PSIBLAST alignment of GI: 254780309 and protein with PDB id: 1r3u

>gi|56553634|pdb|1R3U|A Chain A, Crystal Structure Of Hypoxanthine-Guanine Phosphoribosyltransferase From Thermoanaerobacter Tengcongensis Length = 205
>gi|56553635|pdb|1R3U|B Chain B, Crystal Structure Of Hypoxanthine-Guanine Phosphoribosyltransferase From Thermoanaerobacter Tengcongensis Length = 205
 Score = 55.6 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 8/51 (15%), Positives = 19/51 (37%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + +     + G  +L+++D+  +G T       L      ++ I T 
Sbjct: 104 GIVKIIKDHDIDIEGKDVLIVEDIIDSGLTLAYLRETLLGRKPRSLKICTI 154