +    + L+DDV TTGAT    A  LKKAG   V  +T +R++
Sbjct: 167 VKNAYKVT-GLMKEIK---VGLVDDVVTTGATLMECAKTLKKAGIKEVHAITLARTI 219


>gi|307824520|ref|ZP_07654745.1| phosphoribosyltransferase [Methylobacter tundripaludum SV96]
 gi|307734504|gb|EFO05356.1| phosphoribosyltransferase [Methylobacter tundripaludum SV96]
          Length = 235

 Score = 64.0 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF++       +    I ++DDV TTG+T    A  LKKAGA  V +   +R+
Sbjct: 184 LKNAFSI----INPIHARHIAILDDVMTTGSTTHELAYLLKKAGASRVDVWVCARA 235


>gi|77920166|ref|YP_357981.1| amidophosphoribosyltransferase [Pelobacter carbinolicus DSM 2380]
 gi|77546249|gb|ABA89811.1| predicted amidophosphoribosyltransferase [Pelobacter carbinolicus
           DSM 2380]
          Length = 247

 Score = 64.0 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 35/56 (62%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF +     + +AG ++LL+DDV TTGATA+  A  L   GA +V++   +R+
Sbjct: 190 LKGAFALT----QKLAGQRVLLVDDVLTTGATARECAATLLAGGASSVAVAVLARA 241


>gi|298292753|ref|YP_003694692.1| phosphoribosyltransferase [Starkeya novella DSM 506]
 gi|296929264|gb|ADH90073.1| phosphoribosyltransferase [Starkeya novella DSM 506]
          Length = 273

 Score = 64.0 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 29/44 (65%)

Query: 14  HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
            + G +++L+DDV TTGAT    A AL +AGA  V +L F+R +
Sbjct: 222 ELRGRRVVLVDDVLTTGATIDACAKALTRAGAGRVDVLVFARVV 265


>gi|285017173|ref|YP_003374884.1| amidophosphoribosyltransferase [Xanthomonas albilineans GPE PC73]
 gi|283472391|emb|CBA14896.1| putative competence protein (amidophosphoribosyltransferases)
           [Xanthomonas albilineans]
          Length = 243

 Score = 64.0 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 29/57 (50%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF VP      V    + LIDDV TTGAT   AA AL++AG   V     +R  
Sbjct: 190 LRGAFAVPDPA---VLPAHVALIDDVMTTGATLHAAAQALRRAGVTRVDAWVVARVP 243


>gi|157162890|ref|YP_001460208.1| gluconate periplasmic binding protein [Escherichia coli HS]
 gi|161986432|ref|YP_312335.2| gluconate periplasmic binding protein [Shigella sonnei Ss046]
 gi|191167292|ref|ZP_03029109.1| protein GntX [Escherichia coli B7A]
 gi|191167880|ref|ZP_03029684.1| protein GntX [Escherichia coli B7A]
 gi|209920871|ref|YP_002294955.1| gluconate periplasmic binding protein [Escherichia coli SE11]
 gi|218555962|ref|YP_002388875.1| gluconate periplasmic binding protein [Escherichia coli IAI1]
 gi|254163341|ref|YP_003046449.1| gluconate periplasmic binding protein [Escherichia coli B str.
           REL606]
 gi|297516951|ref|ZP_06935337.1| gluconate periplasmic binding protein [Escherichia coli OP50]
 gi|300926896|ref|ZP_07142662.1| ComF family protein [Escherichia coli MS 182-1]
 gi|300931054|ref|ZP_07146410.1| ComF family protein [Escherichia coli MS 187-1]
 gi|309794684|ref|ZP_07689106.1| ComF family protein [Escherichia coli MS 145-7]
 gi|331670235|ref|ZP_08371074.1| protein GntX [Escherichia coli TA271]
 gi|157068570|gb|ABV07825.1| protein GntX [Escherichia coli HS]
 gi|190902053|gb|EDV61798.1| protein GntX [Escherichia coli B7A]
 gi|190902644|gb|EDV62376.1| protein GntX [Escherichia coli B7A]
 gi|209914130|dbj|BAG79204.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|218362730|emb|CAR00356.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli IAI1]
 gi|242378936|emb|CAQ33734.1| protein involved in utilization of DNA as a carbon source
           [Escherichia coli BL21(DE3)]
 gi|253975242|gb|ACT40913.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli B str. REL606]
 gi|253979398|gb|ACT45068.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli BL21(DE3)]
 gi|300417100|gb|EFK00411.1| ComF family protein [Escherichia coli MS 182-1]
 gi|300461109|gb|EFK24602.1| ComF family protein [Escherichia coli MS 187-1]
 gi|308121734|gb|EFO58996.1| ComF family protein [Escherichia coli MS 145-7]
 gi|323939367|gb|EGB35578.1| comF family protein [Escherichia coli E482]
 gi|323959587|gb|EGB55239.1| comF family protein [Escherichia coli H489]
 gi|324018650|gb|EGB87869.1| ComF family protein [Escherichia coli MS 117-3]
 gi|324116390|gb|EGC10309.1| comF family protein [Escherichia coli E1167]
 gi|331062297|gb|EGI34217.1| protein GntX [Escherichia coli TA271]
          Length = 227

 Score = 64.0 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|293406991|ref|ZP_06650915.1| gluconate periplasmic binding protein [Escherichia coli FVEC1412]
 gi|298382733|ref|ZP_06992328.1| gluconate periplasmic binding protein [Escherichia coli FVEC1302]
 gi|291425802|gb|EFE98836.1| gluconate periplasmic binding protein [Escherichia coli FVEC1412]
 gi|298276569|gb|EFI18087.1| gluconate periplasmic binding protein [Escherichia coli FVEC1302]
          Length = 215

 Score = 64.0 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|300985359|ref|ZP_07177415.1| ComF family protein [Escherichia coli MS 45-1]
 gi|300408100|gb|EFJ91638.1| ComF family protein [Escherichia coli MS 45-1]
          Length = 227

 Score = 64.0 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|170681819|ref|YP_001745661.1| gluconate periplasmic binding protein [Escherichia coli SMS-3-5]
 gi|170519537|gb|ACB17715.1| protein GntX [Escherichia coli SMS-3-5]
          Length = 227

 Score = 64.0 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|157158776|ref|YP_001464871.1| gluconate periplasmic binding protein [Escherichia coli E24377A]
 gi|157080806|gb|ABV20514.1| protein GntX [Escherichia coli E24377A]
          Length = 227

 Score = 64.0 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|161367506|ref|NP_289953.2| gluconate periplasmic binding protein [Escherichia coli O157:H7
           EDL933]
 gi|162139751|ref|NP_312282.2| gluconate periplasmic binding protein [Escherichia coli O157:H7
           str. Sakai]
 gi|195934902|ref|ZP_03080284.1| gluconate periplasmic binding protein [Escherichia coli O157:H7
           str. EC4024]
 gi|254795328|ref|YP_003080165.1| gluconate periplasmic binding protein [Escherichia coli O157:H7
           str. TW14359]
 gi|261224694|ref|ZP_05938975.1| gluconate periplasmic binding protein [Escherichia coli O157:H7
           str. FRIK2000]
 gi|261254411|ref|ZP_05946944.1| gluconate periplasmic binding protein [Escherichia coli O157:H7
           str. FRIK966]
 gi|291284749|ref|YP_003501567.1| gluconate periplasmic binding protein [Escherichia coli O55:H7 str.
           CB9615]
 gi|51701438|sp|Q8X715|GNTX_ECO57 RecName: Full=Protein GntX
 gi|254594728|gb|ACT74089.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli O157:H7 str. TW14359]
 gi|290764622|gb|ADD58583.1| gluconate periplasmic binding protein [Escherichia coli O55:H7 str.
           CB9615]
 gi|320645193|gb|EFX14209.1| DNA utilization protein GntX [Escherichia coli O157:H- str. 493-89]
 gi|320650504|gb|EFX18970.1| DNA utilization protein GntX [Escherichia coli O157:H- str. H 2687]
 gi|320655696|gb|EFX23619.1| DNA utilization protein GntX [Escherichia coli O55:H7 str. 3256-97
           TW 07815]
 gi|320661480|gb|EFX28895.1| DNA utilization protein GntX [Escherichia coli O55:H7 str. USDA
           5905]
 gi|320666503|gb|EFX33486.1| DNA utilization protein GntX [Escherichia coli O157:H7 str. LSU-61]
          Length = 227

 Score = 64.0 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|323179061|gb|EFZ64635.1| protein gntX [Escherichia coli 1180]
 gi|325498955|gb|EGC96814.1| gluconate periplasmic binding protein [Escherichia fergusonii
           ECD227]
 gi|332086008|gb|EGI91172.1| protein gntX [Shigella dysenteriae 155-74]
 gi|332751297|gb|EGJ81700.1| protein gntX [Shigella flexneri 2747-71]
 gi|332763600|gb|EGJ93839.1| comF family protein [Shigella flexneri 2930-71]
 gi|332996635|gb|EGK16260.1| protein gntX [Shigella flexneri K-272]
 gi|333012517|gb|EGK31898.1| protein gntX [Shigella flexneri K-304]
 gi|333013044|gb|EGK32420.1| protein gntX [Shigella flexneri K-227]
          Length = 215

 Score = 64.0 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|260424718|ref|ZP_05733052.2| ComF family protein [Dialister invisus DSM 15470]
 gi|260402941|gb|EEW96488.1| ComF family protein [Dialister invisus DSM 15470]
          Length = 149

 Score = 64.0 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 34/54 (62%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           MR  F+V +  S  V G KILL DD+YTTGAT + AA  L +AGA  V  +T +
Sbjct: 94  MRGVFHVNKGTS--VKGKKILLADDIYTTGATMESAAHELMRAGAEKVVGITIA 145


>gi|254429751|ref|ZP_05043458.1| hypothetical protein ADG881_2981 [Alcanivorax sp. DG881]
 gi|196195920|gb|EDX90879.1| hypothetical protein ADG881_2981 [Alcanivorax sp. DG881]
          Length = 248

 Score = 64.0 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 31/51 (60%)

Query: 8   PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
             +    V GL+++L+DDV TTG++A+ AA  L   GA  V + T +R+L 
Sbjct: 194 AFHCQHPVTGLRLILVDDVMTTGSSARAAAQCLLDHGAKDVRVWTLARTLP 244


>gi|99082742|ref|YP_614896.1| competence protein F, putative [Ruegeria sp. TM1040]
 gi|99039022|gb|ABF65634.1| competence protein F putative [Ruegeria sp. TM1040]
          Length = 243

 Score = 64.0 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 30/56 (53%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + +A      ++  + G ++LL+DDV T+G+T    A A   AGA + ++   +R 
Sbjct: 185 LSDAIRPNPRMASRLKGRRVLLVDDVMTSGSTLSACARACMDAGAKSTNVAVLARV 240


>gi|323974783|gb|EGB69895.1| comF family protein [Escherichia coli TW10509]
          Length = 215

 Score = 64.0 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|331685055|ref|ZP_08385641.1| protein GntX [Escherichia coli H299]
 gi|331077426|gb|EGI48638.1| protein GntX [Escherichia coli H299]
          Length = 227

 Score = 64.0 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|222035114|emb|CAP77859.1| Protein gntX [Escherichia coli LF82]
 gi|312947961|gb|ADR28788.1| gluconate periplasmic binding protein [Escherichia coli O83:H1 str.
           NRG 857C]
          Length = 227

 Score = 64.0 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|161486090|ref|NP_756054.2| gluconate periplasmic binding protein [Escherichia coli CFT073]
 gi|161984841|ref|YP_409717.2| gluconate periplasmic binding protein [Shigella boydii Sb227]
 gi|162138354|ref|YP_542874.2| gluconate periplasmic binding protein [Escherichia coli UTI89]
 gi|218560471|ref|YP_002393384.1| gluconate periplasmic binding protein [Escherichia coli S88]
 gi|218702158|ref|YP_002409787.1| gluconate periplasmic binding protein [Escherichia coli IAI39]
 gi|293416815|ref|ZP_06659452.1| gluconate periplasmic binding protein [Escherichia coli B185]
 gi|300937288|ref|ZP_07152131.1| ComF family protein [Escherichia coli MS 21-1]
 gi|301050375|ref|ZP_07197264.1| ComF family protein [Escherichia coli MS 185-1]
 gi|331659702|ref|ZP_08360640.1| protein GntX [Escherichia coli TA206]
 gi|51701423|sp|Q8FCT3|GNTX_ECOL6 RecName: Full=Protein GntX
 gi|218367240|emb|CAR05014.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli S88]
 gi|218372144|emb|CAR20006.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli IAI39]
 gi|291431391|gb|EFF04376.1| gluconate periplasmic binding protein [Escherichia coli B185]
 gi|294492334|gb|ADE91090.1| protein GntX [Escherichia coli IHE3034]
 gi|300298004|gb|EFJ54389.1| ComF family protein [Escherichia coli MS 185-1]
 gi|300457647|gb|EFK21140.1| ComF family protein [Escherichia coli MS 21-1]
 gi|307555499|gb|ADN48274.1| protein GntX [Escherichia coli ABU 83972]
 gi|307628475|gb|ADN72779.1| gluconate periplasmic binding protein [Escherichia coli UM146]
 gi|315286087|gb|EFU45525.1| ComF family protein [Escherichia coli MS 110-3]
 gi|315291746|gb|EFU51102.1| ComF family protein [Escherichia coli MS 153-1]
 gi|315295926|gb|EFU55235.1| ComF family protein [Escherichia coli MS 16-3]
 gi|323950070|gb|EGB45953.1| comF family protein [Escherichia coli H252]
 gi|323954650|gb|EGB50432.1| comF family protein [Escherichia coli H263]
 gi|324009391|gb|EGB78610.1| ComF family protein [Escherichia coli MS 57-2]
 gi|331052917|gb|EGI24950.1| protein GntX [Escherichia coli TA206]
 gi|332345366|gb|AEE58700.1| conserved hypothetical protein [Escherichia coli UMNK88]
          Length = 227

 Score = 64.0 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|146296670|ref|YP_001180441.1| phosphoribosyltransferase [Caldicellulosiruptor saccharolyticus DSM
           8903]
 gi|145410246|gb|ABP67250.1| phosphoribosyltransferase [Caldicellulosiruptor saccharolyticus DSM
           8903]
          Length = 232

 Score = 64.0 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           R AF   +     V G  +LL+DD++TTGATA   +  L K+GA  V +   +
Sbjct: 175 RIAFK--KGYENIVKGKTVLLVDDIFTTGATADECSKVLLKSGANKVYVSVLA 225


>gi|187733952|ref|YP_001882092.1| gluconate periplasmic binding protein [Shigella boydii CDC 3083-94]
 gi|187430944|gb|ACD10218.1| protein GntX [Shigella boydii CDC 3083-94]
          Length = 227

 Score = 64.0 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|168699233|ref|ZP_02731510.1| phosphoribosyltransferase [Gemmata obscuriglobus UQM 2246]
          Length = 244

 Score = 64.0 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           MR+ F V       VAG  +LL+DDV TTG+TA  AA AL+ AGA  V +   +R
Sbjct: 191 MRDVFRVRSSAR--VAGKAVLLVDDVMTTGSTASVAAKALRDAGAERVVVAVLAR 243


>gi|317494417|ref|ZP_07952831.1| comF family protein [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316917667|gb|EFV39012.1| comF family protein [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 227

 Score = 64.0 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +RNAF       ++ +G  ILL+DDV+TTG+T    +  L   GA ++ ++   R+L
Sbjct: 175 LRNAFT----CQQNPSGKHILLVDDVFTTGSTIGEVSRLLIAQGAKSIQVVCLCRTL 227


>gi|254436580|ref|ZP_05050074.1| hypothetical protein OA307_1450 [Octadecabacter antarcticus 307]
 gi|198252026|gb|EDY76340.1| hypothetical protein OA307_1450 [Octadecabacter antarcticus 307]
          Length = 239

 Score = 64.0 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 30/59 (50%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  A          +AG K+LLIDDV T+GAT   A      AGA  V +L  +R +K+
Sbjct: 180 LSGAIAANPKRMAQLAGRKVLLIDDVMTSGATFAAATEPCYGAGADDVCVLALARVVKN 238


>gi|89110597|ref|AP_004377.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli str. K-12 substr. W3110]
 gi|90111589|ref|NP_417872.2| protein required for the utilization of DNA as a carbon source
           [Escherichia coli str. K-12 substr. MG1655]
 gi|170082929|ref|YP_001732249.1| gluconate periplasmic binding protein [Escherichia coli str. K-12
           substr. DH10B]
 gi|238902504|ref|YP_002928300.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli BW2952]
 gi|253771758|ref|YP_003034589.1| gluconate periplasmic binding protein [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|256025859|ref|ZP_05439724.1| gluconate periplasmic binding protein [Escherichia sp. 4_1_40B]
 gi|300815388|ref|ZP_07095613.1| ComF family protein [Escherichia coli MS 107-1]
 gi|300946844|ref|ZP_07161085.1| ComF family protein [Escherichia coli MS 116-1]
 gi|300956743|ref|ZP_07169012.1| ComF family protein [Escherichia coli MS 175-1]
 gi|301023029|ref|ZP_07186839.1| ComF family protein [Escherichia coli MS 196-1]
 gi|307140099|ref|ZP_07499455.1| gluconate periplasmic binding protein [Escherichia coli H736]
 gi|6136739|sp|P46846|GNTX_ECOLI RecName: Full=Protein GntX
 gi|85676628|dbj|BAE77878.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli str. K12 substr. W3110]
 gi|87082263|gb|AAC76438.2| protein required for the utilization of DNA as a carbon source
           [Escherichia coli str. K-12 substr. MG1655]
 gi|169890764|gb|ACB04471.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli str. K-12 substr. DH10B]
 gi|238861309|gb|ACR63307.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli BW2952]
 gi|253322802|gb|ACT27404.1| comF family protein [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|260447568|gb|ACX37990.1| comF family protein [Escherichia coli DH1]
 gi|299880992|gb|EFI89203.1| ComF family protein [Escherichia coli MS 196-1]
 gi|300316463|gb|EFJ66247.1| ComF family protein [Escherichia coli MS 175-1]
 gi|300453499|gb|EFK17119.1| ComF family protein [Escherichia coli MS 116-1]
 gi|300532280|gb|EFK53342.1| ComF family protein [Escherichia coli MS 107-1]
 gi|309703823|emb|CBJ03164.1| putative competence protein [Escherichia coli ETEC H10407]
 gi|315137989|dbj|BAJ45148.1| GntX [Escherichia coli DH1]
 gi|315614681|gb|EFU95321.1| protein gntX [Escherichia coli 3431]
 gi|323934597|gb|EGB30997.1| comF family protein [Escherichia coli E1520]
          Length = 227

 Score = 64.0 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA  V +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAAAVQVWCLCRTL 227


>gi|193061813|ref|ZP_03042910.1| protein GntX [Escherichia coli E22]
 gi|194427043|ref|ZP_03059595.1| protein GntX [Escherichia coli B171]
 gi|260846197|ref|YP_003223975.1| gluconate periplasmic binding protein GntX [Escherichia coli
           O103:H2 str. 12009]
 gi|192932603|gb|EDV85200.1| protein GntX [Escherichia coli E22]
 gi|194415004|gb|EDX31274.1| protein GntX [Escherichia coli B171]
 gi|257761344|dbj|BAI32841.1| gluconate periplasmic binding protein GntX [Escherichia coli
           O103:H2 str. 12009]
          Length = 227

 Score = 64.0 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|170018351|ref|YP_001723305.1| gluconate periplasmic binding protein [Escherichia coli ATCC 8739]
 gi|169753279|gb|ACA75978.1| comF family protein [Escherichia coli ATCC 8739]
          Length = 227

 Score = 63.6 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|323182874|gb|EFZ68275.1| protein gntX [Escherichia coli 1357]
          Length = 215

 Score = 63.6 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|301329724|ref|ZP_07222467.1| ComF family protein [Escherichia coli MS 78-1]
 gi|312972323|ref|ZP_07786497.1| protein gntX [Escherichia coli 1827-70]
 gi|300844196|gb|EFK71956.1| ComF family protein [Escherichia coli MS 78-1]
 gi|310334700|gb|EFQ00905.1| protein gntX [Escherichia coli 1827-70]
 gi|323164977|gb|EFZ50768.1| protein gntX [Shigella sonnei 53G]
 gi|323970011|gb|EGB65286.1| comF family protein [Escherichia coli TA007]
          Length = 215

 Score = 63.6 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|134300912|ref|YP_001114408.1| phosphoribosyltransferase [Desulfotomaculum reducens MI-1]
 gi|134053612|gb|ABO51583.1| phosphoribosyltransferase [Desulfotomaculum reducens MI-1]
          Length = 237

 Score = 63.6 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF+V     + + G  IL++DDV+TTG+T    A  L K GA  + ++T + + K
Sbjct: 182 LRGAFDVN--TPEAIKGKAILIVDDVFTTGSTMAEVAETLHKKGAGKLYVITLANAGK 237


>gi|257465154|ref|ZP_05629525.1| competence protein F [Actinobacillus minor 202]
 gi|257450814|gb|EEV24857.1| competence protein F [Actinobacillus minor 202]
          Length = 229

 Score = 63.6 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 28/56 (50%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF             +I +IDDV TTG+T     + LKKAG   V + T +R+
Sbjct: 174 LKGAFRYQPQRQAGKFYQRIAIIDDVVTTGSTLNTICLELKKAGVKEVQVWTLARA 229


>gi|240949768|ref|ZP_04754100.1| competence protein F [Actinobacillus minor NM305]
 gi|240295800|gb|EER46487.1| competence protein F [Actinobacillus minor NM305]
          Length = 229

 Score = 63.6 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 28/56 (50%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF             +I +IDDV TTG+T     + LKKAG   V + T +R+
Sbjct: 174 LKGAFRYQPQRQAGKFYQRIAIIDDVVTTGSTLNTICLELKKAGVKEVQVWTLARA 229


>gi|189401819|ref|ZP_02778173.2| protein GntX [Escherichia coli O157:H7 str. EC4401]
 gi|189405505|ref|ZP_02822191.2| protein GntX [Escherichia coli O157:H7 str. EC508]
 gi|189358967|gb|EDU77386.1| protein GntX [Escherichia coli O157:H7 str. EC4401]
 gi|189380059|gb|EDU98475.1| protein GntX [Escherichia coli O157:H7 str. EC508]
 gi|320191575|gb|EFW66225.1| gluconate periplasmic binding protein [Escherichia coli O157:H7
           str. EC1212]
 gi|326337623|gb|EGD61458.1| gluconate periplasmic binding protein [Escherichia coli O157:H7
           str. 1044]
 gi|326344626|gb|EGD68375.1| gluconate periplasmic binding protein [Escherichia coli O157:H7
           str. 1125]
          Length = 215

 Score = 63.6 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|315651636|ref|ZP_07904647.1| competence protein F [Eubacterium saburreum DSM 3986]
 gi|315486090|gb|EFU76461.1| competence protein F [Eubacterium saburreum DSM 3986]
          Length = 247

 Score = 63.6 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 31/54 (57%), Gaps = 3/54 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           + NAF V +  SK V    +L++DDVYTTG T +  A  LK AGA  V  LT  
Sbjct: 192 LDNAFVV-KGFSKEV--KNVLIVDDVYTTGTTIEKCAKILKDAGANEVYFLTIC 242


>gi|288933202|ref|YP_003437261.1| phosphoribosyltransferase [Klebsiella variicola At-22]
 gi|288887931|gb|ADC56249.1| phosphoribosyltransferase [Klebsiella variicola At-22]
          Length = 224

 Score = 63.6 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL I ++DDV TTG+T    +  L + GA TV +    R+L
Sbjct: 172 LKNAFQLEFA----VEGLHIAIVDDVVTTGSTVAEISRLLLRNGAATVQVWCLCRTL 224


>gi|73540017|ref|YP_294537.1| putative amidophosphoribosyltransferase [Ralstonia eutropha JMP134]
 gi|72117430|gb|AAZ59693.1| putative amidophosphoribosyltransferases [Ralstonia eutropha
           JMP134]
          Length = 222

 Score = 63.6 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF + +     +AG+ + L+DDV TTGAT   AA  LK  GA  VS++   R+ 
Sbjct: 168 VRGAFRISRSRP--LAGMHVGLVDDVMTTGATLDEAARTLKAHGAARVSVIVALRTP 222


>gi|88606693|ref|YP_505817.1| comF family protein [Anaplasma phagocytophilum HZ]
 gi|88597756|gb|ABD43226.1| comF family protein [Anaplasma phagocytophilum HZ]
          Length = 217

 Score = 63.6 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           + N+F V   V     G  ++LIDDV TTGA+ +  A  LK +GA  V  LT +R++ 
Sbjct: 162 VWNSFKVTNSVL--FRGKVVVLIDDVVTTGASLQECARVLKNSGAKEVLGLTLARTMS 217


>gi|290512006|ref|ZP_06551374.1| gluconate periplasmic binding protein [Klebsiella sp. 1_1_55]
 gi|289775796|gb|EFD83796.1| gluconate periplasmic binding protein [Klebsiella sp. 1_1_55]
          Length = 224

 Score = 63.6 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL I ++DDV TTG+T    +  L + GA TV +    R+L
Sbjct: 172 LKNAFQLEFA----VEGLHIAIVDDVVTTGSTVAEISRLLLRNGAATVQVWCLCRTL 224


>gi|73666726|ref|YP_302742.1| competence protein F [Ehrlichia canis str. Jake]
 gi|72393867|gb|AAZ68144.1| competence protein F [Ehrlichia canis str. Jake]
          Length = 230

 Score = 63.6 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           AF V       +    ILL+DDV TTG TA+     L +AGA  V ++T +R+L
Sbjct: 179 AFIVKNQHL--ITNKTILLVDDVITTGITARTCTNKLIEAGAKEVRVITLARTL 230


>gi|304397830|ref|ZP_07379706.1| phosphoribosyltransferase [Pantoea sp. aB]
 gi|304354541|gb|EFM18912.1| phosphoribosyltransferase [Pantoea sp. aB]
          Length = 226

 Score = 63.6 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF +       V G  I L+DDV TTG+T    +  L   GA +V +    R+L
Sbjct: 174 LRGAFRL----EMAVQGRHIALLDDVITTGSTVDEISRLLLAQGAASVQVWCLCRTL 226


>gi|227883547|ref|ZP_04001352.1| competence protein F [Escherichia coli 83972]
 gi|227839426|gb|EEJ49892.1| competence protein F [Escherichia coli 83972]
 gi|320185944|gb|EFW60693.1| gluconate periplasmic binding protein [Shigella flexneri CDC
           796-83]
 gi|332090224|gb|EGI95322.1| protein gntX [Shigella boydii 3594-74]
          Length = 215

 Score = 63.6 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|21241163|ref|NP_640745.1| competence protein F [Xanthomonas axonopodis pv. citri str. 306]
 gi|21106468|gb|AAM35281.1| competence protein F [Xanthomonas axonopodis pv. citri str. 306]
          Length = 243

 Score = 63.6 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 25/57 (43%), Positives = 31/57 (54%), Gaps = 5/57 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R+AF V   +  HVA     L+DDV TTGAT   AA AL+KAG   V     +R  
Sbjct: 192 LRDAFEVRGALPAHVA-----LVDDVMTTGATLHAAAKALRKAGVQRVDAWVCARVP 243


>gi|329118732|ref|ZP_08247432.1| competence protein F [Neisseria bacilliformis ATCC BAA-1200]
 gi|327465167|gb|EGF11452.1| competence protein F [Neisseria bacilliformis ATCC BAA-1200]
          Length = 205

 Score = 63.6 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 29/55 (52%), Gaps = 4/55 (7%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           R  F V   V K      +LLIDDV TT AT    A +LK+AGA  V   T +++
Sbjct: 150 RGLFEVRGGVKK----RNLLLIDDVATTNATLAELARSLKRAGAARVCCWTLAQA 200


>gi|301645853|ref|ZP_07245767.1| ComF family protein [Escherichia coli MS 146-1]
 gi|301075842|gb|EFK90648.1| ComF family protein [Escherichia coli MS 146-1]
          Length = 215

 Score = 63.6 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA  V +    R+L
Sbjct: 163 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAAAVQVWCLCRTL 215


>gi|320639695|gb|EFX09289.1| DNA utilization protein GntX [Escherichia coli O157:H7 str. G5101]
          Length = 227

 Score = 63.6 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELAVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|323162798|gb|EFZ48635.1| protein gntX [Escherichia coli E128010]
 gi|323944365|gb|EGB40440.1| comF family protein [Escherichia coli H120]
          Length = 215

 Score = 63.6 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|320530105|ref|ZP_08031175.1| ComF family protein [Selenomonas artemidis F0399]
 gi|320137538|gb|EFW29450.1| ComF family protein [Selenomonas artemidis F0399]
          Length = 172

 Score = 63.2 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
            AF         +AG  ILL+DD+ TTG T    A  LK+AGA  +  L  +
Sbjct: 119 GAFVCANG--AQIAGRHILLLDDIMTTGTTLLECARTLKRAGAENIYALVLA 168


>gi|255037442|ref|YP_003088063.1| amidophosphoribosyl-transferase [Dyadobacter fermentans DSM 18053]
 gi|254950198|gb|ACT94898.1| amidophosphoribosyl-transferase [Dyadobacter fermentans DSM 18053]
          Length = 230

 Score = 63.2 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 4/54 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++  F+V    S       ++LIDDV TTGAT +  A  L  AG     ILT +
Sbjct: 177 VQGVFSVKPGFSPQ----SVILIDDVLTTGATLEECARTLLAAGCKQFHILTIA 226


>gi|212711653|ref|ZP_03319781.1| hypothetical protein PROVALCAL_02728 [Providencia alcalifaciens DSM
           30120]
 gi|212685755|gb|EEB45283.1| hypothetical protein PROVALCAL_02728 [Providencia alcalifaciens DSM
           30120]
          Length = 227

 Score = 63.2 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 25/57 (43%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF +       V+GL I +IDDV TTGAT   AA  L  AGA TV   +  R+L
Sbjct: 175 LKKAFAL----ETSVSGLHIAIIDDVITTGATMHAAAQLLICAGAHTVDAWSLCRTL 227


>gi|330838209|ref|YP_004412789.1| phosphoribosyltransferase [Selenomonas sputigena ATCC 35185]
 gi|329745973|gb|AEB99329.1| phosphoribosyltransferase [Selenomonas sputigena ATCC 35185]
          Length = 229

 Score = 63.2 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 33/57 (57%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSK---HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +R AF++ +        +AG  I+L+DD+ TTGAT    A  LKKAGA +V  L  +
Sbjct: 169 VRGAFSLSEAGKGGAGEIAGKSIVLLDDILTTGATLTSCAAVLKKAGAGSVYALALA 225


>gi|291549967|emb|CBL26229.1| Predicted amidophosphoribosyltransferases [Ruminococcus torques
           L2-14]
          Length = 224

 Score = 63.2 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 32/54 (59%), Gaps = 3/54 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF V +  +       ILLIDD+YTTG+T + AA  LKKAG   V  LT S
Sbjct: 169 LKGAFAVSKSWNPR---QNILLIDDIYTTGSTIERAAGILKKAGVENVYFLTLS 219


>gi|110639861|ref|YP_680071.1| amidophosphoribosyltransferase [Cytophaga hutchinsonii ATCC 33406]
 gi|110282542|gb|ABG60728.1| amidophosphoribosyltransferase [Cytophaga hutchinsonii ATCC 33406]
          Length = 236

 Score = 63.2 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 21/44 (47%), Positives = 27/44 (61%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + VAG  ILL+DDV TTGAT +   + LK AGA  VS+   +  
Sbjct: 191 EKVAGKHILLVDDVLTTGATLEACGLLLKNAGAAKVSVALLAMV 234


>gi|332533245|ref|ZP_08409112.1| competence protein F [Pseudoalteromonas haloplanktis ANT/505]
 gi|332037324|gb|EGI73779.1| competence protein F [Pseudoalteromonas haloplanktis ANT/505]
          Length = 225

 Score = 63.2 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 4/52 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
           ++NAF      ++ + G  + ++DDV TTGAT   A  ALK+AGA  V   T
Sbjct: 172 LKNAF----ICTQDMGGKTVAIVDDVMTTGATLNAATSALKQAGAKQVWAFT 219


>gi|149197780|ref|ZP_01874829.1| predicted amidophosphoribosyltransferase [Lentisphaera araneosa
           HTCC2155]
 gi|149139001|gb|EDM27405.1| predicted amidophosphoribosyltransferase [Lentisphaera araneosa
           HTCC2155]
          Length = 227

 Score = 63.2 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +++ F         +    ILLIDD+ TTGAT      AL++     +S+LT +R
Sbjct: 174 VKDLF--SPKNRDKIKDRSILLIDDILTTGATLNACCKALQQEKPKEISVLTIAR 226


>gi|254446148|ref|ZP_05059624.1| hypothetical protein VDG1235_4397 [Verrucomicrobiae bacterium
           DG1235]
 gi|198260456|gb|EDY84764.1| hypothetical protein VDG1235_4397 [Verrucomicrobiae bacterium
           DG1235]
          Length = 174

 Score = 63.2 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           ++NAF++ Q  +   A   I ++DDV+TTG+T    A AL+++GA  + +LT 
Sbjct: 120 LKNAFSLRQNRAIDPAQRYI-IVDDVFTTGSTVNACAAALRRSGARQIDVLTV 171


>gi|86136799|ref|ZP_01055377.1| competence protein F, putative [Roseobacter sp. MED193]
 gi|85826123|gb|EAQ46320.1| competence protein F, putative [Roseobacter sp. MED193]
          Length = 242

 Score = 63.2 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 28/58 (48%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +  A          + G  +LL+DDV T+GAT    A A ++AGA  V +   +R  +
Sbjct: 184 LSRAIVAHPRHRALMQGRVVLLVDDVMTSGATLTACADACREAGAADVRVAVLARVTR 241


>gi|150397708|ref|YP_001328175.1| phosphoribosyltransferase [Sinorhizobium medicae WSM419]
 gi|150029223|gb|ABR61340.1| phosphoribosyltransferase [Sinorhizobium medicae WSM419]
          Length = 258

 Score = 63.2 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 45/58 (77%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF+VP+ + + VAG +I+L+DDVYTTGAT   AA ALK+AGA  V++LTF+ ++ 
Sbjct: 198 VRGAFSVPEGLRREVAGKRIVLVDDVYTTGATVTAAARALKRAGAGDVTVLTFAMAVS 255


>gi|84514889|ref|ZP_01002252.1| competence protein F, putative [Loktanella vestfoldensis SKA53]
 gi|84511048|gb|EAQ07502.1| competence protein F, putative [Loktanella vestfoldensis SKA53]
          Length = 241

 Score = 63.2 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 28/50 (56%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
                + G  +LL+DDV T+GAT      AL   GA+ VS +T +R +KD
Sbjct: 191 RQQAQITGKPVLLVDDVMTSGATLAACTQALLDGGAVRVSTITLARVVKD 240


>gi|124268368|ref|YP_001022372.1| putative phosphoribosyl transferase [Methylibium petroleiphilum
           PM1]
 gi|124261143|gb|ABM96137.1| putative phosphoribosyl transferase [Methylibium petroleiphilum
           PM1]
          Length = 230

 Score = 63.2 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 27/57 (47%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF V       +    + L DDV TTGATA      L  AGA +V +   +R+ 
Sbjct: 173 LRGAFAVEPLALAALRDRHVALADDVMTTGATAAELTRVLYAAGAASVQVWVVARTP 229


>gi|313896725|ref|ZP_07830273.1| comF family protein [Selenomonas sp. oral taxon 137 str. F0430]
 gi|312974642|gb|EFR40109.1| comF family protein [Selenomonas sp. oral taxon 137 str. F0430]
          Length = 216

 Score = 62.8 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
            AF         +AG  ILL+DD+ TTG T    A  LK+AGA  +  L  +
Sbjct: 163 GAFVCANG--AQIAGRHILLLDDIMTTGTTLLECARTLKRAGAENIYALVLA 212


>gi|269797854|ref|YP_003311754.1| amidophosphoribosyltransferase-like protein [Veillonella parvula
           DSM 2008]
 gi|269094483|gb|ACZ24474.1| amidophosphoribosyltransferase-like protein [Veillonella parvula
           DSM 2008]
          Length = 231

 Score = 62.8 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 3   NAFNVPQYVSK-HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +AF +        +    IL++DD+YTTGAT +  A  L+K  A+ V  LT +
Sbjct: 175 DAFVIRADYKDIDLTNKNILIVDDIYTTGATIEAVAKVLQKHNALRVDALTLA 227


>gi|146337714|ref|YP_001202762.1| putative competence protein F (COMF) [Bradyrhizobium sp. ORS278]
 gi|146190520|emb|CAL74519.1| putative competence protein F (COMF) [Bradyrhizobium sp. ORS278]
          Length = 267

 Score = 62.8 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 34/57 (59%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF V       V G +++++DDV TTGAT    A AL +A A  VS+L F+R +
Sbjct: 204 VQGAFQVSSDRLHDVQGRRVVIVDDVLTTGATVDACARALLRAKAAEVSVLVFARVV 260


>gi|119899106|ref|YP_934319.1| putative competence protein F [Azoarcus sp. BH72]
 gi|119671519|emb|CAL95432.1| putative competence protein F [Azoarcus sp. BH72]
          Length = 230

 Score = 62.8 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF+     +  + G ++L++DDV TTGAT   AA  LK+ GA  V  L  +R+  
Sbjct: 175 VRGAFD----SATDLRGRRVLVLDDVMTTGATLGEAARILKRRGAERVDNLVIARTPP 228


>gi|294667204|ref|ZP_06732425.1| competence protein [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
 gi|292602985|gb|EFF46415.1| competence protein [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
          Length = 241

 Score = 62.8 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 25/57 (43%), Positives = 31/57 (54%), Gaps = 5/57 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R+AF V   +  HVA     L+DDV TTGAT   AA AL+KAG   V     +R  
Sbjct: 190 LRDAFEVRGALPAHVA-----LVDDVMTTGATLHAAAKALRKAGVQRVDAWVCARVP 241


>gi|260888482|ref|ZP_05899745.1| competence protein F [Selenomonas sputigena ATCC 35185]
 gi|260861679|gb|EEX76179.1| competence protein F [Selenomonas sputigena ATCC 35185]
          Length = 185

 Score = 62.8 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 33/57 (57%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSK---HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +R AF++ +        +AG  I+L+DD+ TTGAT    A  LKKAGA +V  L  +
Sbjct: 125 VRGAFSLSEAGKGGAGEIAGKSIVLLDDILTTGATLTSCAAVLKKAGAGSVYALALA 181


>gi|331701708|ref|YP_004398667.1| phosphoribosyltransferase [Lactobacillus buchneri NRRL B-30929]
 gi|329129051|gb|AEB73604.1| phosphoribosyltransferase [Lactobacillus buchneri NRRL B-30929]
          Length = 230

 Score = 62.8 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 30/51 (58%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           F + +     V    +LL+DDVYTTG T + AA  +++AGA +V   T +R
Sbjct: 180 FEMIESQKNQVKNRAVLLVDDVYTTGTTIRHAAALIQQAGAASVKGFTLAR 230


>gi|206579882|ref|YP_002236214.1| protein GntX [Klebsiella pneumoniae 342]
 gi|206568940|gb|ACI10716.1| protein GntX [Klebsiella pneumoniae 342]
          Length = 224

 Score = 62.8 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL I ++DDV TTG+T    +  L + GA TV +    R+L
Sbjct: 172 LKNAFQLEFA----VQGLHIAIVDDVVTTGSTVAEISRLLLRNGAATVQVWCLCRTL 224


>gi|294627596|ref|ZP_06706179.1| competence protein [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 11122]
 gi|292598227|gb|EFF42381.1| competence protein [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 11122]
          Length = 241

 Score = 62.8 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 25/57 (43%), Positives = 31/57 (54%), Gaps = 5/57 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R+AF V   +  HVA     L+DDV TTGAT   AA AL+KAG   V     +R  
Sbjct: 190 LRDAFEVRGALPAHVA-----LVDDVMTTGATLHAAAKALRKAGVQRVDAWVCARVP 241


>gi|114332104|ref|YP_748326.1| hypothetical protein Neut_2139 [Nitrosomonas eutropha C91]
 gi|114309118|gb|ABI60361.1| conserved hypothetical protein [Nitrosomonas eutropha C91]
          Length = 236

 Score = 62.8 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +RNAF      ++H +G ++ ++DDV T+GAT    A  + + GA +V     +R+  
Sbjct: 182 VRNAF----ICTQHFSGKQVAIVDDVMTSGATLNELARVILRQGAGSVRAWVVARAFP 235


>gi|238896880|ref|YP_002921625.1| putative periplasmic gluconate-binding protein in GNT I transport
           system [Klebsiella pneumoniae NTUH-K2044]
 gi|238549207|dbj|BAH65558.1| putative periplasmic gluconate-binding protein in GNT I transport
           system [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
          Length = 224

 Score = 62.8 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL I L+DDV TTG+T    +  L + GA TV +    R+L
Sbjct: 172 LKNAFQLEFA----VQGLHIALVDDVVTTGSTVAEISRLLLRNGAATVQVWCLCRTL 224


>gi|188535340|ref|YP_001909137.1| Predicted amidophosphoribosyltransferase GntX [Erwinia tasmaniensis
           Et1/99]
 gi|188030382|emb|CAO98273.1| Predicted amidophosphoribosyltransferase GntX [Erwinia tasmaniensis
           Et1/99]
          Length = 237

 Score = 62.8 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF +       V G  I+L+DDV TTG+TA   +  L  +GA +V I    R+L
Sbjct: 185 LRGAFRL----ETAVRGYHIVLLDDVLTTGSTAAEISRILLASGAASVEIWCLCRTL 237


>gi|325981843|ref|YP_004294245.1| phosphoribosyltransferase [Nitrosomonas sp. AL212]
 gi|325531362|gb|ADZ26083.1| phosphoribosyltransferase [Nitrosomonas sp. AL212]
          Length = 228

 Score = 62.8 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 34/59 (57%), Gaps = 4/59 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R+AF+     +  ++G  + L+DDV TTGAT    A  L+K G + +S    +R+L +
Sbjct: 165 IRSAFD----CTIDLSGKHVALVDDVMTTGATLNEVAKTLRKRGVIEISNWIIARALSE 219


>gi|299132843|ref|ZP_07026038.1| phosphoribosyltransferase [Afipia sp. 1NLS2]
 gi|298592980|gb|EFI53180.1| phosphoribosyltransferase [Afipia sp. 1NLS2]
          Length = 266

 Score = 62.8 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 34/57 (59%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           M+ AF V       VAG  ++L+DDV T+GAT    A AL +A A +V +L F+R +
Sbjct: 203 MQGAFAVGDDQRASVAGRHLILVDDVLTSGATVDACARALLRAKAASVDVLVFARVV 259


>gi|270264448|ref|ZP_06192714.1| gluconate periplasmic binding protein [Serratia odorifera 4Rx13]
 gi|270041584|gb|EFA14682.1| gluconate periplasmic binding protein [Serratia odorifera 4Rx13]
          Length = 227

 Score = 62.8 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF       + +AG  + L+DDV TTG+T       L + GA ++ I    R+L
Sbjct: 175 LRGAFR----CHEPLAGRHVALLDDVVTTGSTVAEITRLLLRQGAASIQIWCVCRTL 227


>gi|304438488|ref|ZP_07398428.1| competence protein F [Selenomonas sp. oral taxon 149 str. 67H29BP]
 gi|304368571|gb|EFM22256.1| competence protein F [Selenomonas sp. oral taxon 149 str. 67H29BP]
          Length = 220

 Score = 62.8 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +R+AF +       V G  +LL+DD+ TTGAT    A  L+  GA  V  +  +
Sbjct: 165 LRSAFALVHG--ADVQGKDLLLVDDIMTTGATLTECAHVLRHGGARRVYAIALA 216


>gi|89100614|ref|ZP_01173472.1| late competence protein [Bacillus sp. NRRL B-14911]
 gi|89084638|gb|EAR63781.1| late competence protein [Bacillus sp. NRRL B-14911]
          Length = 239

 Score = 62.8 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/46 (45%), Positives = 30/46 (65%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
             S  +    +LLIDD+YTTG+T + AA+ LK+AGA  +  LT +R
Sbjct: 193 STSAAIEAKNLLLIDDIYTTGSTLRHAALPLKQAGAANIMSLTLAR 238


>gi|284040351|ref|YP_003390281.1| phosphoribosyltransferase [Spirosoma linguale DSM 74]
 gi|283819644|gb|ADB41482.1| phosphoribosyltransferase [Spirosoma linguale DSM 74]
          Length = 239

 Score = 62.4 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++  F+V       V G  I+L+DDV TTGAT +  A+ L K+G  +V  +T + + +
Sbjct: 184 VKTVFSVQDA--SEVNGKHIVLVDDVLTTGATLEACAVELLKSGCKSVGFITLAAANR 239


>gi|299821877|ref|ZP_07053765.1| competence protein F [Listeria grayi DSM 20601]
 gi|299817542|gb|EFI84778.1| competence protein F [Listeria grayi DSM 20601]
          Length = 222

 Score = 62.4 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/43 (48%), Positives = 26/43 (60%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
             + G  ILL+DDVYTTGAT  CAA  L + GA  +  +T  R
Sbjct: 180 ATIDGKTILLVDDVYTTGATLHCAAELLHEHGAKQIEAITIFR 222


>gi|313673556|ref|YP_004051667.1| phosphoribosyltransferase [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312940312|gb|ADR19504.1| phosphoribosyltransferase [Calditerrivibrio nitroreducens DSM
           19672]
          Length = 221

 Score = 62.4 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +  AF       K +  LKILL+DD+ TTGAT    A  LK AGA  V     S+ L
Sbjct: 168 VSEAFT----PKKELFDLKILLVDDIITTGATLNECAKMLKGAGARKVDCYVLSKGL 220


>gi|54295172|ref|YP_127587.1| hypothetical protein lpl2252 [Legionella pneumophila str. Lens]
 gi|53755004|emb|CAH16492.1| hypothetical protein lpl2252 [Legionella pneumophila str. Lens]
          Length = 234

 Score = 62.4 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 5/57 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R+AF VP     HV    ++++DD+ TTG+TA   A  LK AG   V I   +R++
Sbjct: 180 LRHAFYVP-----HVTYEHVMIVDDLLTTGSTANEMAHTLKNAGVKRVDICCCARAV 231


>gi|24213204|ref|NP_710685.1| ComFC-like protein [Leptospira interrogans serovar Lai str. 56601]
 gi|24193923|gb|AAN47703.1| ComFC-like protein [Leptospira interrogans serovar Lai str. 56601]
          Length = 251

 Score = 62.4 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           R AF + +   + + G   LLIDDV+TTGA+A   A  L + GA +V ILT  R+
Sbjct: 184 RLAFKIKKEYKEKLKG-NYLLIDDVFTTGASANELARILIQNGADSVRILTLIRT 237


>gi|90422044|ref|YP_530414.1| phosphoribosyltransferase [Rhodopseudomonas palustris BisB18]
 gi|90104058|gb|ABD86095.1| phosphoribosyltransferase [Rhodopseudomonas palustris BisB18]
          Length = 269

 Score = 62.4 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF VP      V G +I+L+DDV T+GAT    A AL +A A +V +L F+R +
Sbjct: 206 VQGAFRVPSENKATVQGRRIVLVDDVLTSGATVDACARALLRARAASVDVLVFARVV 262


>gi|300692667|ref|YP_003753662.1| amidophosphoribosyltransferase, comF/gntX family [Ralstonia
           solanacearum PSI07]
 gi|299079727|emb|CBJ52403.1| putative amidophosphoribosyltransferase, comF/gntX family
           [Ralstonia solanacearum PSI07]
          Length = 240

 Score = 62.4 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF+VP      +AG  + ++DDV TTGAT    A  LK+AGA  V+     R+ 
Sbjct: 186 LQGAFDVPD--PARIAGRHVGVVDDVMTTGATLSEIATQLKRAGAARVTNCVALRTP 240


>gi|15616187|ref|NP_244492.1| late competence protein required for DNA uptake [Bacillus
           halodurans C-125]
 gi|10176249|dbj|BAB07344.1| late competence protein required for DNA uptake [Bacillus
           halodurans C-125]
          Length = 177

 Score = 62.4 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/47 (44%), Positives = 30/47 (63%)

Query: 9   QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +  ++ V G  I+L+DDVYTTGAT + AA  L+  GA  V  +T +R
Sbjct: 131 KGEAEAVEGRSIVLVDDVYTTGATIRQAATVLQAHGAARVRSMTIAR 177


>gi|300718786|ref|YP_003743589.1| gluconate periplasmic binding protein [Erwinia billingiae Eb661]
 gi|299064622|emb|CAX61742.1| Gluconate periplasmic binding protein [Erwinia billingiae Eb661]
          Length = 231

 Score = 62.4 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF V       V GL I L DDV TTG+T    +  L  AGA +V + +  R+L
Sbjct: 179 LRGAFRV----EIAVKGLHIALTDDVVTTGSTVGEISRILLAAGAASVQVWSLCRTL 231


>gi|157372865|ref|YP_001480854.1| gluconate periplasmic binding protein [Serratia proteamaculans 568]
 gi|157324629|gb|ABV43726.1| putative competence-related protein F [Serratia proteamaculans 568]
          Length = 227

 Score = 62.4 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF       + + G  I L+DDV TTG+T    A  L++ G  ++ I    R+L
Sbjct: 175 LRGAFR----CHESLEGRHIALLDDVVTTGSTVAEIARLLQRQGVASIQIWCVCRTL 227


>gi|298242607|ref|ZP_06966414.1| amidophosphoribosyltransferase [Ktedonobacter racemifer DSM 44963]
 gi|297555661|gb|EFH89525.1| amidophosphoribosyltransferase [Ktedonobacter racemifer DSM 44963]
          Length = 194

 Score = 62.4 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 25/57 (43%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 1   MRNAF-NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           M  AF  V    +  VA  KIL+IDDV TTGAT    A  L  AGA +V+ L  + +
Sbjct: 134 MMGAFLYVSTAATPGVANRKILIIDDVCTTGATLDACARPLFAAGARSVTGLVLASA 190


>gi|307611175|emb|CBX00819.1| hypothetical protein LPW_25231 [Legionella pneumophila 130b]
          Length = 234

 Score = 62.4 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 5/57 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R+AF VP      V    ++++DD+ TTG+TA   A  LK AG   V I   +R++
Sbjct: 180 LRHAFYVPP-----VTYEHVMIVDDLLTTGSTANEMAHTLKNAGVKRVDICCCARAV 231


>gi|54298222|ref|YP_124591.1| hypothetical protein lpp2280 [Legionella pneumophila str. Paris]
 gi|53752007|emb|CAH13433.1| hypothetical protein lpp2280 [Legionella pneumophila str. Paris]
          Length = 234

 Score = 62.4 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 5/57 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R+AF VP      V    ++++DD+ TTG+TA   A  LK AG   V I   +R++
Sbjct: 180 LRHAFYVPP-----VTYEHVMIVDDLLTTGSTANEIAHTLKNAGVKRVDICCCARAV 231


>gi|157693946|ref|YP_001488408.1| competence protein FC [Bacillus pumilus SAFR-032]
 gi|157682704|gb|ABV63848.1| competence protein FC [Bacillus pumilus SAFR-032]
          Length = 228

 Score = 62.4 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  F +    +  +    I+LIDD+YTTGAT   AA  LK+AGA +VS  T  RS
Sbjct: 176 KGMFQI--KQTDAIIQRDIILIDDIYTTGATIYDAARILKEAGAKSVSSFTLIRS 228


>gi|16762777|ref|NP_458394.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29144264|ref|NP_807606.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56415425|ref|YP_152500.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197364355|ref|YP_002143992.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|213161412|ref|ZP_03347122.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213420970|ref|ZP_03354036.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E01-6750]
 gi|213426879|ref|ZP_03359629.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213647817|ref|ZP_03377870.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|289824842|ref|ZP_06544285.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|51701439|sp|Q8Z222|GNTX_SALTI RecName: Full=Protein GntX
 gi|25321978|pir||AD0997 probable competence protein STY4286 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16505083|emb|CAD08104.1| putative competence protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29139901|gb|AAO71466.1| putative competence protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56129682|gb|AAV79188.1| putative competence protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197095832|emb|CAR61405.1| putative competence protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 227

 Score = 62.4 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|308188427|ref|YP_003932558.1| amidophosphoribosyltransferase [Pantoea vagans C9-1]
 gi|308058937|gb|ADO11109.1| Putative amidophosphoribosyltransferase [Pantoea vagans C9-1]
          Length = 226

 Score = 62.4 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF +       V G  I L+DDV TTG+T    +  L   GA +V +    R+L
Sbjct: 174 LRGAFRL----EMAVQGRHIALLDDVITTGSTVDEISRLLLAQGAASVQVWCLCRTL 226


>gi|168465219|ref|ZP_02699111.1| protein GntX [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|195632168|gb|EDX50652.1| protein GntX [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
          Length = 227

 Score = 62.1 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|332085564|gb|EGI90730.1| protein gntX [Shigella boydii 5216-82]
          Length = 227

 Score = 62.1 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV +TG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVSTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|194445852|ref|YP_002042762.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194404515|gb|ACF64737.1| protein GntX [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
          Length = 227

 Score = 62.1 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|262045249|ref|ZP_06018275.1| GNTI system gluconate periplasmic binding protein with
           phosphoribosyltransferase domain [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
 gi|259037459|gb|EEW38704.1| GNTI system gluconate periplasmic binding protein with
           phosphoribosyltransferase domain [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
          Length = 212

 Score = 62.1 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL I L+DDV TTG+T    +  L + GA TV +    R+L
Sbjct: 160 LKNAFQLEFA----VQGLHIALVDDVVTTGSTVAEISRLLLRNGAATVQVWCLCRTL 212


>gi|212640411|ref|YP_002316931.1| competence protein FC [Anoxybacillus flavithermus WK1]
 gi|212561891|gb|ACJ34946.1| Competence protein FC [Anoxybacillus flavithermus WK1]
          Length = 222

 Score = 62.1 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/44 (47%), Positives = 28/44 (63%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + VAG +I+++DD+YTTGAT   AA  L  AGA  +   T  RS
Sbjct: 179 EDVAGKRIVIVDDIYTTGATVHEAAKLLHDAGAQEICSFTLVRS 222


>gi|330012477|ref|ZP_08307391.1| comF family protein [Klebsiella sp. MS 92-3]
 gi|328533828|gb|EGF60507.1| comF family protein [Klebsiella sp. MS 92-3]
          Length = 212

 Score = 62.1 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL I L+DDV TTG+T    +  L + GA TV +    R+L
Sbjct: 160 LKNAFQLEFA----VQGLHIALVDDVVTTGSTVAEISRLLLRNGAATVQVWCLCRTL 212


>gi|224585305|ref|YP_002639104.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|224469833|gb|ACN47663.1| putative competence protein [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
          Length = 215

 Score = 62.1 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|262273565|ref|ZP_06051379.1| predicted amidophosphoribosyltransferase [Grimontia hollisae CIP
           101886]
 gi|262222543|gb|EEY73854.1| predicted amidophosphoribosyltransferase [Grimontia hollisae CIP
           101886]
          Length = 282

 Score = 62.1 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 5/59 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +++AF+V   +  HVA     L+DDV TTGAT       L++ G   + +    R+  D
Sbjct: 227 LKSAFSVNGKLPPHVA-----LVDDVVTTGATIAQICSLLRRHGVERIDVYCLCRTPPD 280


>gi|205375046|ref|ZP_03227837.1| late competence protein [Bacillus coahuilensis m4-4]
          Length = 226

 Score = 62.1 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 28/48 (58%)

Query: 8   PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           P    + +   ++LL+DD+YTTG T   A+  L + GA +V++ T  R
Sbjct: 178 PFTCYEEIKQQRVLLVDDIYTTGVTVHSASEVLYRHGAKSVAVFTLVR 225


>gi|62182012|ref|YP_218429.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161616553|ref|YP_001590518.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|205354866|ref|YP_002228667.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|207858750|ref|YP_002245401.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|62129645|gb|AAX67348.1| putative amidophosphoribosyltransferase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161365917|gb|ABX69685.1| hypothetical protein SPAB_04369 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|205274647|emb|CAR39701.1| putative competence protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|206710553|emb|CAR34911.1| putative competence protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|322716500|gb|EFZ08071.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|326630012|gb|EGE36355.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 227

 Score = 62.1 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|77361761|ref|YP_341336.1| hypothetical protein PSHAa2858 [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76876672|emb|CAI87894.1| conserved protein of unknown function [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 225

 Score = 62.1 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 4/52 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
           +++AF      +  ++G  + ++DD+ TTGAT   A  ALK+AGA  V   T
Sbjct: 172 LKDAF----ICTADMSGKTVAIVDDIMTTGATLNAATQALKQAGAKQVWAFT 219


>gi|197265899|ref|ZP_03165973.1| protein GntX [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197244154|gb|EDY26774.1| protein GntX [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
          Length = 227

 Score = 62.1 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|298370454|ref|ZP_06981770.1| ComF/gntX family protein [Neisseria sp. oral taxon 014 str. F0314]
 gi|298281914|gb|EFI23403.1| ComF/gntX family protein [Neisseria sp. oral taxon 014 str. F0314]
          Length = 240

 Score = 62.1 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF++   V K      ILLIDDV TTG+T    A  LKK+GA  V   + +R+
Sbjct: 184 VKNAFSIENDVFKK---RNILLIDDVVTTGSTFGELAQTLKKSGAEKVFCWSLARA 236


>gi|254453222|ref|ZP_05066659.1| competence protein F [Octadecabacter antarcticus 238]
 gi|198267628|gb|EDY91898.1| competence protein F [Octadecabacter antarcticus 238]
          Length = 239

 Score = 62.1 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 29/59 (49%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  A          + G K+LLIDDV T+GAT   A  A   AG   V +L  +R +KD
Sbjct: 180 LSGAIVPNPKRMALLNGRKVLLIDDVMTSGATFAAATEACYSAGVDDVCVLALARVVKD 238


>gi|126738463|ref|ZP_01754168.1| competence protein F, putative [Roseobacter sp. SK209-2-6]
 gi|126720262|gb|EBA16968.1| competence protein F, putative [Roseobacter sp. SK209-2-6]
          Length = 242

 Score = 62.1 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 25/58 (43%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +  A          + G  ++L+DDV T+GAT    A     AGA  V +   +R  +
Sbjct: 184 LSRAIVAHPRHQALMQGRVVVLVDDVMTSGATLTACADVCLAAGAAEVRVAVLARVTR 241


>gi|300088792|ref|YP_003759314.1| phosphoribosyltransferase [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
 gi|299528525|gb|ADJ26993.1| phosphoribosyltransferase [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
          Length = 230

 Score = 62.1 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 3/55 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           + +AF      +  + G  ++LIDDV T+GAT    A AL   GA  V  LT +R
Sbjct: 177 VADAFR---CYNSSLTGRSVILIDDVATSGATLNACARALTAGGAAEVRALTLAR 228


>gi|239828349|ref|YP_002950973.1| late competence protein [Geobacillus sp. WCH70]
 gi|239808642|gb|ACS25707.1| late competence protein [Geobacillus sp. WCH70]
          Length = 235

 Score = 62.1 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 21/45 (46%), Positives = 28/45 (62%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
              +    I+LIDD+YTTG T + AA  L++AGA+ VS  T  RS
Sbjct: 191 KMPLQDKHIVLIDDIYTTGTTLRHAAKVLRQAGAIDVSSFTLVRS 235


>gi|299142045|ref|ZP_07035179.1| competence protein F [Prevotella oris C735]
 gi|298576507|gb|EFI48379.1| competence protein F [Prevotella oris C735]
          Length = 231

 Score = 62.1 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           +++AF +     + + G  +LLIDDV TTG+T    A  L KAG + VS+L+ 
Sbjct: 176 VKDAFRL--QHPERIIGRHLLLIDDVITTGSTMLACAKELAKAGDIKVSVLSL 226


>gi|259418155|ref|ZP_05742074.1| competence protein F [Silicibacter sp. TrichCH4B]
 gi|259347061|gb|EEW58875.1| competence protein F [Silicibacter sp. TrichCH4B]
          Length = 243

 Score = 62.1 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 32/56 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + +A      +S+ + G ++LL+DDV T+G+T    A A   AGA  VS++  +R 
Sbjct: 185 LADAIRPNPRMSERLTGRQVLLVDDVMTSGSTLSACARACIDAGADGVSVVVLARV 240


>gi|197286754|ref|YP_002152626.1| gluconate metabolism protein [Proteus mirabilis HI4320]
 gi|194684241|emb|CAR45762.1| putative gluconate metabolism protein [Proteus mirabilis HI4320]
          Length = 230

 Score = 62.1 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 25/57 (43%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           + NAF V + VS  VAG  + LIDDV TT AT       L +AGA +V +    R+L
Sbjct: 176 LNNAFIVNRTVS--VAGKDLALIDDVITTSATLNAIVPLLFRAGARSVEVWAICRTL 230


>gi|257091917|ref|YP_003165558.1| phosphoribosyltransferase [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257044441|gb|ACV33629.1| phosphoribosyltransferase [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 235

 Score = 62.1 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 36/58 (62%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF    + +  + G +++L+DDV TTGA+    A  +K  GA+ V++LT +R+L 
Sbjct: 181 VRGAF----HCATDLTGKRLVLVDDVMTTGASLNELARTVKLHGAVEVTLLTLARALP 234


>gi|45658877|ref|YP_002963.1| ComFC-like protein [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
 gi|45602122|gb|AAS71600.1| ComFC-like protein [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
          Length = 251

 Score = 62.1 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           R AF + +     + G   LLIDDV+TTGA+A   A  L + GA +V ILT  R+
Sbjct: 184 RLAFKIKKEYKGKLKG-NYLLIDDVFTTGASANELARILIQNGADSVRILTLIRT 237


>gi|322804439|emb|CBZ01989.1| comf operon protein C [Clostridium botulinum H04402 065]
          Length = 225

 Score = 62.1 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + N+F V  Y  K +   K+LLIDDV TTGAT+   A  LKK GA  + ILT ++S
Sbjct: 170 VENSFKV--YNEKCIKNKKVLLIDDVLTTGATSFYCANELKKRGAKEIFILTAAKS 223


>gi|288554154|ref|YP_003426089.1| ComF operon protein 3 [Bacillus pseudofirmus OF4]
 gi|288545314|gb|ADC49197.1| comF operon protein 3 [Bacillus pseudofirmus OF4]
          Length = 235

 Score = 62.1 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 31/54 (57%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++ F +   +       KI+L+DDVYTTG T + AA  L+K GA  +  LT +R
Sbjct: 182 QSPFYIQSGIDSVKTLKKIVLVDDVYTTGTTVRQAAYVLRKHGAEHIESLTLAR 235


>gi|170754829|ref|YP_001779798.1| comF protein,-like protein [Clostridium botulinum B1 str. Okra]
 gi|169120041|gb|ACA43877.1| comF protein, homolog [Clostridium botulinum B1 str. Okra]
          Length = 225

 Score = 62.1 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + N+F V  Y  K +   K+LLIDDV TTGAT+   A  LKK GA  + ILT ++S
Sbjct: 170 VENSFKV--YNEKCIKNKKVLLIDDVLTTGATSFYCANELKKRGAKEIFILTAAKS 223


>gi|153940823|ref|YP_001389534.1| comF protein,-like protein [Clostridium botulinum F str. Langeland]
 gi|152936719|gb|ABS42217.1| ComF protein homolog [Clostridium botulinum F str. Langeland]
 gi|295317632|gb|ADF98009.1| ComF protein-like protein [Clostridium botulinum F str. 230613]
          Length = 225

 Score = 62.1 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + N+F V  Y  K +   K+LLIDDV TTGAT+   A  LKK GA  + ILT ++S
Sbjct: 170 VENSFKV--YNEKCIKNKKVLLIDDVLTTGATSFYCANELKKRGAKEIFILTAAKS 223


>gi|153932646|ref|YP_001382575.1| comF protein-like protein [Clostridium botulinum A str. ATCC 19397]
 gi|153937133|ref|YP_001386128.1| comF protein-like protein [Clostridium botulinum A str. Hall]
 gi|168177503|ref|ZP_02612167.1| comF protein homolog [Clostridium botulinum NCTC 2916]
 gi|226947393|ref|YP_002802484.1| comF protein, homolog [Clostridium botulinum A2 str. Kyoto]
 gi|152928690|gb|ABS34190.1| comF protein, homolog [Clostridium botulinum A str. ATCC 19397]
 gi|152933047|gb|ABS38546.1| comF protein, homolog [Clostridium botulinum A str. Hall]
 gi|182671613|gb|EDT83587.1| comF protein homolog [Clostridium botulinum NCTC 2916]
 gi|226842576|gb|ACO85242.1| comF protein, homolog [Clostridium botulinum A2 str. Kyoto]
          Length = 225

 Score = 62.1 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + N+F V  Y  K +   K+LLIDDV TTGAT+   A  LKK GA  + ILT ++S
Sbjct: 170 VENSFKV--YNEKCIKNKKVLLIDDVLTTGATSFYCANELKKRGAKEIFILTAAKS 223


>gi|148378175|ref|YP_001252716.1| phosphoribosyl transferase [Clostridium botulinum A str. ATCC 3502]
 gi|148287659|emb|CAL81724.1| putative phosphoribosyl transferase [Clostridium botulinum A str.
           ATCC 3502]
          Length = 207

 Score = 62.1 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + N+F V  Y  K +   K+LLIDDV TTGAT+   A  LKK GA  + ILT ++S
Sbjct: 152 VENSFKV--YNEKCIKNKKVLLIDDVLTTGATSFYCANELKKRGAKEIFILTAAKS 205


>gi|152972291|ref|YP_001337437.1| putative periplasmic gluconate-binding protein in GNT I transport
           system [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|150957140|gb|ABR79170.1| putative periplasmic gluconate-binding protein in GNT I transport
           system [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
          Length = 212

 Score = 62.1 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL I L+DDV TTG+T    +  L + GA TV +    R+L
Sbjct: 160 LKNAFQLEFA----VQGLHIALVDDVVTTGSTVAEISRLLLRNGAATVQVWCLCRTL 212


>gi|119471388|ref|ZP_01613860.1| hypothetical protein ATW7_17117 [Alteromonadales bacterium TW-7]
 gi|119445664|gb|EAW26948.1| hypothetical protein ATW7_17117 [Alteromonadales bacterium TW-7]
          Length = 224

 Score = 62.1 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 4/52 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
           + NAF      ++ ++G  + ++DD+ TTGAT   A  ALKKAGA  V   T
Sbjct: 171 LTNAF----ICTEDMSGKTVAIVDDIMTTGATLNAATQALKKAGAKQVWAFT 218


>gi|16766798|ref|NP_462413.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|167549283|ref|ZP_02343042.1| protein GntX [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|167990715|ref|ZP_02571814.1| protein GntX [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|168241652|ref|ZP_02666584.1| protein GntX [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|194449324|ref|YP_002047535.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|200388063|ref|ZP_03214675.1| protein GntX [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|51701442|sp|Q8ZLI8|GNTX_SALTY RecName: Full=Protein GntX
 gi|16422069|gb|AAL22372.1| putative amidophosphoribosyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|194407628|gb|ACF67847.1| protein GntX [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|199605161|gb|EDZ03706.1| protein GntX [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|205325670|gb|EDZ13509.1| protein GntX [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|205330741|gb|EDZ17505.1| protein GntX [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205339021|gb|EDZ25785.1| protein GntX [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|261248665|emb|CBG26503.1| putative competence protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267995732|gb|ACY90617.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301160053|emb|CBW19572.1| putative competence protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312914534|dbj|BAJ38508.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321226561|gb|EFX51611.1| protein GntX [Salmonella enterica subsp. enterica serovar
           Typhimurium str. TN061786]
 gi|323131870|gb|ADX19300.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|332990362|gb|AEF09345.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 227

 Score = 62.1 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +