PSIBLAST alignment of GI: 254780309 and protein with PDB id: 2geb

>gi|145579368|pdb|2GEB|A Chain A, Crystal Structure Of The Thermoanaerobacter Tengcongensis Hypoxanthine-Guanine Phosphoribosyltransferase L160i Mutant: Insights Into The Inhibitor Design Length = 185
 Score = 54.9 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 8/51 (15%), Positives = 19/51 (37%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + +     + G  +L+++D+  +G T       L      ++ I T 
Sbjct: 84  GIVKIIKDHDIDIEGKDVLIVEDIIDSGLTLAYLRETLLGRKPRSLKICTI 134