BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780309|ref|YP_003064722.1| comF family protein
[Candidatus Liberibacter asiaticus str. psy62]
         (59 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|116751311|ref|YP_847998.1| phosphoribosyltransferase [Syntrophobacter fumaroxidans MPOB]
 gi|116700375|gb|ABK19563.1| phosphoribosyltransferase [Syntrophobacter fumaroxidans MPOB]
          Length = 259

 Score = 86.5 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++NAF V       V G  IL++DDV+TTG T    A ALKK GA +V  LT +R+L D
Sbjct: 191 VKNAFRVKDETR--VEGKSILIVDDVFTTGTTLSECARALKKGGAASVHALTVARALPD 247


>gi|86359347|ref|YP_471239.1| competence protein F (phosphoribosyltransferase protein) [Rhizobium
           etli CFN 42]
 gi|86283449|gb|ABC92512.1| competence protein F (phosphoribosyltransferase protein) [Rhizobium
           etli CFN 42]
          Length = 258

 Score = 82.6 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 42/59 (71%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF + +     ++G +I+L+DDVYTTGAT   A+  L+KAGA  +++LTF+R+L +
Sbjct: 198 VRGAFAIAKGRENDISGKRIVLVDDVYTTGATVAAASRTLRKAGAAEITVLTFARALSE 256


>gi|320108567|ref|YP_004184157.1| phosphoribosyltransferase [Terriglobus saanensis SP1PR4]
 gi|319927088|gb|ADV84163.1| phosphoribosyltransferase [Terriglobus saanensis SP1PR4]
          Length = 281

 Score = 82.6 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF V +     +AG  ILL+DD+YTTGATA+  +  L  AGA +V +LT +R+
Sbjct: 205 LRGAFRVTR--PGKIAGRDILLVDDIYTTGATARECSKTLLAAGAHSVHVLTLARA 258


>gi|160897117|ref|YP_001562699.1| ComF family protein [Delftia acidovorans SPH-1]
 gi|160362701|gb|ABX34314.1| ComF family protein [Delftia acidovorans SPH-1]
          Length = 244

 Score = 81.8 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 34/56 (60%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R  F VP     HV G ++LLIDDV TTGA+    A  L++AGA  VS L  +R+
Sbjct: 188 LRGVFAVPPAQLPHVRGRRVLLIDDVMTTGASLHALATCLRRAGAAEVSALVLART 243


>gi|90022782|ref|YP_528609.1| K+-dependent Na+/Ca+ exchanger related-protein [Saccharophagus
           degradans 2-40]
 gi|89952382|gb|ABD82397.1| phosphoribosyltransferase [Saccharophagus degradans 2-40]
          Length = 296

 Score = 81.8 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 34/58 (58%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R +F V   +   V G  I ++DDV TTGATA+  A  LK+AGA  V I   +R+ K
Sbjct: 237 LRQSFAVAPKLLTEVKGKHIAVVDDVVTTGATAEVIANLLKEAGASRVDIWALARTPK 294


>gi|306844850|ref|ZP_07477433.1| competence protein F [Brucella sp. BO1]
 gi|306274782|gb|EFM56563.1| competence protein F [Brucella sp. BO1]
          Length = 262

 Score = 81.8 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 31/59 (52%), Positives = 39/59 (66%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VP+    H+ G ++LLIDDVYTTGAT K A  AL + GA +V +LT SR L D
Sbjct: 204 VDGAFRVPKEHEIHIRGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTLSRVLPD 262


>gi|327193402|gb|EGE60302.1| competence protein F (phosphoribosyltransferase protein) [Rhizobium
           etli CNPAF512]
          Length = 258

 Score = 81.8 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF + +     + G +I+LIDDVYTTGAT   A+  L+KAGA  +++LTF+R+L +
Sbjct: 198 VRGAFAIAKGRENDIFGKRIVLIDDVYTTGATVAAASRTLRKAGAAEITVLTFARALSE 256


>gi|209551108|ref|YP_002283025.1| competence protein F (phosphoribosyltransferase protein) [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209536864|gb|ACI56799.1| competence protein F (phosphoribosyltransferase protein) [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 258

 Score = 81.8 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF + +     + G +I+LIDDVYTTGAT   A+  L+KAGA  +++LTF+R+L +
Sbjct: 198 VRGAFAIAKGCENDIFGKRIVLIDDVYTTGATVAAASRTLRKAGAAEITVLTFARALSE 256


>gi|190893598|ref|YP_001980140.1| competence protein F (phosphoribosyltransferase) [Rhizobium etli
           CIAT 652]
 gi|190698877|gb|ACE92962.1| competence protein F (phosphoribosyltransferase protein) [Rhizobium
           etli CIAT 652]
          Length = 258

 Score = 81.5 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF + +     + G +I+LIDDVYTTGAT   A+  L+KAGA  +++LTF+R+L +
Sbjct: 198 VRGAFAIAKGRENDIFGKRIVLIDDVYTTGATVAAASRTLRKAGAAEITVLTFARALSE 256


>gi|148560259|ref|YP_001259705.1| putative competence protein F [Brucella ovis ATCC 25840]
 gi|148371516|gb|ABQ61495.1| putative competence protein F [Brucella ovis ATCC 25840]
          Length = 262

 Score = 81.1 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 204 VDGAFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 262


>gi|153008363|ref|YP_001369578.1| competence protein F [Ochrobactrum anthropi ATCC 49188]
 gi|151560251|gb|ABS13749.1| competence protein F, putative [Ochrobactrum anthropi ATCC 49188]
          Length = 262

 Score = 80.7 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 33/59 (55%), Positives = 39/59 (66%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VPQ    HV G ++LLIDDVYTTGAT K    AL + GA +V +LTFSR L D
Sbjct: 204 VDGAFRVPQEHEIHVRGRRVLLIDDVYTTGATVKAVTRALLRGGAKSVDVLTFSRVLPD 262


>gi|306842968|ref|ZP_07475602.1| competence protein F [Brucella sp. BO2]
 gi|306286896|gb|EFM58421.1| competence protein F [Brucella sp. BO2]
          Length = 262

 Score = 80.7 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 204 VDGAFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 262


>gi|161619796|ref|YP_001593683.1| protein gntX [Brucella canis ATCC 23365]
 gi|260567631|ref|ZP_05838101.1| competence protein F [Brucella suis bv. 4 str. 40]
 gi|161336607|gb|ABX62912.1| Protein gntX [Brucella canis ATCC 23365]
 gi|260157149|gb|EEW92229.1| competence protein F [Brucella suis bv. 4 str. 40]
          Length = 262

 Score = 80.7 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 204 VDGAFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 262


>gi|121603784|ref|YP_981113.1| hypothetical protein Pnap_0875 [Polaromonas naphthalenivorans CJ2]
 gi|120592753|gb|ABM36192.1| conserved hypothetical protein [Polaromonas naphthalenivorans CJ2]
          Length = 255

 Score = 80.7 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 35/58 (60%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF V    +  + G +++L+DDV T+GA+   AA AL+ AGA  ++ +  +R+  
Sbjct: 197 VRGAFQVDPLRAPQLQGRRVVLVDDVMTSGASLFAAAQALRDAGAARITAVVLARTPP 254


>gi|225628082|ref|ZP_03786117.1| protein gntX [Brucella ceti str. Cudo]
 gi|225616907|gb|EEH13954.1| protein gntX [Brucella ceti str. Cudo]
          Length = 290

 Score = 80.7 bits (199), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 232 VDGAFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 290


>gi|23502731|ref|NP_698858.1| competence protein F [Brucella suis 1330]
 gi|254704895|ref|ZP_05166723.1| putative competence protein F [Brucella suis bv. 3 str. 686]
 gi|261755589|ref|ZP_05999298.1| phosphoribosyltransferase [Brucella suis bv. 3 str. 686]
 gi|23348747|gb|AAN30773.1| competence protein F, putative [Brucella suis 1330]
 gi|261745342|gb|EEY33268.1| phosphoribosyltransferase [Brucella suis bv. 3 str. 686]
          Length = 262

 Score = 80.7 bits (199), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 204 VDGAFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 262


>gi|237816244|ref|ZP_04595237.1| competence protein F [Brucella abortus str. 2308 A]
 gi|237788311|gb|EEP62526.1| competence protein F [Brucella abortus str. 2308 A]
          Length = 290

 Score = 80.3 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 232 VDGAFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 290


>gi|163843904|ref|YP_001628308.1| protein gntX [Brucella suis ATCC 23445]
 gi|254707589|ref|ZP_05169417.1| putative competence protein F [Brucella pinnipedialis M163/99/10]
 gi|254708873|ref|ZP_05170684.1| putative competence protein F [Brucella pinnipedialis B2/94]
 gi|254713704|ref|ZP_05175515.1| putative competence protein F [Brucella ceti M644/93/1]
 gi|254715946|ref|ZP_05177757.1| putative competence protein F [Brucella ceti M13/05/1]
 gi|256030399|ref|ZP_05444013.1| putative competence protein F [Brucella pinnipedialis M292/94/1]
 gi|256059857|ref|ZP_05450044.1| putative competence protein F [Brucella neotomae 5K33]
 gi|256370278|ref|YP_003107789.1| competence protein F, putative [Brucella microti CCM 4915]
 gi|261217709|ref|ZP_05931990.1| phosphoribosyltransferase [Brucella ceti M13/05/1]
 gi|261315076|ref|ZP_05954273.1| phosphoribosyltransferase [Brucella pinnipedialis M163/99/10]
 gi|261316366|ref|ZP_05955563.1| phosphoribosyltransferase [Brucella pinnipedialis B2/94]
 gi|261321444|ref|ZP_05960641.1| phosphoribosyltransferase [Brucella ceti M644/93/1]
 gi|261323827|ref|ZP_05963024.1| phosphoribosyltransferase [Brucella neotomae 5K33]
 gi|265987438|ref|ZP_06099995.1| phosphoribosyltransferase [Brucella pinnipedialis M292/94/1]
 gi|163674627|gb|ABY38738.1| Protein gntX [Brucella suis ATCC 23445]
 gi|256000441|gb|ACU48840.1| competence protein F, putative [Brucella microti CCM 4915]
 gi|260922798|gb|EEX89366.1| phosphoribosyltransferase [Brucella ceti M13/05/1]
 gi|261294134|gb|EEX97630.1| phosphoribosyltransferase [Brucella ceti M644/93/1]
 gi|261295589|gb|EEX99085.1| phosphoribosyltransferase [Brucella pinnipedialis B2/94]
 gi|261299807|gb|EEY03304.1| phosphoribosyltransferase [Brucella neotomae 5K33]
 gi|261304102|gb|EEY07599.1| phosphoribosyltransferase [Brucella pinnipedialis M163/99/10]
 gi|264659635|gb|EEZ29896.1| phosphoribosyltransferase [Brucella pinnipedialis M292/94/1]
          Length = 262

 Score = 80.3 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 204 VDGAFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 262


>gi|256158382|ref|ZP_05456280.1| putative competence protein F [Brucella ceti M490/95/1]
 gi|256253801|ref|ZP_05459337.1| putative competence protein F [Brucella ceti B1/94]
 gi|260169308|ref|ZP_05756119.1| putative competence protein F [Brucella sp. F5/99]
 gi|261220934|ref|ZP_05935215.1| phosphoribosyltransferase [Brucella ceti B1/94]
 gi|261758821|ref|ZP_06002530.1| competence protein F [Brucella sp. F5/99]
 gi|265996894|ref|ZP_06109451.1| phosphoribosyltransferase [Brucella ceti M490/95/1]
 gi|260919518|gb|EEX86171.1| phosphoribosyltransferase [Brucella ceti B1/94]
 gi|261738805|gb|EEY26801.1| competence protein F [Brucella sp. F5/99]
 gi|262551362|gb|EEZ07352.1| phosphoribosyltransferase [Brucella ceti M490/95/1]
          Length = 262

 Score = 80.3 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 204 VDGAFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 262


>gi|254717947|ref|ZP_05179758.1| protein gntX [Brucella sp. 83/13]
 gi|265982890|ref|ZP_06095625.1| phosphoribosyltransferase [Brucella sp. 83/13]
 gi|306838253|ref|ZP_07471103.1| competence protein F [Brucella sp. NF 2653]
 gi|264661482|gb|EEZ31743.1| phosphoribosyltransferase [Brucella sp. 83/13]
 gi|306406656|gb|EFM62885.1| competence protein F [Brucella sp. NF 2653]
          Length = 262

 Score = 80.3 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 204 VDGAFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 262


>gi|62290737|ref|YP_222530.1| competence protein F [Brucella abortus bv. 1 str. 9-941]
 gi|82700649|ref|YP_415223.1| competence protein F [Brucella melitensis biovar Abortus 2308]
 gi|189024949|ref|YP_001935717.1| competence protein F [Brucella abortus S19]
 gi|254690026|ref|ZP_05153280.1| putative competence protein F [Brucella abortus bv. 6 str. 870]
 gi|254694515|ref|ZP_05156343.1| putative competence protein F [Brucella abortus bv. 3 str. Tulya]
 gi|254696140|ref|ZP_05157968.1| putative competence protein F [Brucella abortus bv. 2 str. 86/8/59]
 gi|254731058|ref|ZP_05189636.1| putative competence protein F [Brucella abortus bv. 4 str. 292]
 gi|256258280|ref|ZP_05463816.1| putative competence protein F [Brucella abortus bv. 9 str. C68]
 gi|260546000|ref|ZP_05821740.1| competence protein F [Brucella abortus NCTC 8038]
 gi|260755561|ref|ZP_05867909.1| phosphoribosyltransferase [Brucella abortus bv. 6 str. 870]
 gi|260758784|ref|ZP_05871132.1| phosphoribosyltransferase [Brucella abortus bv. 4 str. 292]
 gi|260760508|ref|ZP_05872851.1| phosphoribosyltransferase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884585|ref|ZP_05896199.1| phosphoribosyltransferase [Brucella abortus bv. 9 str. C68]
 gi|261214832|ref|ZP_05929113.1| phosphoribosyltransferase [Brucella abortus bv. 3 str. Tulya]
 gi|297247124|ref|ZP_06930842.1| competence protein ComFC [Brucella abortus bv. 5 str. B3196]
 gi|62196869|gb|AAX75169.1| competence protein F, hypothetical [Brucella abortus bv. 1 str.
           9-941]
 gi|82616750|emb|CAJ11836.1| competence protein F [Brucella melitensis biovar Abortus 2308]
 gi|189020521|gb|ACD73243.1| competence protein F [Brucella abortus S19]
 gi|260096107|gb|EEW79983.1| competence protein F [Brucella abortus NCTC 8038]
 gi|260669102|gb|EEX56042.1| phosphoribosyltransferase [Brucella abortus bv. 4 str. 292]
 gi|260670940|gb|EEX57761.1| phosphoribosyltransferase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675669|gb|EEX62490.1| phosphoribosyltransferase [Brucella abortus bv. 6 str. 870]
 gi|260874113|gb|EEX81182.1| phosphoribosyltransferase [Brucella abortus bv. 9 str. C68]
 gi|260916439|gb|EEX83300.1| phosphoribosyltransferase [Brucella abortus bv. 3 str. Tulya]
 gi|297174293|gb|EFH33640.1| competence protein ComFC [Brucella abortus bv. 5 str. B3196]
          Length = 262

 Score = 80.3 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 204 VDGAFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 262


>gi|319406072|emb|CBI79702.1| competence protein ComF [Bartonella sp. AR 15-3]
          Length = 225

 Score = 80.3 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++NAF VP+ V KH+ G  ILLIDDV TTG T   AA  LK AG   V++LTFSR LKD
Sbjct: 160 VQNAFKVPKEVKKHLKGRSILLIDDVLTTGVTVTAAAKTLKHAGTRQVNVLTFSRVLKD 218


>gi|241206509|ref|YP_002977605.1| competence protein F (phosphoribosyltransferase protein) [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240860399|gb|ACS58066.1| competence protein F (phosphoribosyltransferase protein) [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 258

 Score = 80.3 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF + +     + G +I+LIDDVYTTGAT   A+  L+KAGA  +++LTF+R+L +
Sbjct: 198 VRGAFAIAKGCENDIFGKRIVLIDDVYTTGATVAAASRTLRKAGATDITVLTFARALSE 256


>gi|326539594|gb|ADZ87809.1| competence protein F [Brucella melitensis M5-90]
          Length = 251

 Score = 80.3 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 193 VDGAFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 251


>gi|17986467|ref|NP_539101.1| competence protein F [Brucella melitensis bv. 1 str. 16M]
 gi|225853317|ref|YP_002733550.1| competence protein F [Brucella melitensis ATCC 23457]
 gi|256045489|ref|ZP_05448372.1| putative competence protein F [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256263196|ref|ZP_05465728.1| competence protein F [Brucella melitensis bv. 2 str. 63/9]
 gi|260562798|ref|ZP_05833284.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|265991911|ref|ZP_06104468.1| phosphoribosyltransferase [Brucella melitensis bv. 1 str. Rev.1]
 gi|17982065|gb|AAL51365.1| competence protein f [Brucella melitensis bv. 1 str. 16M]
 gi|225641682|gb|ACO01596.1| competence protein F [Brucella melitensis ATCC 23457]
 gi|260152814|gb|EEW87906.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|263002977|gb|EEZ15270.1| phosphoribosyltransferase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093118|gb|EEZ17253.1| competence protein F [Brucella melitensis bv. 2 str. 63/9]
 gi|326409880|gb|ADZ66945.1| competence protein F [Brucella melitensis M28]
          Length = 262

 Score = 80.3 bits (198), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 204 VDGAFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 262


>gi|239832955|ref|ZP_04681284.1| competence protein F [Ochrobactrum intermedium LMG 3301]
 gi|239825222|gb|EEQ96790.1| competence protein F [Ochrobactrum intermedium LMG 3301]
          Length = 288

 Score = 80.3 bits (198), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 39/59 (66%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VPQ    H+ G ++LLIDDVYTTGAT K    AL + GA +V +LTFSR L D
Sbjct: 230 VDGAFRVPQEHEIHIRGRRVLLIDDVYTTGATVKAVTRALLRGGARSVDVLTFSRVLPD 288


>gi|256112214|ref|ZP_05453135.1| competence protein F [Brucella melitensis bv. 3 str. Ether]
 gi|265993642|ref|ZP_06106199.1| phosphoribosyltransferase [Brucella melitensis bv. 3 str. Ether]
 gi|262764623|gb|EEZ10544.1| phosphoribosyltransferase [Brucella melitensis bv. 3 str. Ether]
          Length = 262

 Score = 79.9 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 204 VDGAFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 262


>gi|313496727|gb|ADR58093.1| Competence protein ComF, putative [Pseudomonas putida BIRD-1]
          Length = 243

 Score = 79.5 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 34/58 (58%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF V       + G  + ++DDV TTGATA+  A AL+KAGA  V +   +R+ K
Sbjct: 186 LRQAFAV----KGELEGKHVAIVDDVLTTGATAQAIAQALRKAGARRVDVYCLARTPK 239


>gi|26987103|ref|NP_742528.1| competence protein ComF, putative [Pseudomonas putida KT2440]
 gi|24981731|gb|AAN65992.1|AE016228_5 competence protein ComF, putative [Pseudomonas putida KT2440]
          Length = 243

 Score = 79.5 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 34/58 (58%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF V       + G  + ++DDV TTGATA+  A AL+KAGA  V +   +R+ K
Sbjct: 186 LRQAFAV----QGELEGKHVAIVDDVLTTGATAQAIAQALRKAGARRVDVYCLARTPK 239


>gi|20806995|ref|NP_622166.1| amidophosphoribosyltransferase [Thermoanaerobacter tengcongensis
           MB4]
 gi|254478842|ref|ZP_05092207.1| Phosphoribosyl transferase domain protein [Carboxydibrachium
           pacificum DSM 12653]
 gi|20515478|gb|AAM23770.1| predicted amidophosphoribosyltransferases [Thermoanaerobacter
           tengcongensis MB4]
 gi|214035204|gb|EEB75913.1| Phosphoribosyl transferase domain protein [Carboxydibrachium
           pacificum DSM 12653]
          Length = 228

 Score = 79.1 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF V       + G  +LL+DDV TTGAT    A ALK+ GA  V ++T +
Sbjct: 173 VKGAFKVT--YKDTIEGKNVLLVDDVLTTGATLDECAKALKENGAKEVYVVTIA 224


>gi|254700524|ref|ZP_05162352.1| putative competence protein F [Brucella suis bv. 5 str. 513]
 gi|261751028|ref|ZP_05994737.1| phosphoribosyltransferase [Brucella suis bv. 5 str. 513]
 gi|261740781|gb|EEY28707.1| phosphoribosyltransferase [Brucella suis bv. 5 str. 513]
          Length = 262

 Score = 78.8 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 40/57 (70%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            AF VP+    H++G ++LLIDDVYTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 206 GAFRVPKEHEIHISGRRVLLIDDVYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 262


>gi|294085486|ref|YP_003552246.1| putative competence protein F [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292665061|gb|ADE40162.1| putative competence protein F (COMF) [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 238

 Score = 78.4 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 25/57 (43%), Positives = 33/57 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF VP +    +A   I+LIDDV TTGAT   AA  L+ AGA ++  L  +R  
Sbjct: 182 VRGAFAVPAHQKPALANRPIMLIDDVMTTGATLFEAAKTLQMAGAGSICGLVIARVT 238


>gi|116254026|ref|YP_769864.1| hypothetical protein RL4290 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258674|emb|CAK09778.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 246

 Score = 78.4 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF + +     + G +I+LIDDVYTTGAT   A+  L+KAGA  +++LTF+R+L +
Sbjct: 186 VRGAFAIAKGSENDIFGKRIVLIDDVYTTGATVAAASRTLRKAGATDITVLTFARALSE 244


>gi|332529993|ref|ZP_08405943.1| phosphoribosyltransferase [Hylemonella gracilis ATCC 19624]
 gi|332040466|gb|EGI76842.1| phosphoribosyltransferase [Hylemonella gracilis ATCC 19624]
          Length = 249

 Score = 78.4 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 37/56 (66%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +++AF VP    + + G ++LLIDDV TTGAT   AA  L++AGA+ +  L  +R+
Sbjct: 189 VQDAFGVPPGKRRRIEGQRLLLIDDVMTTGATLNAAAAVLREAGAVEICALVLART 244


>gi|149182540|ref|ZP_01861012.1| late competence protein [Bacillus sp. SG-1]
 gi|148849732|gb|EDL63910.1| late competence protein [Bacillus sp. SG-1]
          Length = 237

 Score = 78.4 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 22/52 (42%), Positives = 31/52 (59%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
            F +   +   +    ILLIDD+YTTG T + AA  LK+AGA  ++ LT +R
Sbjct: 185 VFGINPDLQPEINNKSILLIDDIYTTGTTLRQAARILKEAGAKEITSLTLAR 236


>gi|218659666|ref|ZP_03515596.1| competence protein F (phosphoribosyltransferase protein) [Rhizobium
           etli IE4771]
          Length = 182

 Score = 78.0 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 42/59 (71%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF + +     + G +++LIDDVYTTGAT   A+ AL+KAGA  +++LTF+R+L +
Sbjct: 122 VRGAFAIAKGRENDIFGKRVVLIDDVYTTGATVAAASRALRKAGAAEITVLTFARALSE 180


>gi|254486071|ref|ZP_05099276.1| competence protein F [Roseobacter sp. GAI101]
 gi|214042940|gb|EEB83578.1| competence protein F [Roseobacter sp. GAI101]
          Length = 242

 Score = 77.6 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 34/59 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  A  V    ++ + G  +L++DDV T+GAT   AA A   AGA ++ ++T +R  KD
Sbjct: 183 LEGAITVHPKRAERLQGRSVLIVDDVMTSGATLCSAAKACIDAGAGSIRVVTLARVAKD 241


>gi|260576133|ref|ZP_05844126.1| competence protein F, putative [Rhodobacter sp. SW2]
 gi|259021613|gb|EEW24916.1| competence protein F, putative [Rhodobacter sp. SW2]
          Length = 240

 Score = 77.6 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 31/57 (54%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            AF V       +AG ++LL+DDV T+GAT      A   AGA  VS+L  +R  KD
Sbjct: 183 GAFRVNPARDWQIAGRRVLLVDDVMTSGATLAACTEACLAAGATEVSVLALARVAKD 239


>gi|296284059|ref|ZP_06862057.1| amidophosphoribosyltransferase [Citromicrobium bathyomarinum JL354]
          Length = 161

 Score = 77.2 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 34/59 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R A  V     + + G  ++L+DDV T+GAT+     AL +AGA +V I  F+R  ++
Sbjct: 91  LRGAIRVRPRCREDIEGRHVILVDDVLTSGATSTACTAALLEAGAKSVRIACFARVPEN 149


>gi|225873655|ref|YP_002755114.1| ComF family protein [Acidobacterium capsulatum ATCC 51196]
 gi|225792065|gb|ACO32155.1| ComF family protein [Acidobacterium capsulatum ATCC 51196]
          Length = 310

 Score = 77.2 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 40/59 (67%), Gaps = 1/59 (1%)

Query: 1   MRNAFNVPQ-YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF VP+      V G  +LLIDD+YTTGATA   ++AL++AGA +V + T +R+ +
Sbjct: 201 VRGAFFVPEGRAQAAVKGRDVLLIDDIYTTGATAHACSLALRRAGAASVRVATVARAQR 259


>gi|309379776|emb|CBX21552.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 165

 Score = 77.2 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 25/56 (44%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF + + +     G  ILLIDDV+TTGAT    A  LKK+GA  V   T +R+
Sbjct: 109 IKNAFEIREPLP---KGCNILLIDDVFTTGATLNELAKMLKKSGARRVCCWTLART 161


>gi|269214467|ref|ZP_06158596.1| ComF/gntX family protein [Neisseria lactamica ATCC 23970]
 gi|269209759|gb|EEZ76214.1| ComF/gntX family protein [Neisseria lactamica ATCC 23970]
          Length = 165

 Score = 77.2 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 25/56 (44%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF + + +     G  ILLIDDV+TTGAT    A  LKK+GA  V   T +R+
Sbjct: 109 IKNAFEIREPLP---KGCNILLIDDVFTTGATLNELAKMLKKSGARRVCCWTLART 161


>gi|91974589|ref|YP_567248.1| phosphoribosyltransferase [Rhodopseudomonas palustris BisB5]
 gi|91681045|gb|ABE37347.1| phosphoribosyltransferase [Rhodopseudomonas palustris BisB5]
          Length = 272

 Score = 76.8 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF VP      V G +I+L+DDV T+GAT    A AL +A A +V +L F+R +
Sbjct: 209 VQGAFKVPPECKAEVQGRRIVLVDDVLTSGATVDACARALLRAKARSVDVLVFARVV 265


>gi|148545642|ref|YP_001265744.1| amidophosphoribosyltransferase-like protein [Pseudomonas putida F1]
 gi|148509700|gb|ABQ76560.1| amidophosphoribosyltransferase-like protein [Pseudomonas putida F1]
          Length = 243

 Score = 76.8 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 34/58 (58%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF V       + G  + ++DDV TTGATA+  A AL+KAGA  V +   +R+ K
Sbjct: 186 LRQAFAV----MGKLQGKHVAIVDDVLTTGATAQAIAQALRKAGARQVDVYCLARTPK 239


>gi|56552061|ref|YP_162900.1| amidophosphoribosyltransferase [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|56543635|gb|AAV89789.1| amidophosphoribosyltransferase [Zymomonas mobilis subsp. mobilis
           ZM4]
          Length = 281

 Score = 76.8 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 37/60 (61%), Gaps = 1/60 (1%)

Query: 1   MRNAFNVPQYVSKH-VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++NAF +        +AG  I+LIDDV+T+GAT +  A  LKKAG  +V +L ++R +  
Sbjct: 218 VKNAFGLRIGKKDRPLAGRDIILIDDVFTSGATTESCARLLKKAGVKSVHVLCWARVIPQ 277


>gi|264680076|ref|YP_003279985.1| hypothetical protein CtCNB1_3943 [Comamonas testosteroni CNB-2]
 gi|262210591|gb|ACY34689.1| conserved hypothetical protein [Comamonas testosteroni CNB-2]
          Length = 254

 Score = 76.8 bits (189), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R  F++       V G +ILL+DDV TTGAT    A  L  AGA +VS +  +R+
Sbjct: 198 LRGIFSLAPARQALVKGREILLLDDVMTTGATLDALAGCLLSAGAASVSAVVLART 253


>gi|254472326|ref|ZP_05085726.1| phosphoribosyltransferase [Pseudovibrio sp. JE062]
 gi|211958609|gb|EEA93809.1| phosphoribosyltransferase [Pseudovibrio sp. JE062]
          Length = 281

 Score = 76.8 bits (189), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 34/59 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ AF V ++    V+G  ++L+DDV TTGAT +     LK AGA  V +L F+    +
Sbjct: 216 VKGAFEVSEHFLAKVSGAHVVLVDDVLTTGATVEECTRVLKAAGAKQVDVLVFALVDPE 274


>gi|94501351|ref|ZP_01307871.1| amidophosphoribosyltransferase family protein [Oceanobacter sp.
           RED65]
 gi|94426464|gb|EAT11452.1| amidophosphoribosyltransferase family protein [Oceanobacter sp.
           RED65]
          Length = 148

 Score = 76.8 bits (189), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 24/59 (40%), Positives = 35/59 (59%), Gaps = 2/59 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++NAF V       + G  +LLIDDV TTGATA  A++ L K+GA +V +   +R+   
Sbjct: 90  VKNAFEVNSAQY--IEGKNVLLIDDVMTTGATAHEASLTLIKSGAKSVCVACLARTPPQ 146


>gi|299534094|ref|ZP_07047446.1| hypothetical protein CTS44_24793 [Comamonas testosteroni S44]
 gi|298718003|gb|EFI59008.1| hypothetical protein CTS44_24793 [Comamonas testosteroni S44]
          Length = 254

 Score = 76.8 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R  F++       V G +ILL+DDV TTGAT    A  L  AGA +VS +  +R+
Sbjct: 198 LRGIFSLAPARQALVKGREILLLDDVMTTGATLDALAGCLLSAGAASVSAVVLART 253


>gi|260431723|ref|ZP_05785694.1| competence protein F [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415551|gb|EEX08810.1| competence protein F [Silicibacter lacuscaerulensis ITI-1157]
          Length = 254

 Score = 76.8 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 34/59 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R+A  V    +  + G  +LL+DDV T+GAT      A ++AGA  +S+L  +R  KD
Sbjct: 195 LRDAITVHPRRADRLTGRHVLLVDDVMTSGATLAACTHACQEAGAADISVLVLARVAKD 253


>gi|221065311|ref|ZP_03541416.1| ComF family protein [Comamonas testosteroni KF-1]
 gi|220710334|gb|EED65702.1| ComF family protein [Comamonas testosteroni KF-1]
          Length = 254

 Score = 76.8 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +RN F++       + G  ILL+DDV TTGAT    A  L  AGA +VS +  +R+
Sbjct: 198 LRNVFSLDPARKALIEGQAILLLDDVMTTGATLDALARCLLSAGAASVSAVVLART 253


>gi|313669260|ref|YP_004049544.1| hypothetical protein NLA_19950 [Neisseria lactamica ST-640]
 gi|313006722|emb|CBN88192.1| conserved hypothetical protein [Neisseria lactamica 020-06]
          Length = 241

 Score = 76.5 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 25/56 (44%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF + + +     G  ILLIDDV+TTGAT    A  LKK+GA  V   T +R+
Sbjct: 185 IKNAFEIREPLP---KGCNILLIDDVFTTGATLNELAKMLKKSGARRVCCWTLART 237


>gi|218779784|ref|YP_002431102.1| phosphoribosyltransferase [Desulfatibacillum alkenivorans AK-01]
 gi|218761168|gb|ACL03634.1| phosphoribosyltransferase [Desulfatibacillum alkenivorans AK-01]
          Length = 252

 Score = 76.5 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/58 (46%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF V +     V G  +LL+DDV+TTGATA   A AL KAGA  V +LT +  ++
Sbjct: 197 IRGAFAVVR--PDLVRGKNVLLVDDVFTTGATANECAKALLKAGAKKVDVLTLAVVVR 252


>gi|296444589|ref|ZP_06886553.1| phosphoribosyltransferase [Methylosinus trichosporium OB3b]
 gi|296257857|gb|EFH04920.1| phosphoribosyltransferase [Methylosinus trichosporium OB3b]
          Length = 262

 Score = 76.5 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 33/57 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           M+ AF +    +  V G  I+L+DDV TTGAT   AA  L +AGA  V +L  +R +
Sbjct: 203 MQGAFRLKPERAAAVHGRNIVLVDDVLTTGATVNAAARVLLRAGAARVDVLVLARVV 259


>gi|121601823|ref|YP_988686.1| comF family protein [Bartonella bacilliformis KC583]
 gi|120614000|gb|ABM44601.1| comF family protein [Bartonella bacilliformis KC583]
          Length = 251

 Score = 76.5 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 33/59 (55%), Positives = 42/59 (71%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++NAF+VP+ + K + G  ILL+DDV TTG T   AA  LK+AGA  V +LTFSR LKD
Sbjct: 186 VQNAFSVPRKIKKRMQGCSILLVDDVLTTGVTVTIAAATLKRAGARQVDVLTFSRVLKD 244


>gi|237747426|ref|ZP_04577906.1| gntX protein [Oxalobacter formigenes HOxBLS]
 gi|229378777|gb|EEO28868.1| gntX protein [Oxalobacter formigenes HOxBLS]
          Length = 199

 Score = 76.1 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 33/58 (56%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           + NAF++ +     +    I ++DDV TTG T +  A  LKK+GA  V+   F+R+L 
Sbjct: 136 VHNAFDLAETGRFSIKEKHIGIVDDVMTTGHTLEEIARLLKKSGAKRVTNFVFARTLP 193


>gi|260467149|ref|ZP_05813327.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259029073|gb|EEW30371.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 266

 Score = 76.1 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 39/58 (67%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF VP      +AG ++LL+DDVYTTGAT + A  ALKK GA  V +LTF+R L 
Sbjct: 198 VRAAFRVPAEAEIEIAGRRVLLVDDVYTTGATVRSATKALKKGGAAAVDVLTFARVLP 255


>gi|325271487|ref|ZP_08138005.1| competence protein ComF, putative [Pseudomonas sp. TJI-51]
 gi|324103377|gb|EGC00706.1| competence protein ComF, putative [Pseudomonas sp. TJI-51]
          Length = 243

 Score = 76.1 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF V       + G  + ++DDV TTGATA+  A  L+KAGA  V +   +R+ K
Sbjct: 186 LRQAFAVA----GDLPGKHVAIVDDVLTTGATAQAIAQVLRKAGAQRVDVYCLARTPK 239


>gi|119475124|ref|ZP_01615477.1| competence protein ComF, putative [marine gamma proteobacterium
           HTCC2143]
 gi|119451327|gb|EAW32560.1| competence protein ComF, putative [marine gamma proteobacterium
           HTCC2143]
          Length = 243

 Score = 76.1 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           M+ AF     +   VAG  + ++DDV TTG T   A+  L KAGA  V I   +R+
Sbjct: 191 MKGAFQ----MCGDVAGKLVAVVDDVMTTGTTVSEASQCLLKAGATEVHIWCLART 242


>gi|163792772|ref|ZP_02186749.1| Phosphoribosyltransferase [alpha proteobacterium BAL199]
 gi|159182477|gb|EDP66986.1| Phosphoribosyltransferase [alpha proteobacterium BAL199]
          Length = 248

 Score = 76.1 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 35/57 (61%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF V       +A  ++LL+DDV T+GATA   A  L +AGA +V +LT +R +
Sbjct: 192 VQGAFRVDDRRRSEIADRRVLLVDDVLTSGATAGACARVLLRAGAASVDLLTLARVV 248


>gi|319408180|emb|CBI81833.1| competence protein ComF [Bartonella schoenbuchensis R1]
          Length = 247

 Score = 76.1 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 33/59 (55%), Positives = 40/59 (67%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +++ F VP  + KH+ G  ILLIDDV TTG T   AA  LK+AGA  V +LTFSR LKD
Sbjct: 182 VQSTFKVPHKIKKHLKGRSILLIDDVLTTGETITAAAATLKRAGAQQVDVLTFSRVLKD 240


>gi|302875858|ref|YP_003844491.1| phosphoribosyltransferase [Clostridium cellulovorans 743B]
 gi|307689291|ref|ZP_07631737.1| phosphoribosyltransferase [Clostridium cellulovorans 743B]
 gi|302578715|gb|ADL52727.1| phosphoribosyltransferase [Clostridium cellulovorans 743B]
          Length = 225

 Score = 76.1 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 33/56 (58%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF + +     +A   IL++DDV TTGAT+ C    LK AGA  + +LT  +S
Sbjct: 168 LQGAFEINEKYKDSIANKNILIVDDVVTTGATSYCCYQQLKSAGAKKIKLLTLCKS 223


>gi|222053719|ref|YP_002536081.1| amidophosphoribosyltransferase-like protein [Geobacter sp. FRC-32]
 gi|221563008|gb|ACM18980.1| amidophosphoribosyltransferase-like protein [Geobacter sp. FRC-32]
          Length = 239

 Score = 76.1 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 40/59 (67%), Gaps = 2/59 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ AF V +   + VA  +I+LIDDV+TTG+T +  A  LKKAGA  + I+T +R+L +
Sbjct: 183 VKGAFAVAE--PERVADRRIILIDDVFTTGSTVEECAKTLKKAGAAEIFIITVARALSN 239


>gi|13472985|ref|NP_104552.1| hypothetical protein mll3453 [Mesorhizobium loti MAFF303099]
 gi|14023733|dbj|BAB50338.1| mll3453 [Mesorhizobium loti MAFF303099]
          Length = 240

 Score = 75.7 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 39/58 (67%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF VP      +AG ++LLIDDVYTTGAT + A  ALK+ GA  V +LTF+R L 
Sbjct: 172 VRAAFRVPAEAEIEIAGRRVLLIDDVYTTGATVRAATKALKRGGASAVDVLTFARVLP 229


>gi|319781332|ref|YP_004140808.1| phosphoribosyltransferase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317167220|gb|ADV10758.1| phosphoribosyltransferase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 266

 Score = 75.7 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 39/58 (67%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF VP      +AG ++LLIDDVYTTGAT + A  ALK+ GA  V +LTF+R L 
Sbjct: 198 VRAAFRVPAEAEIEIAGRRVLLIDDVYTTGATVRSATKALKRGGAAAVDVLTFARVLP 255


>gi|114704317|ref|ZP_01437225.1| hypothetical protein FP2506_05271 [Fulvimarina pelagi HTCC2506]
 gi|114539102|gb|EAU42222.1| hypothetical protein FP2506_05271 [Fulvimarina pelagi HTCC2506]
          Length = 249

 Score = 75.7 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 36/56 (64%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF V       V    +LLIDDV+TTG+T   A  ALK+AGA +V++LTF+R 
Sbjct: 189 VRGAFRVAPERYDRVMAKTVLLIDDVFTTGSTVASATKALKRAGAKSVNVLTFARV 244


>gi|227823196|ref|YP_002827168.1| putative competence protein F [Sinorhizobium fredii NGR234]
 gi|227342197|gb|ACP26415.1| putative competence protein F [Sinorhizobium fredii NGR234]
          Length = 281

 Score = 75.7 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/58 (46%), Positives = 39/58 (67%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF VP+     + G +I+L+DDVYTTGAT   A  ALK+A A  +++LTF+ +L 
Sbjct: 221 VRGAFAVPESARSGIEGKRIVLVDDVYTTGATVSAATRALKRARAGDITVLTFAMALS 278


>gi|71906257|ref|YP_283844.1| phosphoribosyltransferase [Dechloromonas aromatica RCB]
 gi|71845878|gb|AAZ45374.1| Phosphoribosyltransferase [Dechloromonas aromatica RCB]
          Length = 247

 Score = 75.7 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 34/58 (58%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF         ++G ++LLIDDV TTGAT    A  LK  GA +V++   +R+L+
Sbjct: 193 VRGAFE----CRTDLSGRRLLLIDDVMTTGATVNECARVLKLHGAASVTVAVIARALR 246


>gi|85708603|ref|ZP_01039669.1| amidophosphoribosyltransferase [Erythrobacter sp. NAP1]
 gi|85690137|gb|EAQ30140.1| amidophosphoribosyltransferase [Erythrobacter sp. NAP1]
          Length = 287

 Score = 75.7 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R A  V       + G  ++L+DDV T+GAT+     AL  AGA++V I  F+R +
Sbjct: 202 LRGAIEVRANAKGSITGRNVILVDDVLTSGATSDACTKALLDAGAVSVRIACFARVV 258


>gi|90420200|ref|ZP_01228108.1| competence protein F [Aurantimonas manganoxydans SI85-9A1]
 gi|90335534|gb|EAS49284.1| competence protein F [Aurantimonas manganoxydans SI85-9A1]
          Length = 249

 Score = 75.7 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 37/56 (66%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF V +     + G ++LL+DDVYTTGAT   A  ALK+AGA  V +LTF+R 
Sbjct: 189 VRGAFQVVETRRDELDGKRVLLVDDVYTTGATVASATRALKRAGARDVDVLTFARV 244


>gi|115522182|ref|YP_779093.1| phosphoribosyltransferase [Rhodopseudomonas palustris BisA53]
 gi|115516129|gb|ABJ04113.1| phosphoribosyltransferase [Rhodopseudomonas palustris BisA53]
          Length = 273

 Score = 75.7 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 33/57 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF VP      + G +ILL+DDV T+GAT    A AL +A A  V +  F+R +
Sbjct: 210 VQGAFKVPAERRAELQGRRILLVDDVLTSGATVDACARALLRAKAKAVDVAVFARVV 266


>gi|291619242|ref|YP_003521984.1| GntX [Pantoea ananatis LMG 20103]
 gi|291154272|gb|ADD78856.1| GntX [Pantoea ananatis LMG 20103]
 gi|327395571|dbj|BAK12993.1| protein GntX [Pantoea ananatis AJ13355]
          Length = 233

 Score = 75.3 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF +       V G  I LIDDV TTG+T +  +  L+  GA +V +    R+L
Sbjct: 181 LRGAFCL----ETDVNGRHIALIDDVVTTGSTVREISRLLQGRGAASVQVWCLCRTL 233


>gi|77461398|ref|YP_350905.1| phosphoribosyltransferase [Pseudomonas fluorescens Pf0-1]
 gi|77385401|gb|ABA76914.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1]
          Length = 246

 Score = 75.3 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +       V G  + L+DDV TTGATA+  A  L  AGA  V +   +R+ K
Sbjct: 186 LRHAFALSAD--AQVQGRHLALVDDVLTTGATAQALARLLMDAGAARVDVYCLARTPK 241


>gi|86747153|ref|YP_483649.1| phosphoribosyltransferase [Rhodopseudomonas palustris HaA2]
 gi|86570181|gb|ABD04738.1| Phosphoribosyltransferase [Rhodopseudomonas palustris HaA2]
          Length = 254

 Score = 75.3 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF VP      V G +I+L+DDV T+GAT    A AL +A A +V +L F+R +
Sbjct: 191 VQGAFKVPAERKAEVQGRRIVLVDDVLTSGATVDACARALLRAKAQSVDVLVFARVV 247


>gi|167031407|ref|YP_001666638.1| phosphoribosyltransferase [Pseudomonas putida GB-1]
 gi|166857895|gb|ABY96302.1| phosphoribosyltransferase [Pseudomonas putida GB-1]
          Length = 243

 Score = 75.3 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF V       + G  + ++DDV TTGATA+  A  L+KAGA  V +   +R+ K
Sbjct: 186 LRQAFAVT----GKLTGKHVAVVDDVLTTGATAQAIAQVLRKAGARQVDVYCLARTPK 239


>gi|271502335|ref|YP_003335361.1| phosphoribosyltransferase [Dickeya dadantii Ech586]
 gi|270345890|gb|ACZ78655.1| phosphoribosyltransferase [Dickeya dadantii Ech586]
          Length = 239

 Score = 75.3 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 24/59 (40%), Positives = 36/59 (61%), Gaps = 1/59 (1%)

Query: 1   MRNAFNVPQY-VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF   Q  +S+ VAG +++L+DDV TTG+TA   +  L +AGA  V +    R+L 
Sbjct: 181 LRGAFRCRQDAISQRVAGKRLVLLDDVVTTGSTAAEVSRTLLRAGAQHVQVWCVCRTLS 239


>gi|222149922|ref|YP_002550879.1| competence protein F [Agrobacterium vitis S4]
 gi|221736904|gb|ACM37867.1| competence protein F [Agrobacterium vitis S4]
          Length = 236

 Score = 75.3 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 39/57 (68%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF V +     V G  ++L+DDVYTTGAT   A  ALK+AGA+ V++LTF+ +L
Sbjct: 176 VRGAFKVAENRRDQVFGRHLVLVDDVYTTGATVSAATRALKRAGAVEVTVLTFAMAL 232


>gi|4768852|gb|AAD29646.1|AF124757_6 competence protein F [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 258

 Score = 74.9 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/60 (38%), Positives = 36/60 (60%), Gaps = 1/60 (1%)

Query: 1   MRNAFNVPQYVSKH-VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++NAF +        +AG  I+ IDDV+T+GAT +  A  LKKAG  +V +L ++R +  
Sbjct: 195 VKNAFGLRIGKKDRPLAGRDIIFIDDVFTSGATTESCARLLKKAGVKSVHVLCWARVIPQ 254


>gi|197104234|ref|YP_002129611.1| predicted amidophosphoribosyltransferase [Phenylobacterium zucineum
           HLK1]
 gi|196477654|gb|ACG77182.1| predicted amidophosphoribosyltransferase [Phenylobacterium zucineum
           HLK1]
          Length = 259

 Score = 74.9 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 35/56 (62%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  AF VP      V GL IL++DDV TTGATA+  A ALK AGA +V++   +R 
Sbjct: 196 VAGAFAVPPRRRTQVEGLNILVVDDVLTTGATAEGCARALKAAGATSVNVAVVARV 251


>gi|261884092|ref|ZP_06008131.1| competence protein F [Campylobacter fetus subsp. venerealis str.
           Azul-94]
          Length = 127

 Score = 74.9 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 31/59 (52%), Positives = 40/59 (67%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VP+    H++G ++LLIDD YTTGAT K A  AL + GA +V +LTFSR L D
Sbjct: 69  VDGAFRVPKEHEIHISGRRVLLIDDGYTTGATVKAATRALLRGGAKSVDVLTFSRVLPD 127


>gi|327482505|gb|AEA85815.1| phosphoribosyl transferase [Pseudomonas stutzeri DSM 4166]
          Length = 234

 Score = 74.9 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +       V G  + L+DDV TTGATA+  A  LK+AGA  V +   +R+ K
Sbjct: 176 LRQAFAIATG--ADVKGRHLALVDDVLTTGATAEALARLLKRAGAERVDVYCLARTPK 231


>gi|330967246|gb|EGH67506.1| competence protein ComF [Pseudomonas syringae pv. actinidiae str.
           M302091]
          Length = 244

 Score = 74.9 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF+V       V G  + LIDDV TTG+TA+  A  L  AGA  V +   +R+ K
Sbjct: 186 LRGAFSVIDA--DWVQGKHLALIDDVLTTGSTAEVIARLLNNAGARRVDVYCLARTPK 241


>gi|330954916|gb|EGH55176.1| phosphoribosyltransferase [Pseudomonas syringae Cit 7]
          Length = 244

 Score = 74.9 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +       V G  + L+DDV TTG+TA+  A  L KAGA  V +   +R+ K
Sbjct: 186 LRGAFTLVD--PDWVQGKHLALVDDVLTTGSTAEVIARLLNKAGARRVDVYCLARTPK 241


>gi|146284179|ref|YP_001174332.1| phosphoribosyl transferase [Pseudomonas stutzeri A1501]
 gi|145572384|gb|ABP81490.1| probable phosphoribosyl transferase [Pseudomonas stutzeri A1501]
          Length = 234

 Score = 74.5 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +       V G  + L+DDV TTGATA+  A  LK+AGA  V +   +R+ K
Sbjct: 176 LRQAFAIATG--ADVKGRHLALVDDVLTTGATAEALARLLKRAGAERVDVYCLARTPK 231


>gi|260752407|ref|YP_003225300.1| phosphoribosyltransferase [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|258551770|gb|ACV74716.1| phosphoribosyltransferase [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 281

 Score = 74.5 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 23/59 (38%), Positives = 36/59 (61%), Gaps = 1/59 (1%)

Query: 1   MRNAFNVPQYVSKH-VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++NAF +        +AG  I+LIDDV+T+GAT +  A  LK AG  +V +L ++R + 
Sbjct: 218 VKNAFGLRIGKKDRPLAGRDIILIDDVFTSGATTESCARLLKTAGVKSVHVLCWARVIP 276


>gi|241762015|ref|ZP_04760099.1| amidophosphoribosyltransferase [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|241373481|gb|EER63068.1| amidophosphoribosyltransferase [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
          Length = 281

 Score = 74.5 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 23/59 (38%), Positives = 36/59 (61%), Gaps = 1/59 (1%)

Query: 1   MRNAFNVPQYVSKH-VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++NAF +        +AG  I+LIDDV+T+GAT +  A  LK AG  +V +L ++R + 
Sbjct: 218 VKNAFGLRIGKKDRPLAGRDIILIDDVFTSGATTESCARLLKTAGVKSVHVLCWARVIP 276


>gi|302185790|ref|ZP_07262463.1| phosphoribosyltransferase [Pseudomonas syringae pv. syringae 642]
          Length = 244

 Score = 74.5 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +       V G  + LIDDV TTG+TA+  A  L KAGA  V +   +R+ K
Sbjct: 186 LRGAFTLVD--PDWVQGRHLALIDDVVTTGSTAEVIARLLNKAGARRVDVYCLARTPK 241


>gi|325203384|gb|ADY98837.1| comF/gntX family protein [Neisseria meningitidis M01-240355]
          Length = 241

 Score = 74.5 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF + + +     G  ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIREPLP---KGCNILLIDDVFTTGATLDELAKMLKKSGANRICCWTLART 237


>gi|307132918|ref|YP_003884934.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system [Dickeya
           dadantii 3937]
 gi|306530447|gb|ADN00378.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system [Dickeya
           dadantii 3937]
          Length = 234

 Score = 74.5 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF         V G +++L+DDV TTG+TA   + AL+ AGA  V +    R+L 
Sbjct: 181 LRGAFA----CRHDVDGKRLVLLDDVVTTGSTAAEVSRALRHAGARQVQVWCLCRTLS 234


>gi|91787139|ref|YP_548091.1| hypothetical protein Bpro_1242 [Polaromonas sp. JS666]
 gi|91696364|gb|ABE43193.1| conserved hypothetical protein [Polaromonas sp. JS666]
          Length = 271

 Score = 74.5 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  AF V       + G ++LL+DDV T+GA+   AA AL++AGA  ++ +  +R+
Sbjct: 215 VEGAFLVDPLRVGELEGRRVLLVDDVMTSGASLFTAARALREAGAAHITAVVLART 270


>gi|302036453|ref|YP_003796775.1| putative phosphoribosyltransferase [Candidatus Nitrospira defluvii]
 gi|300604517|emb|CBK40849.1| putative Phosphoribosyltransferase [Candidatus Nitrospira defluvii]
          Length = 270

 Score = 74.5 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 26/57 (45%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +  AF +       V G +IL+IDDV+TTG TA   A  L  AGA  V++LT +RSL
Sbjct: 193 LHRAFAL--RAPGEVTGKRILIIDDVFTTGTTANECAKVLLNAGAKDVAVLTLARSL 247


>gi|146313458|ref|YP_001178532.1| gluconate periplasmic binding protein [Enterobacter sp. 638]
 gi|145320334|gb|ABP62481.1| putative competence protein [Enterobacter sp. 638]
          Length = 227

 Score = 74.5 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF    ++   V G  I ++DDV TTG+T    +  L ++GA +V +    R+L
Sbjct: 175 LKNAF----HLELSVKGRHIAIVDDVVTTGSTVAELSRLLLQSGAASVQVWCLCRTL 227


>gi|182678125|ref|YP_001832271.1| phosphoribosyltransferase [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182634008|gb|ACB94782.1| phosphoribosyltransferase [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 264

 Score = 74.5 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 33/57 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           M+ AF VP+     V G  I+L+DDV T+GAT   AA  L +  A  V +L F+R +
Sbjct: 208 MQGAFVVPEEARSRVEGRSIVLVDDVLTSGATLNAAARVLLRHRAARVDVLVFARVI 264


>gi|167038183|ref|YP_001665761.1| phosphoribosyltransferase [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|167039108|ref|YP_001662093.1| phosphoribosyltransferase [Thermoanaerobacter sp. X514]
 gi|300913302|ref|ZP_07130619.1| phosphoribosyltransferase [Thermoanaerobacter sp. X561]
 gi|307723684|ref|YP_003903435.1| phosphoribosyltransferase [Thermoanaerobacter sp. X513]
 gi|320116592|ref|YP_004186751.1| phosphoribosyltransferase [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|166853348|gb|ABY91757.1| phosphoribosyltransferase [Thermoanaerobacter sp. X514]
 gi|166857017|gb|ABY95425.1| phosphoribosyltransferase [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|300889987|gb|EFK85132.1| phosphoribosyltransferase [Thermoanaerobacter sp. X561]
 gi|307580745|gb|ADN54144.1| phosphoribosyltransferase [Thermoanaerobacter sp. X513]
 gi|319929683|gb|ADV80368.1| phosphoribosyltransferase [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
          Length = 229

 Score = 74.5 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF V       + G  +LL+DDV TTGAT    A  LK+ GA  V + T +
Sbjct: 173 VKGAFKVT--YKDTIVGKNVLLVDDVLTTGATLDECAKVLKENGAKDVYVATIA 224


>gi|85713804|ref|ZP_01044794.1| phosphoribosyltransferase [Nitrobacter sp. Nb-311A]
 gi|85699708|gb|EAQ37575.1| phosphoribosyltransferase [Nitrobacter sp. Nb-311A]
          Length = 269

 Score = 74.1 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 34/57 (59%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF V    S HV G +++LIDDV T+GAT    A  L +A A  V +L F+R +
Sbjct: 206 VQGAFKVAAERSSHVQGRRVILIDDVLTSGATVDACARVLLRAKAAQVDVLVFARVV 262


>gi|329847920|ref|ZP_08262948.1| phosphoribosyl transferase domain protein [Asticcacaulis
           biprosthecum C19]
 gi|328842983|gb|EGF92552.1| phosphoribosyl transferase domain protein [Asticcacaulis
           biprosthecum C19]
          Length = 272

 Score = 74.1 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 38/59 (64%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF V    +K VAG +++LIDDV+TTGAT K     L KAGA  V +   +R++++
Sbjct: 212 VRKAFAVSASGAKAVAGKRVVLIDDVFTTGATLKACTRELLKAGAAQVDVAVLARAVQE 270


>gi|331649211|ref|ZP_08350297.1| protein GntX [Escherichia coli M605]
 gi|331041709|gb|EGI13853.1| protein GntX [Escherichia coli M605]
          Length = 243

 Score = 74.1 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 191 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 243


>gi|209965933|ref|YP_002298848.1| competence protein F [Rhodospirillum centenum SW]
 gi|209959399|gb|ACJ00036.1| competence protein F [Rhodospirillum centenum SW]
          Length = 263

 Score = 74.1 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 36/58 (62%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +  AF V       V G +I+L+DDV+TTGAT +  A  LK+AGA  V +LT +R ++
Sbjct: 201 VAGAFAVRAACRDRVRGARIVLLDDVFTTGATVEECARVLKRAGAARVDVLTLARVVR 258


>gi|317049908|ref|YP_004117556.1| phosphoribosyltransferase [Pantoea sp. At-9b]
 gi|316951525|gb|ADU71000.1| phosphoribosyltransferase [Pantoea sp. At-9b]
          Length = 225

 Score = 74.1 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF +       V G  ILLIDDV TTG+T    +  L+ AGA +V I    R+L
Sbjct: 173 LRGAFRL----EIPVTGRHILLIDDVVTTGSTVAEISRMLQAAGAASVQIGCLCRTL 225


>gi|110807248|ref|YP_690768.1| gluconate periplasmic binding protein [Shigella flexneri 5 str.
           8401]
 gi|332281959|ref|ZP_08394372.1| conserved hypothetical protein [Shigella sp. D9]
 gi|30043564|gb|AAP19284.1| hypothetical protein S4330 [Shigella flexneri 2a str. 2457T]
 gi|56383886|gb|AAN44897.2| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|110616796|gb|ABF05463.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|281602767|gb|ADA75751.1| gluconate periplasmic binding protein [Shigella flexneri 2002017]
 gi|332104311|gb|EGJ07657.1| conserved hypothetical protein [Shigella sp. D9]
          Length = 243

 Score = 74.1 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 191 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 243


>gi|320326429|gb|EFW82482.1| competence protein ComF [Pseudomonas syringae pv. glycinea str.
           B076]
          Length = 244

 Score = 74.1 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +       V G  + L+DDV TTG+TA+  A  L KAGA  V +   +R+ K
Sbjct: 186 LRDAFTLVD--PDRVQGKHLALVDDVLTTGSTAEVIARLLNKAGARRVDVYCLARTPK 241


>gi|26110443|gb|AAN82628.1|AE016768_46 Hypothetical protein yhgH [Escherichia coli CFT073]
          Length = 248

 Score = 74.1 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 196 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 248


>gi|315122266|ref|YP_004062755.1| competence protein F, putative [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495668|gb|ADR52267.1| competence protein F, putative [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 214

 Score = 74.1 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 45/59 (76%), Positives = 53/59 (89%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           + NAF+VPQY  K++AG KILLIDDVYTTGATA+ AAIALKKAGA ++SILTFSRSLK+
Sbjct: 156 LHNAFHVPQYAQKYIAGFKILLIDDVYTTGATAQYAAIALKKAGAKSISILTFSRSLKN 214


>gi|284822068|gb|ADB98038.1| gluconate periplasmic binding protein [Escherichia coli]
          Length = 243

 Score = 74.1 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 191 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 243


>gi|331654991|ref|ZP_08355990.1| protein GntX [Escherichia coli M718]
 gi|331047006|gb|EGI19084.1| protein GntX [Escherichia coli M718]
          Length = 243

 Score = 74.1 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 191 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 243


>gi|213967736|ref|ZP_03395883.1| competence protein ComF [Pseudomonas syringae pv. tomato T1]
 gi|301382373|ref|ZP_07230791.1| competence protein ComF, putative [Pseudomonas syringae pv. tomato
           Max13]
 gi|302062356|ref|ZP_07253897.1| competence protein ComF, putative [Pseudomonas syringae pv. tomato
           K40]
 gi|302130674|ref|ZP_07256664.1| competence protein ComF, putative [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|213927512|gb|EEB61060.1| competence protein ComF [Pseudomonas syringae pv. tomato T1]
          Length = 244

 Score = 74.1 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +       V G  + L+DDV TTG+TA+  A  L  AGA  V +   +R+ K
Sbjct: 186 LRGAFALID--PDWVHGKHLALVDDVLTTGSTAEVIARLLNSAGARRVDVYCLARTPK 241


>gi|194435591|ref|ZP_03067694.1| protein GntX [Escherichia coli 101-1]
 gi|194425134|gb|EDX41118.1| protein GntX [Escherichia coli 101-1]
          Length = 248

 Score = 74.1 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 196 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 248


>gi|28867723|ref|NP_790342.1| competence protein ComF [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|28850958|gb|AAO54037.1| competence protein ComF, putative [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|331015040|gb|EGH95096.1| competence protein ComF, putative [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 244

 Score = 74.1 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +       V G  + L+DDV TTG+TA+  A  L  AGA  V +   +R+ K
Sbjct: 186 LRGAFALID--PDWVHGKHLALVDDVLTTGSTAEVIARLLNSAGARRVDVYCLARTPK 241


>gi|331674901|ref|ZP_08375658.1| protein GntX [Escherichia coli TA280]
 gi|331067810|gb|EGI39208.1| protein GntX [Escherichia coli TA280]
          Length = 243

 Score = 73.8 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 191 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 243


>gi|301019566|ref|ZP_07183728.1| ComF family protein [Escherichia coli MS 69-1]
 gi|300399191|gb|EFJ82729.1| ComF family protein [Escherichia coli MS 69-1]
          Length = 227

 Score = 73.8 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|187775692|ref|ZP_02992680.1| protein GntX [Escherichia coli O157:H7 str. EC4196]
 gi|188024504|ref|ZP_02772131.2| protein GntX [Escherichia coli O157:H7 str. EC4113]
 gi|189010096|ref|ZP_02804504.2| protein GntX [Escherichia coli O157:H7 str. EC4076]
 gi|189402773|ref|ZP_02790768.2| protein GntX [Escherichia coli O157:H7 str. EC4486]
 gi|189403746|ref|ZP_02784445.2| protein GntX [Escherichia coli O157:H7 str. EC4501]
 gi|189404697|ref|ZP_02810225.2| protein GntX [Escherichia coli O157:H7 str. EC869]
 gi|208809535|ref|ZP_03251872.1| protein GntX [Escherichia coli O157:H7 str. EC4206]
 gi|208813850|ref|ZP_03255179.1| protein GntX [Escherichia coli O157:H7 str. EC4045]
 gi|208821693|ref|ZP_03262013.1| protein GntX [Escherichia coli O157:H7 str. EC4042]
 gi|209396165|ref|YP_002272849.1| protein GntX [Escherichia coli O157:H7 str. EC4115]
 gi|217324234|ref|ZP_03440318.1| protein GntX [Escherichia coli O157:H7 str. TW14588]
 gi|187771691|gb|EDU35535.1| protein GntX [Escherichia coli O157:H7 str. EC4196]
 gi|188018351|gb|EDU56473.1| protein GntX [Escherichia coli O157:H7 str. EC4113]
 gi|189002345|gb|EDU71331.1| protein GntX [Escherichia coli O157:H7 str. EC4076]
 gi|189364761|gb|EDU83180.1| protein GntX [Escherichia coli O157:H7 str. EC4486]
 gi|189369879|gb|EDU88295.1| protein GntX [Escherichia coli O157:H7 str. EC4501]
 gi|189374500|gb|EDU92916.1| protein GntX [Escherichia coli O157:H7 str. EC869]
 gi|208729336|gb|EDZ78937.1| protein GntX [Escherichia coli O157:H7 str. EC4206]
 gi|208735127|gb|EDZ83814.1| protein GntX [Escherichia coli O157:H7 str. EC4045]
 gi|208741816|gb|EDZ89498.1| protein GntX [Escherichia coli O157:H7 str. EC4042]
 gi|209157565|gb|ACI34998.1| protein GntX [Escherichia coli O157:H7 str. EC4115]
 gi|217320455|gb|EEC28879.1| protein GntX [Escherichia coli O157:H7 str. TW14588]
          Length = 248

 Score = 73.8 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 196 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 248


>gi|254038580|ref|ZP_04872636.1| GntX [Escherichia sp. 1_1_43]
 gi|331644113|ref|ZP_08345242.1| protein GntX [Escherichia coli H736]
 gi|606348|gb|AAA58211.1| ORF_o243 [Escherichia coli str. K-12 substr. MG1655]
 gi|226839086|gb|EEH71109.1| GntX [Escherichia sp. 1_1_43]
 gi|331036407|gb|EGI08633.1| protein GntX [Escherichia coli H736]
          Length = 243

 Score = 73.8 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA  V +    R+L
Sbjct: 191 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAAAVQVWCLCRTL 243


>gi|225023962|ref|ZP_03713154.1| hypothetical protein EIKCOROL_00829 [Eikenella corrodens ATCC
           23834]
 gi|224942987|gb|EEG24196.1| hypothetical protein EIKCOROL_00829 [Eikenella corrodens ATCC
           23834]
          Length = 302

 Score = 73.8 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +   F V       V    +LLIDDV T+GAT    A  L++AGA  V    F+R+
Sbjct: 248 VHGIFQVASA--ADVKNRHVLLIDDVVTSGATIGELARTLQRAGAAAVYGWVFARA 301


>gi|237703143|ref|ZP_04533624.1| gluconate periplasmic binding protein [Escherichia sp. 3_2_53FAA]
 gi|91074462|gb|ABE09343.1| hypothetical protein YhgH [Escherichia coli UTI89]
 gi|226902407|gb|EEH88666.1| gluconate periplasmic binding protein [Escherichia sp. 3_2_53FAA]
          Length = 248

 Score = 73.8 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 196 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 248


>gi|330909446|gb|EGH37960.1| hypothetical protein ECAA86_03648 [Escherichia coli AA86]
          Length = 227

 Score = 73.8 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|120612548|ref|YP_972226.1| ComF family protein [Acidovorax citrulli AAC00-1]
 gi|120591012|gb|ABM34452.1| ComF family protein [Acidovorax citrulli AAC00-1]
          Length = 238

 Score = 73.8 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 30/56 (53%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +   F V    +  V G  I+L+DDV TTGAT   AA  L +AGA  V  +  +R+
Sbjct: 182 LDGVFAVAPDRAARVRGQGIVLVDDVMTTGATLHAAARVLLQAGAARVDAVVLART 237


>gi|83859693|ref|ZP_00953213.1| phosphoribosyltransferase [Oceanicaulis alexandrii HTCC2633]
 gi|83852052|gb|EAP89906.1| phosphoribosyltransferase [Oceanicaulis alexandrii HTCC2633]
          Length = 185

 Score = 73.8 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 36/58 (62%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +  AF V +     V G + +L+DDV+TTGAT +  A  LK+AGA  V+ +T +R +K
Sbjct: 122 VAGAFMVREAAKPFVQGRRFVLVDDVHTTGATLQACARVLKRAGAEDVTAITLARVVK 179


>gi|290969085|ref|ZP_06560618.1| ComF family protein [Megasphaera genomosp. type_1 str. 28L]
 gi|290780882|gb|EFD93477.1| ComF family protein [Megasphaera genomosp. type_1 str. 28L]
          Length = 220

 Score = 73.8 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 32/54 (59%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++NAF +    +  V G  I+++DD+YTTGAT    A  LKK GA  ++ L  +
Sbjct: 163 IKNAFAIKGNCASMVKGRHIIVVDDIYTTGATLDGCARVLKKHGAAMITGLVMA 216


>gi|215488694|ref|YP_002331125.1| gluconate periplasmic binding protein [Escherichia coli O127:H6
           str. E2348/69]
 gi|215266766|emb|CAS11206.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli O127:H6 str. E2348/69]
          Length = 227

 Score = 73.8 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|110643646|ref|YP_671376.1| gluconate periplasmic binding protein [Escherichia coli 536]
 gi|191171572|ref|ZP_03033120.1| protein GntX [Escherichia coli F11]
 gi|300987299|ref|ZP_07178107.1| ComF family protein [Escherichia coli MS 200-1]
 gi|110345238|gb|ABG71475.1| putative amidophosphoribosyltransferase [Escherichia coli 536]
 gi|190908199|gb|EDV67790.1| protein GntX [Escherichia coli F11]
 gi|300306167|gb|EFJ60687.1| ComF family protein [Escherichia coli MS 200-1]
 gi|324014595|gb|EGB83814.1| ComF family protein [Escherichia coli MS 60-1]
          Length = 227

 Score = 73.8 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|331679477|ref|ZP_08380147.1| protein GntX [Escherichia coli H591]
 gi|73857392|gb|AAZ90099.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|331072649|gb|EGI43974.1| protein GntX [Escherichia coli H591]
          Length = 243

 Score = 73.8 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 191 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 243


>gi|319764159|ref|YP_004128096.1| phosphoribosyltransferase [Alicycliphilus denitrificans BC]
 gi|330826484|ref|YP_004389787.1| phosphoribosyltransferase [Alicycliphilus denitrificans K601]
 gi|317118720|gb|ADV01209.1| phosphoribosyltransferase [Alicycliphilus denitrificans BC]
 gi|329311856|gb|AEB86271.1| phosphoribosyltransferase [Alicycliphilus denitrificans K601]
          Length = 245

 Score = 73.8 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 36/56 (64%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF +   ++   +G ++LL+DDV TTGAT   AA  L++AGA  V+ +  +R+
Sbjct: 189 LRGAFMLDPLLAAQASGRRVLLVDDVMTTGATLHAAAAPLREAGARHVAAIVLART 244


>gi|187250530|ref|YP_001875012.1| phosphoribosyltransferase [Elusimicrobium minutum Pei191]
 gi|186970690|gb|ACC97675.1| Phosphoribosyltransferase [Elusimicrobium minutum Pei191]
          Length = 245

 Score = 73.8 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 34/55 (61%), Gaps = 4/55 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           M+NAF      +  + G  ILLIDDV TTG+T +  A ALKKAGA  +  LT +R
Sbjct: 190 MKNAFK----AAGKITGKTILLIDDVATTGSTLEACAEALKKAGAKNIYALTIAR 240


>gi|12518043|gb|AAG58514.1|AE005563_8 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|13363729|dbj|BAB37678.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|209756448|gb|ACI76536.1| hypothetical protein ECs4254 [Escherichia coli]
 gi|209756450|gb|ACI76537.1| hypothetical protein ECs4254 [Escherichia coli]
 gi|209756452|gb|ACI76538.1| hypothetical protein ECs4254 [Escherichia coli]
 gi|209756454|gb|ACI76539.1| hypothetical protein ECs4254 [Escherichia coli]
 gi|209756456|gb|ACI76540.1| hypothetical protein ECs4254 [Escherichia coli]
          Length = 243

 Score = 73.8 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 191 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 243


>gi|85706922|ref|ZP_01038012.1| competence protein F, putative [Roseovarius sp. 217]
 gi|85668533|gb|EAQ23404.1| competence protein F, putative [Roseovarius sp. 217]
          Length = 232

 Score = 73.8 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 35/59 (59%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           + +A  V       +AG  IL++DDV T+GAT   AA A   AGA  VSILT +R+ KD
Sbjct: 173 LADAIRVHPRHRARMAGRFILIVDDVMTSGATLSVAAQACFSAGAGEVSILTLARAAKD 231


>gi|281180445|dbj|BAI56775.1| conserved hypothetical protein [Escherichia coli SE15]
          Length = 227

 Score = 73.8 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|117625678|ref|YP_859001.1| gluconate periplasmic binding protein [Escherichia coli APEC O1]
 gi|81247180|gb|ABB67888.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|115514802|gb|ABJ02877.1| conserved hypothetical protein [Escherichia coli APEC O1]
          Length = 243

 Score = 73.8 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 191 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 243


>gi|300919300|ref|ZP_07135814.1| ComF family protein [Escherichia coli MS 115-1]
 gi|300413615|gb|EFJ96925.1| ComF family protein [Escherichia coli MS 115-1]
          Length = 227

 Score = 73.8 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|289577708|ref|YP_003476335.1| phosphoribosyltransferase [Thermoanaerobacter italicus Ab9]
 gi|289527421|gb|ADD01773.1| phosphoribosyltransferase [Thermoanaerobacter italicus Ab9]
          Length = 229

 Score = 73.8 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF V       + G  +LL+DDV TTGAT    A  LK+ GA  V + T +
Sbjct: 173 VKGAFKVT--YKDTIIGKNVLLVDDVLTTGATLDECAKVLKENGAKDVYVATIA 224


>gi|70732979|ref|YP_262752.1| competence protein ComF [Pseudomonas fluorescens Pf-5]
 gi|68347278|gb|AAY94884.1| competence protein ComF [Pseudomonas fluorescens Pf-5]
          Length = 246

 Score = 73.8 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +       VAG  + L+DDV TTGATA+  A  L  AGA  V I   +R+  
Sbjct: 186 LRQAFALAD--QAQVAGRHLALVDDVLTTGATAQALARLLINAGARRVDIYCLARTPS 241


>gi|312968275|ref|ZP_07782485.1| protein gntX [Escherichia coli 2362-75]
 gi|312287100|gb|EFR15010.1| protein gntX [Escherichia coli 2362-75]
          Length = 215

 Score = 73.8 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|323188997|gb|EFZ74281.1| protein gntX [Escherichia coli RN587/1]
          Length = 215

 Score = 73.8 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|293453719|ref|ZP_06664138.1| gluconate periplasmic binding protein [Escherichia coli B088]
 gi|291321845|gb|EFE61276.1| gluconate periplasmic binding protein [Escherichia coli B088]
          Length = 227

 Score = 73.4 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|161485822|ref|NP_709190.3| gluconate periplasmic binding protein [Shigella flexneri 2a str.
           301]
 gi|161486382|ref|NP_839473.2| gluconate periplasmic binding protein [Shigella flexneri 2a str.
           2457T]
 gi|193068814|ref|ZP_03049774.1| protein GntX [Escherichia coli E110019]
 gi|194431130|ref|ZP_03063423.1| protein GntX [Shigella dysenteriae 1012]
 gi|218550671|ref|YP_002384462.1| gluconate periplasmic binding protein [Escherichia fergusonii ATCC
           35469]
 gi|218697096|ref|YP_002404763.1| gluconate periplasmic binding protein [Escherichia coli 55989]
 gi|256020758|ref|ZP_05434623.1| gluconate periplasmic binding protein [Shigella sp. D9]
 gi|260857520|ref|YP_003231411.1| gluconate periplasmic binding protein GntX [Escherichia coli
           O26:H11 str. 11368]
 gi|260870139|ref|YP_003236541.1| gluconate periplasmic binding protein GntX [Escherichia coli
           O111:H- str. 11128]
 gi|307311922|ref|ZP_07591560.1| comF family protein [Escherichia coli W]
 gi|51701421|sp|Q83J92|GNTX_SHIFL RecName: Full=Protein GntX
 gi|192957890|gb|EDV88333.1| protein GntX [Escherichia coli E110019]
 gi|194420585|gb|EDX36661.1| protein GntX [Shigella dysenteriae 1012]
 gi|218353828|emb|CAV00184.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli 55989]
 gi|218358212|emb|CAQ90859.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia fergusonii ATCC 35469]
 gi|257756169|dbj|BAI27671.1| gluconate periplasmic binding protein GntX [Escherichia coli
           O26:H11 str. 11368]
 gi|257766495|dbj|BAI37990.1| gluconate periplasmic binding protein GntX [Escherichia coli
           O111:H- str. 11128]
 gi|306908066|gb|EFN38566.1| comF family protein [Escherichia coli W]
 gi|313647285|gb|EFS11737.1| protein gntX [Shigella flexneri 2a str. 2457T]
 gi|315062691|gb|ADT77018.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli W]
 gi|320199586|gb|EFW74176.1| gluconate periplasmic binding protein [Escherichia coli EC4100B]
 gi|323154248|gb|EFZ40451.1| protein gntX [Escherichia coli EPECa14]
 gi|323376721|gb|ADX48989.1| comF family protein [Escherichia coli KO11]
 gi|324111726|gb|EGC05706.1| comF family protein [Escherichia fergusonii B253]
 gi|332749485|gb|EGJ79902.1| protein gntX [Shigella flexneri K-671]
 gi|332750332|gb|EGJ80743.1| protein gntX [Shigella flexneri 4343-70]
 gi|332996396|gb|EGK16023.1| protein gntX [Shigella flexneri VA-6]
 gi|332997062|gb|EGK16678.1| protein gntX [Shigella flexneri K-218]
          Length = 227

 Score = 73.4 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|319945284|ref|ZP_08019546.1| competence protein F [Lautropia mirabilis ATCC 51599]
 gi|319741854|gb|EFV94279.1| competence protein F [Lautropia mirabilis ATCC 51599]
          Length = 262

 Score = 73.4 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF+VP      V+G  + L+DDV T+G T   AA  L  AGA +V  L  +R+
Sbjct: 208 LRGAFSVPDPKR--VSGQHLALVDDVMTSGNTLNEAAQTLLAAGAASVMALVVART 261


>gi|84500737|ref|ZP_00998986.1| competence protein F, putative [Oceanicola batsensis HTCC2597]
 gi|84391690|gb|EAQ04022.1| competence protein F, putative [Oceanicola batsensis HTCC2597]
          Length = 244

 Score = 73.4 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 39/58 (67%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           + +A  V    +  VAG  +LLIDDV T+GAT   A  ALK+AGA +VS+LT +R++K
Sbjct: 185 LHDAVTVNPRRAGRVAGGSVLLIDDVMTSGATLTAATGALKRAGAASVSVLTLARAVK 242


>gi|254558820|ref|YP_003065915.1| phosphoribosyltransferase [Methylobacterium extorquens DM4]
 gi|254266098|emb|CAX21850.1| putative phosphoribosyltransferase [Methylobacterium extorquens
           DM4]
          Length = 255

 Score = 73.4 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 38/59 (64%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ AF VP+     +AG ++LLIDDV TTGAT   AA  L + GA +V +LTF+   +D
Sbjct: 195 LQGAFRVPEDARSRIAGRRLLLIDDVATTGATGNAAARVLLRGGAASVDLLTFATVTRD 253


>gi|297537770|ref|YP_003673539.1| phosphoribosyltransferase [Methylotenera sp. 301]
 gi|297257117|gb|ADI28962.1| phosphoribosyltransferase [Methylotenera sp. 301]
          Length = 223

 Score = 73.4 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++ AF V  +    + G +I ++DDV TTGA+    A  LK+AGA  V     +R+L 
Sbjct: 169 IKGAFTVSNH----LNGKRIAIVDDVMTTGASLNELAKTLKQAGAAHVECWVVARTLP 222


>gi|323966226|gb|EGB61662.1| comF family protein [Escherichia coli M863]
 gi|327251049|gb|EGE62742.1| protein gntX [Escherichia coli STEC_7v]
          Length = 227

 Score = 73.4 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|320181905|gb|EFW56811.1| gluconate periplasmic binding protein [Shigella boydii ATCC 9905]
          Length = 227

 Score = 73.4 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|293412831|ref|ZP_06655499.1| gluconate periplasmic binding protein [Escherichia coli B354]
 gi|300907443|ref|ZP_07125090.1| ComF family protein [Escherichia coli MS 84-1]
 gi|301302292|ref|ZP_07208424.1| ComF family protein [Escherichia coli MS 124-1]
 gi|291468478|gb|EFF10971.1| gluconate periplasmic binding protein [Escherichia coli B354]
 gi|300400858|gb|EFJ84396.1| ComF family protein [Escherichia coli MS 84-1]
 gi|300842455|gb|EFK70215.1| ComF family protein [Escherichia coli MS 124-1]
 gi|315256004|gb|EFU35972.1| ComF family protein [Escherichia coli MS 85-1]
          Length = 227

 Score = 73.4 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|218691689|ref|YP_002399901.1| gluconate periplasmic binding protein [Escherichia coli ED1a]
 gi|306816249|ref|ZP_07450387.1| gluconate periplasmic binding protein [Escherichia coli NC101]
 gi|218429253|emb|CAR10064.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli ED1a]
 gi|305850645|gb|EFM51102.1| gluconate periplasmic binding protein [Escherichia coli NC101]
 gi|320197372|gb|EFW71987.1| gluconate periplasmic binding protein [Escherichia coli WV_060327]
          Length = 227

 Score = 73.4 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|218707004|ref|YP_002414523.1| gluconate periplasmic binding protein [Escherichia coli UMN026]
 gi|300898898|ref|ZP_07117199.1| ComF family protein [Escherichia coli MS 198-1]
 gi|331665019|ref|ZP_08365920.1| protein GntX [Escherichia coli TA143]
 gi|218434101|emb|CAR15018.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli UMN026]
 gi|284923405|emb|CBG36499.1| putative competence protein [Escherichia coli 042]
 gi|300357460|gb|EFJ73330.1| ComF family protein [Escherichia coli MS 198-1]
 gi|331057529|gb|EGI29515.1| protein GntX [Escherichia coli TA143]
          Length = 227

 Score = 73.4 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|157158776|ref|YP_001464871.1| gluconate periplasmic binding protein [Escherichia coli E24377A]
 gi|157080806|gb|ABV20514.1| protein GntX [Escherichia coli E24377A]
          Length = 227

 Score = 73.4 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|218528400|ref|YP_002419216.1| competence protein F [Methylobacterium chloromethanicum CM4]
 gi|218520703|gb|ACK81288.1| competence protein F [Methylobacterium chloromethanicum CM4]
          Length = 255

 Score = 73.4 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 38/59 (64%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ AF VP+     +AG ++LLIDDV TTGAT   AA  L + GA +V +LTF+   +D
Sbjct: 195 LQGAFRVPEDARSRIAGRRLLLIDDVATTGATGNAAARVLLRGGAASVDLLTFATVTRD 253


>gi|323179061|gb|EFZ64635.1| protein gntX [Escherichia coli 1180]
 gi|325498955|gb|EGC96814.1| gluconate periplasmic binding protein [Escherichia fergusonii
           ECD227]
 gi|332086008|gb|EGI91172.1| protein gntX [Shigella dysenteriae 155-74]
 gi|332751297|gb|EGJ81700.1| protein gntX [Shigella flexneri 2747-71]
 gi|332763600|gb|EGJ93839.1| comF family protein [Shigella flexneri 2930-71]
 gi|332996635|gb|EGK16260.1| protein gntX [Shigella flexneri K-272]
 gi|333012517|gb|EGK31898.1| protein gntX [Shigella flexneri K-304]
 gi|333013044|gb|EGK32420.1| protein gntX [Shigella flexneri K-227]
          Length = 215

 Score = 73.4 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|154252188|ref|YP_001413012.1| phosphoribosyltransferase [Parvibaculum lavamentivorans DS-1]
 gi|154156138|gb|ABS63355.1| phosphoribosyltransferase [Parvibaculum lavamentivorans DS-1]
          Length = 258

 Score = 73.4 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 34/58 (58%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +  AF +   V+  V   +I+LIDDV TTGATA+  A  L  AGA  VS+L  +R + 
Sbjct: 195 VAGAFRLAPGVAPLVKDRRIVLIDDVMTTGATAEACARVLTGAGAREVSVLCLARVVP 252


>gi|304397830|ref|ZP_07379706.1| phosphoribosyltransferase [Pantoea sp. aB]
 gi|304354541|gb|EFM18912.1| phosphoribosyltransferase [Pantoea sp. aB]
          Length = 226

 Score = 73.4 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF +       V G  I L+DDV TTG+T    +  L   GA +V +    R+L
Sbjct: 174 LRGAFRL----EMAVQGRHIALLDDVITTGSTVDEISRLLLAQGAASVQVWCLCRTL 226


>gi|254293167|ref|YP_003059190.1| phosphoribosyltransferase [Hirschia baltica ATCC 49814]
 gi|254041698|gb|ACT58493.1| phosphoribosyltransferase [Hirschia baltica ATCC 49814]
          Length = 232

 Score = 73.4 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 40/58 (68%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +  AF++ +   K +AG ++LL+DDVYTTGAT +    ALK++GA +V ++T SR + 
Sbjct: 169 VEGAFHIAERHRKKLAGKRVLLVDDVYTTGATVEACCRALKRSGATSVDVITLSRVVS 226


>gi|300985359|ref|ZP_07177415.1| ComF family protein [Escherichia coli MS 45-1]
 gi|300408100|gb|EFJ91638.1| ComF family protein [Escherichia coli MS 45-1]
          Length = 227

 Score = 73.4 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|89110597|ref|AP_004377.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli str. K-12 substr. W3110]
 gi|90111589|ref|NP_417872.2| protein required for the utilization of DNA as a carbon source
           [Escherichia coli str. K-12 substr. MG1655]
 gi|170082929|ref|YP_001732249.1| gluconate periplasmic binding protein [Escherichia coli str. K-12
           substr. DH10B]
 gi|238902504|ref|YP_002928300.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli BW2952]
 gi|253771758|ref|YP_003034589.1| gluconate periplasmic binding protein [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|256025859|ref|ZP_05439724.1| gluconate periplasmic binding protein [Escherichia sp. 4_1_40B]
 gi|300815388|ref|ZP_07095613.1| ComF family protein [Escherichia coli MS 107-1]
 gi|300946844|ref|ZP_07161085.1| ComF family protein [Escherichia coli MS 116-1]
 gi|300956743|ref|ZP_07169012.1| ComF family protein [Escherichia coli MS 175-1]
 gi|301023029|ref|ZP_07186839.1| ComF family protein [Escherichia coli MS 196-1]
 gi|307140099|ref|ZP_07499455.1| gluconate periplasmic binding protein [Escherichia coli H736]
 gi|6136739|sp|P46846|GNTX_ECOLI RecName: Full=Protein GntX
 gi|85676628|dbj|BAE77878.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli str. K12 substr. W3110]
 gi|87082263|gb|AAC76438.2| protein required for the utilization of DNA as a carbon source
           [Escherichia coli str. K-12 substr. MG1655]
 gi|169890764|gb|ACB04471.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli str. K-12 substr. DH10B]
 gi|238861309|gb|ACR63307.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli BW2952]
 gi|253322802|gb|ACT27404.1| comF family protein [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|260447568|gb|ACX37990.1| comF family protein [Escherichia coli DH1]
 gi|299880992|gb|EFI89203.1| ComF family protein [Escherichia coli MS 196-1]
 gi|300316463|gb|EFJ66247.1| ComF family protein [Escherichia coli MS 175-1]
 gi|300453499|gb|EFK17119.1| ComF family protein [Escherichia coli MS 116-1]
 gi|300532280|gb|EFK53342.1| ComF family protein [Escherichia coli MS 107-1]
 gi|309703823|emb|CBJ03164.1| putative competence protein [Escherichia coli ETEC H10407]
 gi|315137989|dbj|BAJ45148.1| GntX [Escherichia coli DH1]
 gi|315614681|gb|EFU95321.1| protein gntX [Escherichia coli 3431]
 gi|323934597|gb|EGB30997.1| comF family protein [Escherichia coli E1520]
          Length = 227

 Score = 73.4 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA  V +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAAAVQVWCLCRTL 227


>gi|220904997|ref|YP_002480309.1| ComF family protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|219869296|gb|ACL49631.1| ComF family protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 299

 Score = 73.4 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 35/59 (59%), Gaps = 4/59 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R++F      S  V G  + L+DDV TTG+T + A  AL+ AGA  V IL  +R+ KD
Sbjct: 233 VRHSFA----SSPEVKGRCLWLVDDVMTTGSTLRAACRALRHAGAARVYILVAARTPKD 287


>gi|330979909|gb|EGH78209.1| phosphoribosyltransferase [Pseudomonas syringae pv. aptata str. DSM
           50252]
          Length = 244

 Score = 73.4 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +       V G  + L+DDV TTG+TA   A  L  AGA  V +   +R+ K
Sbjct: 186 LRGAFTLID--PDWVQGRHLALVDDVLTTGSTADVIARLLSNAGARRVDVYCLARTPK 241


>gi|330938548|gb|EGH42131.1| phosphoribosyltransferase [Pseudomonas syringae pv. pisi str.
           1704B]
          Length = 244

 Score = 73.4 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +       V G  + L+DDV TTG+TA   A  L  AGA  V +   +R+ K
Sbjct: 186 LRGAFTLID--PDWVQGRHLALVDDVLTTGSTADVIARLLSNAGARRVDVYCLARTPK 241


>gi|330898835|gb|EGH30254.1| phosphoribosyltransferase [Pseudomonas syringae pv. japonica str.
           M301072PT]
          Length = 244

 Score = 73.4 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +       V G  + L+DDV TTG+TA   A  L  AGA  V +   +R+ K
Sbjct: 186 LRGAFTLID--PDWVQGRHLALVDDVLTTGSTADVIARLLSNAGARRVDVYCLARTPK 241


>gi|323974783|gb|EGB69895.1| comF family protein [Escherichia coli TW10509]
          Length = 215

 Score = 73.4 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|157162890|ref|YP_001460208.1| gluconate periplasmic binding protein [Escherichia coli HS]
 gi|161986432|ref|YP_312335.2| gluconate periplasmic binding protein [Shigella sonnei Ss046]
 gi|191167292|ref|ZP_03029109.1| protein GntX [Escherichia coli B7A]
 gi|191167880|ref|ZP_03029684.1| protein GntX [Escherichia coli B7A]
 gi|209920871|ref|YP_002294955.1| gluconate periplasmic binding protein [Escherichia coli SE11]
 gi|218555962|ref|YP_002388875.1| gluconate periplasmic binding protein [Escherichia coli IAI1]
 gi|254163341|ref|YP_003046449.1| gluconate periplasmic binding protein [Escherichia coli B str.
           REL606]
 gi|297516951|ref|ZP_06935337.1| gluconate periplasmic binding protein [Escherichia coli OP50]
 gi|300926896|ref|ZP_07142662.1| ComF family protein [Escherichia coli MS 182-1]
 gi|300931054|ref|ZP_07146410.1| ComF family protein [Escherichia coli MS 187-1]
 gi|309794684|ref|ZP_07689106.1| ComF family protein [Escherichia coli MS 145-7]
 gi|331670235|ref|ZP_08371074.1| protein GntX [Escherichia coli TA271]
 gi|157068570|gb|ABV07825.1| protein GntX [Escherichia coli HS]
 gi|190902053|gb|EDV61798.1| protein GntX [Escherichia coli B7A]
 gi|190902644|gb|EDV62376.1| protein GntX [Escherichia coli B7A]
 gi|209914130|dbj|BAG79204.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|218362730|emb|CAR00356.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli IAI1]
 gi|242378936|emb|CAQ33734.1| protein involved in utilization of DNA as a carbon source
           [Escherichia coli BL21(DE3)]
 gi|253975242|gb|ACT40913.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli B str. REL606]
 gi|253979398|gb|ACT45068.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli BL21(DE3)]
 gi|300417100|gb|EFK00411.1| ComF family protein [Escherichia coli MS 182-1]
 gi|300461109|gb|EFK24602.1| ComF family protein [Escherichia coli MS 187-1]
 gi|308121734|gb|EFO58996.1| ComF family protein [Escherichia coli MS 145-7]
 gi|323939367|gb|EGB35578.1| comF family protein [Escherichia coli E482]
 gi|323959587|gb|EGB55239.1| comF family protein [Escherichia coli H489]
 gi|324018650|gb|EGB87869.1| ComF family protein [Escherichia coli MS 117-3]
 gi|324116390|gb|EGC10309.1| comF family protein [Escherichia coli E1167]
 gi|331062297|gb|EGI34217.1| protein GntX [Escherichia coli TA271]
          Length = 227

 Score = 73.4 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|161367506|ref|NP_289953.2| gluconate periplasmic binding protein [Escherichia coli O157:H7
           EDL933]
 gi|162139751|ref|NP_312282.2| gluconate periplasmic binding protein [Escherichia coli O157:H7
           str. Sakai]
 gi|195934902|ref|ZP_03080284.1| gluconate periplasmic binding protein [Escherichia coli O157:H7
           str. EC4024]
 gi|254795328|ref|YP_003080165.1| gluconate periplasmic binding protein [Escherichia coli O157:H7
           str. TW14359]
 gi|261224694|ref|ZP_05938975.1| gluconate periplasmic binding protein [Escherichia coli O157:H7
           str. FRIK2000]
 gi|261254411|ref|ZP_05946944.1| gluconate periplasmic binding protein [Escherichia coli O157:H7
           str. FRIK966]
 gi|291284749|ref|YP_003501567.1| gluconate periplasmic binding protein [Escherichia coli O55:H7 str.
           CB9615]
 gi|51701438|sp|Q8X715|GNTX_ECO57 RecName: Full=Protein GntX
 gi|254594728|gb|ACT74089.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli O157:H7 str. TW14359]
 gi|290764622|gb|ADD58583.1| gluconate periplasmic binding protein [Escherichia coli O55:H7 str.
           CB9615]
 gi|320645193|gb|EFX14209.1| DNA utilization protein GntX [Escherichia coli O157:H- str. 493-89]
 gi|320650504|gb|EFX18970.1| DNA utilization protein GntX [Escherichia coli O157:H- str. H 2687]
 gi|320655696|gb|EFX23619.1| DNA utilization protein GntX [Escherichia coli O55:H7 str. 3256-97
           TW 07815]
 gi|320661480|gb|EFX28895.1| DNA utilization protein GntX [Escherichia coli O55:H7 str. USDA
           5905]
 gi|320666503|gb|EFX33486.1| DNA utilization protein GntX [Escherichia coli O157:H7 str. LSU-61]
          Length = 227

 Score = 73.4 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|170681819|ref|YP_001745661.1| gluconate periplasmic binding protein [Escherichia coli SMS-3-5]
 gi|170519537|gb|ACB17715.1| protein GntX [Escherichia coli SMS-3-5]
          Length = 227

 Score = 73.4 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|293406991|ref|ZP_06650915.1| gluconate periplasmic binding protein [Escherichia coli FVEC1412]
 gi|298382733|ref|ZP_06992328.1| gluconate periplasmic binding protein [Escherichia coli FVEC1302]
 gi|291425802|gb|EFE98836.1| gluconate periplasmic binding protein [Escherichia coli FVEC1412]
 gi|298276569|gb|EFI18087.1| gluconate periplasmic binding protein [Escherichia coli FVEC1302]
          Length = 215

 Score = 73.4 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|317130319|ref|YP_004096601.1| phosphoribosyltransferase [Bacillus cellulosilyticus DSM 2522]
 gi|315475267|gb|ADU31870.1| phosphoribosyltransferase [Bacillus cellulosilyticus DSM 2522]
          Length = 253

 Score = 73.4 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 37/58 (63%), Gaps = 1/58 (1%)

Query: 1   MRNAFNVPQYVSK-HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +  AF + +      +A  KILL+DD+YTTGAT + AA  L +AGA +V  +T +RS+
Sbjct: 191 LDGAFTLSKDGQGLTIANKKILLVDDIYTTGATLRSAATVLYRAGAKSVGAVTVARSV 248


>gi|187733952|ref|YP_001882092.1| gluconate periplasmic binding protein [Shigella boydii CDC 3083-94]
 gi|187430944|gb|ACD10218.1| protein GntX [Shigella boydii CDC 3083-94]
          Length = 227

 Score = 73.4 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|78355831|ref|YP_387280.1| ComF family protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78218236|gb|ABB37585.1| ComF family protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 251

 Score = 73.4 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF         V G  +LL+DDV TTGAT +  A AL  AGA  V  +  +R+  
Sbjct: 191 LRDAFE----ADSCVRGRNVLLVDDVMTTGATLEHCAQALYHAGAQQVHAVVAARTPP 244


>gi|331685055|ref|ZP_08385641.1| protein GntX [Escherichia coli H299]
 gi|331077426|gb|EGI48638.1| protein GntX [Escherichia coli H299]
          Length = 227

 Score = 73.0 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|301645853|ref|ZP_07245767.1| ComF family protein [Escherichia coli MS 146-1]
 gi|301075842|gb|EFK90648.1| ComF family protein [Escherichia coli MS 146-1]
          Length = 215

 Score = 73.0 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA  V +    R+L
Sbjct: 163 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAAAVQVWCLCRTL 215


>gi|161486090|ref|NP_756054.2| gluconate periplasmic binding protein [Escherichia coli CFT073]
 gi|161984841|ref|YP_409717.2| gluconate periplasmic binding protein [Shigella boydii Sb227]
 gi|162138354|ref|YP_542874.2| gluconate periplasmic binding protein [Escherichia coli UTI89]
 gi|218560471|ref|YP_002393384.1| gluconate periplasmic binding protein [Escherichia coli S88]
 gi|218702158|ref|YP_002409787.1| gluconate periplasmic binding protein [Escherichia coli IAI39]
 gi|293416815|ref|ZP_06659452.1| gluconate periplasmic binding protein [Escherichia coli B185]
 gi|300937288|ref|ZP_07152131.1| ComF family protein [Escherichia coli MS 21-1]
 gi|301050375|ref|ZP_07197264.1| ComF family protein [Escherichia coli MS 185-1]
 gi|331659702|ref|ZP_08360640.1| protein GntX [Escherichia coli TA206]
 gi|51701423|sp|Q8FCT3|GNTX_ECOL6 RecName: Full=Protein GntX
 gi|218367240|emb|CAR05014.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli S88]
 gi|218372144|emb|CAR20006.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Escherichia coli IAI39]
 gi|291431391|gb|EFF04376.1| gluconate periplasmic binding protein [Escherichia coli B185]
 gi|294492334|gb|ADE91090.1| protein GntX [Escherichia coli IHE3034]
 gi|300298004|gb|EFJ54389.1| ComF family protein [Escherichia coli MS 185-1]
 gi|300457647|gb|EFK21140.1| ComF family protein [Escherichia coli MS 21-1]
 gi|307555499|gb|ADN48274.1| protein GntX [Escherichia coli ABU 83972]
 gi|307628475|gb|ADN72779.1| gluconate periplasmic binding protein [Escherichia coli UM146]
 gi|315286087|gb|EFU45525.1| ComF family protein [Escherichia coli MS 110-3]
 gi|315291746|gb|EFU51102.1| ComF family protein [Escherichia coli MS 153-1]
 gi|315295926|gb|EFU55235.1| ComF family protein [Escherichia coli MS 16-3]
 gi|323950070|gb|EGB45953.1| comF family protein [Escherichia coli H252]
 gi|323954650|gb|EGB50432.1| comF family protein [Escherichia coli H263]
 gi|324009391|gb|EGB78610.1| ComF family protein [Escherichia coli MS 57-2]
 gi|331052917|gb|EGI24950.1| protein GntX [Escherichia coli TA206]
 gi|332345366|gb|AEE58700.1| conserved hypothetical protein [Escherichia coli UMNK88]
          Length = 227

 Score = 73.0 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|326318590|ref|YP_004236262.1| phosphoribosyltransferase [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|323375426|gb|ADX47695.1| phosphoribosyltransferase [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 238

 Score = 73.0 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 30/56 (53%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +   F V    +  V   +I+L+DDV TTGAT   AA  L +AGA  V  +  +R+
Sbjct: 182 LDGVFAVAPDRAARVRDKRIVLVDDVMTTGATLHAAAHVLLQAGASRVDAVVLART 237


>gi|85374003|ref|YP_458065.1| amidophosphoribosyltransferase [Erythrobacter litoralis HTCC2594]
 gi|84787086|gb|ABC63268.1| amidophosphoribosyltransferase [Erythrobacter litoralis HTCC2594]
          Length = 263

 Score = 73.0 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 35/59 (59%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  A  +     + +AG  +LL+DDV T+GAT++     L KAGA +V I +F+R L +
Sbjct: 188 LSGAIAIAPAWQQKIAGRDVLLVDDVVTSGATSERCTRVLLKAGAKSVRIASFTRVLSE 246


>gi|222035114|emb|CAP77859.1| Protein gntX [Escherichia coli LF82]
 gi|312947961|gb|ADR28788.1| gluconate periplasmic binding protein [Escherichia coli O83:H1 str.
           NRG 857C]
          Length = 227

 Score = 73.0 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|85859102|ref|YP_461304.1| amidophosphoribosyltransferase family protein [Syntrophus
           aciditrophicus SB]
 gi|85722193|gb|ABC77136.1| amidophosphoribosyltransferase family protein [Syntrophus
           aciditrophicus SB]
          Length = 239

 Score = 73.0 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 25/56 (44%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +RNAF V +     + G +ILL+DDVYTTG+T    A  L + GA +VS+ T +R+
Sbjct: 186 VRNAFEVVR--KAEIEGSRILLVDDVYTTGSTVGECARVLLEGGARSVSVATLARA 239


>gi|323182874|gb|EFZ68275.1| protein gntX [Escherichia coli 1357]
          Length = 215

 Score = 73.0 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|148553483|ref|YP_001261065.1| phosphoribosyltransferase [Sphingomonas wittichii RW1]
 gi|148498673|gb|ABQ66927.1| phosphoribosyltransferase [Sphingomonas wittichii RW1]
          Length = 248

 Score = 73.0 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 38/59 (64%), Gaps = 2/59 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF V       V G  +LL+DDVYTTGATA   A AL++AGA  V ++ ++R ++D
Sbjct: 187 VRGAFAVRD--RGAVKGRAVLLVDDVYTTGATADACARALRRAGASRVDLICWARVVRD 243


>gi|301329724|ref|ZP_07222467.1| ComF family protein [Escherichia coli MS 78-1]
 gi|312972323|ref|ZP_07786497.1| protein gntX [Escherichia coli 1827-70]
 gi|300844196|gb|EFK71956.1| ComF family protein [Escherichia coli MS 78-1]
 gi|310334700|gb|EFQ00905.1| protein gntX [Escherichia coli 1827-70]
 gi|323164977|gb|EFZ50768.1| protein gntX [Shigella sonnei 53G]
 gi|323970011|gb|EGB65286.1| comF family protein [Escherichia coli TA007]
          Length = 215

 Score = 73.0 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|297544021|ref|YP_003676323.1| phosphoribosyltransferase [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|296841796|gb|ADH60312.1| phosphoribosyltransferase [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
          Length = 229

 Score = 73.0 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF V       + G  +LL+DDV TTGAT    A  LK+ GA  V + T +
Sbjct: 173 VKGAFKVT--YKDTIIGRNVLLVDDVLTTGATLDECAKVLKENGAKDVYVATIA 224


>gi|189401819|ref|ZP_02778173.2| protein GntX [Escherichia coli O157:H7 str. EC4401]
 gi|189405505|ref|ZP_02822191.2| protein GntX [Escherichia coli O157:H7 str. EC508]
 gi|189358967|gb|EDU77386.1| protein GntX [Escherichia coli O157:H7 str. EC4401]
 gi|189380059|gb|EDU98475.1| protein GntX [Escherichia coli O157:H7 str. EC508]
 gi|320191575|gb|EFW66225.1| gluconate periplasmic binding protein [Escherichia coli O157:H7
           str. EC1212]
 gi|326337623|gb|EGD61458.1| gluconate periplasmic binding protein [Escherichia coli O157:H7
           str. 1044]
 gi|326344626|gb|EGD68375.1| gluconate periplasmic binding protein [Escherichia coli O157:H7
           str. 1125]
          Length = 215

 Score = 73.0 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|170018351|ref|YP_001723305.1| gluconate periplasmic binding protein [Escherichia coli ATCC 8739]
 gi|169753279|gb|ACA75978.1| comF family protein [Escherichia coli ATCC 8739]
          Length = 227

 Score = 73.0 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|229592992|ref|YP_002875111.1| hypothetical protein PFLU5616 [Pseudomonas fluorescens SBW25]
 gi|229364858|emb|CAY52911.1| conserved hypothetical protein [Pseudomonas fluorescens SBW25]
          Length = 245

 Score = 73.0 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 27/56 (48%), Gaps = 2/56 (3%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            AF +       V G    L+DDV TTGATA   A  L  AGA  V +   +R+ K
Sbjct: 189 GAFALAPG--AQVQGRHFALVDDVLTTGATAHSLARLLINAGARQVDVYCLARTPK 242


>gi|218889229|ref|YP_002438093.1| putative phosphoribosyl transferase [Pseudomonas aeruginosa LESB58]
 gi|218769452|emb|CAW25212.1| probable phosphoribosyl transferase [Pseudomonas aeruginosa LESB58]
          Length = 241

 Score = 73.0 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +       V GL + L+DDV TTGAT +  +  L++AGA  V +   +R+ K
Sbjct: 184 LRHAFALAPA--SDVRGLHLALVDDVLTTGATTEHLSRLLRRAGAARVDVYCLARTPK 239


>gi|163849759|ref|YP_001637802.1| competence protein F [Methylobacterium extorquens PA1]
 gi|163661364|gb|ABY28731.1| competence protein F [Methylobacterium extorquens PA1]
          Length = 255

 Score = 73.0 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 37/59 (62%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ AF VP      +AG ++LLIDDV TTGAT   AA  L + GA +V +LTF+   +D
Sbjct: 195 LQGAFRVPDDARSRIAGRRLLLIDDVATTGATGNAAARVLLRGGAASVDLLTFATVTRD 253


>gi|193061813|ref|ZP_03042910.1| protein GntX [Escherichia coli E22]
 gi|194427043|ref|ZP_03059595.1| protein GntX [Escherichia coli B171]
 gi|260846197|ref|YP_003223975.1| gluconate periplasmic binding protein GntX [Escherichia coli
           O103:H2 str. 12009]
 gi|192932603|gb|EDV85200.1| protein GntX [Escherichia coli E22]
 gi|194415004|gb|EDX31274.1| protein GntX [Escherichia coli B171]
 gi|257761344|dbj|BAI32841.1| gluconate periplasmic binding protein GntX [Escherichia coli
           O103:H2 str. 12009]
          Length = 227

 Score = 73.0 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|46201247|ref|ZP_00208026.1| COG1040: Predicted amidophosphoribosyltransferases
           [Magnetospirillum magnetotacticum MS-1]
          Length = 344

 Score = 73.0 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 23/59 (38%), Positives = 35/59 (59%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF V   +   + G +++LIDDV T+GAT    A  L KAGA+ V +LT  R +++
Sbjct: 285 VAGAFRVDDRLRPRLDGRRVVLIDDVMTSGATVGECARVLLKAGAVCVDVLTLGRVVRE 343


>gi|227883547|ref|ZP_04001352.1| competence protein F [Escherichia coli 83972]
 gi|227839426|gb|EEJ49892.1| competence protein F [Escherichia coli 83972]
 gi|320185944|gb|EFW60693.1| gluconate periplasmic binding protein [Shigella flexneri CDC
           796-83]
 gi|332090224|gb|EGI95322.1| protein gntX [Shigella boydii 3594-74]
          Length = 215

 Score = 73.0 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|15595686|ref|NP_249180.1| phosphoribosyl transferase [Pseudomonas aeruginosa PAO1]
 gi|9946352|gb|AAG03878.1|AE004486_7 probable phosphoribosyl transferase [Pseudomonas aeruginosa PAO1]
          Length = 241

 Score = 73.0 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +       V GL + L+DDV TTGATA+  +  L++AGA  V +   +R+ K
Sbjct: 184 LRHAFALAPA--SDVRGLHLALVDDVLTTGATAERLSRLLRRAGAARVDVYCLARTPK 239


>gi|320639695|gb|EFX09289.1| DNA utilization protein GntX [Escherichia coli O157:H7 str. G5101]
          Length = 227

 Score = 73.0 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELAVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|114797458|ref|YP_761845.1| ComF family protein [Hyphomonas neptunium ATCC 15444]
 gi|114737632|gb|ABI75757.1| ComF family protein [Hyphomonas neptunium ATCC 15444]
          Length = 252

 Score = 73.0 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 34/58 (58%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +  AF+V     K   G +ILL+DDV TTGAT      ALK+AGA  + +L  +R ++
Sbjct: 189 VTGAFDVRASRRKLEEGRRILLVDDVLTTGATLNACTRALKRAGARQIDVLVLARVVR 246


>gi|162147687|ref|YP_001602148.1| phosphoribosyltransferase [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786264|emb|CAP55846.1| putative phosphoribosyltransferase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 276

 Score = 73.0 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 30/56 (53%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  A  V       +A  +I+L+DDV TTGAT    A  L  AGA +V +L  +R+
Sbjct: 206 LHGAIAVRPSRRAAIANRRIVLVDDVMTTGATTGECARVLLAAGAASVDVLVAARA 261


>gi|75674583|ref|YP_317004.1| phosphoribosyltransferase [Nitrobacter winogradskyi Nb-255]
 gi|74419453|gb|ABA03652.1| phosphoribosyltransferase [Nitrobacter winogradskyi Nb-255]
          Length = 271

 Score = 73.0 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 34/57 (59%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF V    + HV G +++LIDDV T+GAT    A  L +A A  V +L F+R +
Sbjct: 208 VQGAFKVTAERAGHVQGRRVILIDDVLTSGATVDACARVLLRAKAAQVDVLVFARVV 264


>gi|330956967|gb|EGH57227.1| competence protein ComF [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 244

 Score = 73.0 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +       V G  + ++DDV TTG+TA+  A  L  AGA  V +   +R+ K
Sbjct: 186 LRGAFTLRD--PDWVHGKHLAVVDDVLTTGSTAEVIARLLNSAGARRVDVYCLARTPK 241


>gi|254243583|ref|ZP_04936905.1| hypothetical protein PA2G_04406 [Pseudomonas aeruginosa 2192]
 gi|126196961|gb|EAZ61024.1| hypothetical protein PA2G_04406 [Pseudomonas aeruginosa 2192]
          Length = 241

 Score = 73.0 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +       V GL + L+DDV TTGAT +  +  L++AGA  V +   +R+ K
Sbjct: 184 LRHAFALAPA--SDVRGLHLALVDDVLTTGATTEHLSRLLRRAGAARVDVYCLARTPK 239


>gi|110677794|ref|YP_680801.1| competence protein F, putative [Roseobacter denitrificans OCh 114]
 gi|109453910|gb|ABG30115.1| competence protein F, putative [Roseobacter denitrificans OCh 114]
          Length = 243

 Score = 72.6 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 32/59 (54%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ A          +AG  +LL+DDV+T+GAT   A  A   AG+  V ++T +R  K+
Sbjct: 184 VKGAIRAHPKRRHRMAGRPVLLVDDVFTSGATLSSATDACLAAGSGPVYVVTLARVTKN 242


>gi|316932065|ref|YP_004107047.1| phosphoribosyltransferase [Rhodopseudomonas palustris DX-1]
 gi|315599779|gb|ADU42314.1| phosphoribosyltransferase [Rhodopseudomonas palustris DX-1]
          Length = 271

 Score = 72.6 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 38/57 (66%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF VP++    + G +I+LIDDV T+GAT    A AL +A A++V +L F+R +
Sbjct: 208 VQGAFKVPKHRKAEIHGRRIVLIDDVLTSGATVDACARALLRARAVSVEVLVFARVV 264


>gi|209883247|ref|YP_002287104.1| phosphoribosyltransferase [Oligotropha carboxidovorans OM5]
 gi|209871443|gb|ACI91239.1| phosphoribosyltransferase [Oligotropha carboxidovorans OM5]
          Length = 278

 Score = 72.6 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 33/57 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF V       V G + +LIDDV T+GAT +    AL +A A +V +L F+R +
Sbjct: 215 VQGAFAVEADQRAAVKGRRFILIDDVLTSGATTQACTRALLRAKAASVDVLVFARVV 271


>gi|323162798|gb|EFZ48635.1| protein gntX [Escherichia coli E128010]
 gi|323944365|gb|EGB40440.1| comF family protein [Escherichia coli H120]
          Length = 215

 Score = 72.6 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|330985850|gb|EGH83953.1| competence protein ComF [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 244

 Score = 72.6 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +       V G  + L+DDV TTG+TA+  A  L KAGA  V +   +R+ K
Sbjct: 186 LRDAFTLVD--PDWVQGKHLALVDDVLTTGSTAEVIARLLNKAGARRVDVYCLARTPK 241


>gi|320331599|gb|EFW87537.1| competence protein ComF [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330872324|gb|EGH06473.1| competence protein ComF [Pseudomonas syringae pv. glycinea str.
           race 4]
          Length = 244

 Score = 72.6 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +       V G  + L+DDV TTG+TA+  A  L KAGA  V +   +R+ K
Sbjct: 186 LRDAFTLVD--PDWVQGKHLALVDDVLTTGSTAEVIARLLNKAGARRVDVYCLARTPK 241


>gi|298489185|ref|ZP_07007204.1| Competence protein F [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|298156267|gb|EFH97368.1| Competence protein F [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
          Length = 244

 Score = 72.6 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +       V G  + L+DDV TTG+TA+  A  L KAGA  V +   +R+ K
Sbjct: 186 LRDAFTLVD--PDWVQGKHLALVDDVLTTGSTAEVIARLLNKAGARRVDVYCLARTPK 241


>gi|289624783|ref|ZP_06457737.1| competence protein ComF [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289650640|ref|ZP_06481983.1| competence protein ComF [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|330871186|gb|EGH05895.1| competence protein ComF [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 244

 Score = 72.6 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +       V G  + L+DDV TTG+TA+  A  L KAGA  V +   +R+ K
Sbjct: 186 LRDAFTLVD--PDWVQGKHLALVDDVLTTGSTAEVIARLLNKAGARRVDVYCLARTPK 241


>gi|71734602|ref|YP_276823.1| competence protein ComF [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|71555155|gb|AAZ34366.1| competence protein ComF [Pseudomonas syringae pv. phaseolicola
           1448A]
          Length = 244

 Score = 72.6 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +       V G  + L+DDV TTG+TA+  A  L KAGA  V +   +R+ K
Sbjct: 186 LRDAFTLVD--PDWVQGKHLALVDDVLTTGSTAEVIARLLNKAGARRVDVYCLARTPK 241


>gi|209542312|ref|YP_002274541.1| putative phosphoribosyltransferase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209529989|gb|ACI49926.1| putative phosphoribosyltransferase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 260

 Score = 72.6 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 30/56 (53%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  A  V       +A  +I+L+DDV TTGAT    A  L  AGA +V +L  +R+
Sbjct: 190 LHGAIAVRPSRRAAIANRRIVLVDDVMTTGATTGECARVLLAAGAASVDVLVAARA 245


>gi|307294581|ref|ZP_07574423.1| phosphoribosyltransferase [Sphingobium chlorophenolicum L-1]
 gi|306879055|gb|EFN10273.1| phosphoribosyltransferase [Sphingobium chlorophenolicum L-1]
          Length = 246

 Score = 72.6 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF +       + G  +LLIDDV+T+GATA   A  LK+ GA +V +L ++R L D
Sbjct: 187 VRGAFALTPD--HGLKGRAVLLIDDVHTSGATAAACARTLKRGGAASVHLLCWARVLPD 243


>gi|94971228|ref|YP_593276.1| phosphoribosyltransferase [Candidatus Koribacter versatilis
           Ellin345]
 gi|94553278|gb|ABF43202.1| phosphoribosyltransferase [Candidatus Koribacter versatilis
           Ellin345]
          Length = 213

 Score = 72.6 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 25/57 (43%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +  AF VP      V G  ++L+DDV TTGATA   A  LK+AGA  V + T +R++
Sbjct: 136 LHGAFKVPD--KALVKGRNVILVDDVLTTGATADECARILKRAGAEQVLVATVARAV 190


>gi|159185776|ref|NP_357098.2| competence protein F [Agrobacterium tumefaciens str. C58]
 gi|159140910|gb|AAK89883.2| competence protein F [Agrobacterium tumefaciens str. C58]
          Length = 263

 Score = 72.6 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 41/58 (70%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF++       + G +++L+DDVYTTGAT   A+ AL+KAGA+ V++LTF+ ++ 
Sbjct: 203 VRGAFSLAPGREADIFGKRVVLVDDVYTTGATVGAASRALRKAGAVDVTVLTFAMAIS 260


>gi|308188427|ref|YP_003932558.1| amidophosphoribosyltransferase [Pantoea vagans C9-1]
 gi|308058937|gb|ADO11109.1| Putative amidophosphoribosyltransferase [Pantoea vagans C9-1]
          Length = 226

 Score = 72.2 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF +       V G  I L+DDV TTG+T    +  L   GA +V +    R+L
Sbjct: 174 LRGAFRL----EMAVQGRHIALLDDVITTGSTVDEISRLLLAQGAASVQVWCLCRTL 226


>gi|104784036|ref|YP_610534.1| competence protein ComF [Pseudomonas entomophila L48]
 gi|95113023|emb|CAK17751.1| putative competence protein ComF [Pseudomonas entomophila L48]
          Length = 245

 Score = 72.2 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +       V  L + ++DDV TTGATA+  A  L+KAGA  V I   +R+ +
Sbjct: 186 LRHAFALAPG--TEVKDLHLAVVDDVMTTGATAQAIAALLRKAGARRVDIYCLARTPR 241


>gi|260599715|ref|YP_003212286.1| protein gntX [Cronobacter turicensis z3032]
 gi|260218892|emb|CBA34247.1| Protein gntX [Cronobacter turicensis z3032]
          Length = 251

 Score = 72.2 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 25/57 (43%), Positives = 34/57 (59%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF V       VAGL I+++DDV TTG+T    A  LK+ GA TV +    R+L
Sbjct: 199 LKNAFRV----ELPVAGLHIVIVDDVVTTGSTVARIARLLKRNGAATVQVWCLCRTL 251


>gi|32475560|ref|NP_868554.1| phosphoribosyl transferase [Rhodopirellula baltica SH 1]
 gi|32446102|emb|CAD75931.1| probable phosphoribosyl transferase [Rhodopirellula baltica SH 1]
          Length = 302

 Score = 72.2 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 37/59 (62%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF V +   K +AG  ILL+DDV TTGATA   +  L  AGA  V +L  +R+++D
Sbjct: 241 VRGAFRVRRRWRKRLAGEHILLVDDVMTTGATADEISRVLLDAGAARVDLLVVARAIRD 299


>gi|116054218|ref|YP_788662.1| putative phosphoribosyl transferase [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|296386989|ref|ZP_06876488.1| putative phosphoribosyl transferase [Pseudomonas aeruginosa PAb1]
 gi|115589439|gb|ABJ15454.1| putative phosphoribosyltransferase [Pseudomonas aeruginosa
           UCBPP-PA14]
          Length = 241

 Score = 72.2 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +       V GL + L+DDV TTGATA+C +  L++AGA  V +   +R+ K
Sbjct: 184 LRHAFALAPA--SDVRGLHLALVDDVLTTGATAECLSRLLRRAGAARVDVYCLARTPK 239


>gi|327542904|gb|EGF29360.1| phosphoribosyl transferase [Rhodopirellula baltica WH47]
          Length = 302

 Score = 72.2 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 37/59 (62%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF V +   K +AG  ILL+DDV TTGATA   +  L  AGA  V +L  +R+++D
Sbjct: 241 VRGAFRVRRRWRKRLAGEHILLVDDVMTTGATADEISRVLLDAGAARVDLLVVARAIRD 299


>gi|107099475|ref|ZP_01363393.1| hypothetical protein PaerPA_01000487 [Pseudomonas aeruginosa PACS2]
          Length = 229

 Score = 72.2 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +       V GL + L+DDV TTGAT +  +  L++AGA  V +   +R+ K
Sbjct: 172 LRHAFALAPA--SDVRGLHLALVDDVLTTGATTEHLSRLLRRAGAARVDVYCLARTPK 227


>gi|307265486|ref|ZP_07547041.1| phosphoribosyltransferase [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306919440|gb|EFN49659.1| phosphoribosyltransferase [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 229

 Score = 72.2 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF V       + G   LL+DDV TTGAT    A  LK+ GA  V ++T +
Sbjct: 173 VKGAFKVT--YKDTIVGKNALLVDDVLTTGATLDECAKVLKENGAKDVYVVTIA 224


>gi|121595833|ref|YP_987729.1| ComF family protein [Acidovorax sp. JS42]
 gi|120607913|gb|ABM43653.1| ComF family protein [Acidovorax sp. JS42]
          Length = 242

 Score = 72.2 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 34/56 (60%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF      +  +AG ++LL+DDV TTGAT   AA  L+ AGA+ V  L  +R+
Sbjct: 186 LRGAFVPDPLRAAQLAGKRVLLVDDVMTTGATLHAAAAPLRDAGALQVCALVLART 241


>gi|317154568|ref|YP_004122616.1| phosphoribosyltransferase [Desulfovibrio aespoeensis Aspo-2]
 gi|316944819|gb|ADU63870.1| phosphoribosyltransferase [Desulfovibrio aespoeensis Aspo-2]
          Length = 260

 Score = 72.2 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 37/59 (62%), Gaps = 3/59 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R+AF         VAG  ILL+DDVYTTGAT    A  L++AGA  +S+L  +R+ ++
Sbjct: 203 IRDAFAANPA---QVAGRSILLVDDVYTTGATLTECARTLRRAGAAGLSVLVLARARRE 258


>gi|251787886|ref|YP_003002607.1| gluconate periplasmic binding protein [Dickeya zeae Ech1591]
 gi|247536507|gb|ACT05128.1| gluconate periplasmic binding protein [Dickeya zeae Ech1591]
          Length = 239

 Score = 72.2 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/59 (38%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 1   MRNAFNVPQYVSKH-VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF     V    VAG +++L+DDV TTG+TA   +  L  AGA  V +    R+L 
Sbjct: 181 LRGAFRCRHTVVNQWVAGKRLVLLDDVVTTGSTAAEISRTLLNAGAQQVQVWCVCRTLS 239


>gi|237802414|ref|ZP_04590875.1| competence protein ComF [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331025271|gb|EGI05327.1| competence protein ComF [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 245

 Score = 72.2 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +  AF +       V    + L+DDV TTG+TA+  A  L  AGA  V +   +R+ K
Sbjct: 186 LHGAFTLIDA--DWVRDKHLALVDDVLTTGSTAEVIARLLNDAGARRVDVYCLARTPK 241


>gi|300313450|ref|YP_003777542.1| amidophosphoribosyltransferase [Herbaspirillum seropedicae SmR1]
 gi|300076235|gb|ADJ65634.1| amidophosphoribosyltransferase protein [Herbaspirillum seropedicae
           SmR1]
          Length = 299

 Score = 71.8 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 26/58 (44%), Positives = 36/58 (62%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +P      V GL + ++DDV TTGAT    AI LK+ GA  V+ L F+R+L 
Sbjct: 241 VRSAFALPFATMDQVRGLHVGIVDDVMTTGATLNEVAIVLKRHGARRVTNLVFARTLP 298


>gi|311277653|ref|YP_003939884.1| phosphoribosyltransferase [Enterobacter cloacae SCF1]
 gi|308746848|gb|ADO46600.1| phosphoribosyltransferase [Enterobacter cloacae SCF1]
          Length = 224

 Score = 71.8 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       VAG  I ++DDV TTGATA   +  L ++GA +V +    R+L
Sbjct: 172 LKNAFRL----DIPVAGHHIAIVDDVVTTGATAAEISRLLLQSGAASVQVWCLCRTL 224


>gi|149174134|ref|ZP_01852762.1| Phosphoribosyltransferase [Planctomyces maris DSM 8797]
 gi|148847114|gb|EDL61449.1| Phosphoribosyltransferase [Planctomyces maris DSM 8797]
          Length = 252

 Score = 71.8 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF V +     V  L ILL+DDV TTG+TA  A  AL +AGA  +++   +R+ +
Sbjct: 196 LRDAFQVRR--PGRVKDLSILLVDDVMTTGSTANAATRALLQAGASEINVAVIARAPR 251


>gi|158425919|ref|YP_001527211.1| competence protein F [Azorhizobium caulinodans ORS 571]
 gi|158332808|dbj|BAF90293.1| competence protein F [Azorhizobium caulinodans ORS 571]
          Length = 264

 Score = 71.8 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 36/57 (63%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +  AF+VP  +   V G  +LL+DDV TTGAT +  A  L+++ A  + +LTF+R +
Sbjct: 205 VAGAFDVPPPLRAAVEGRHLLLVDDVMTTGATLESCARVLRRSSAAAIDVLTFARVV 261


>gi|222112033|ref|YP_002554297.1| phosphoribosyltransferase [Acidovorax ebreus TPSY]
 gi|221731477|gb|ACM34297.1| phosphoribosyltransferase [Acidovorax ebreus TPSY]
          Length = 242

 Score = 71.8 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 34/56 (60%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF      +  +AG ++LL+DDV TTGAT   AA  L+ AGA+ V  L  +R+
Sbjct: 186 LRGAFVPDPLRAAQLAGKRVLLVDDVMTTGATLHAAAAPLRDAGALQVCALVLART 241


>gi|288956999|ref|YP_003447340.1| hypothetical protein AZL_001580 [Azospirillum sp. B510]
 gi|288909307|dbj|BAI70796.1| hypothetical protein AZL_001580 [Azospirillum sp. B510]
          Length = 255

 Score = 71.8 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF +     + VAG +++LIDDV TTGAT       L +AGA  V +LT +R +
Sbjct: 199 VKGAFCLRPG--QSVAGQRLVLIDDVMTTGATLAECTRVLLRAGAARVDVLTLARVV 253


>gi|158521918|ref|YP_001529788.1| phosphoribosyltransferase [Desulfococcus oleovorans Hxd3]
 gi|158510744|gb|ABW67711.1| phosphoribosyltransferase [Desulfococcus oleovorans Hxd3]
          Length = 279

 Score = 71.8 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF +       VAG ++L++DDV+TTGAT    A  L   GA  V +LT +R 
Sbjct: 224 VKGAFALTD--PSAVAGKRVLVVDDVFTTGATVNECARVLLAGGAKQVDVLTLARV 277


>gi|312109468|ref|YP_003987784.1| phosphoribosyltransferase [Geobacillus sp. Y4.1MC1]
 gi|311214569|gb|ADP73173.1| phosphoribosyltransferase [Geobacillus sp. Y4.1MC1]
          Length = 235

 Score = 71.8 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 2/54 (3%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
            N F + +     + G  I+LIDD+YTTG T + AA  L KAGA +VS LT +R
Sbjct: 183 ENVFRLSE--QTSLQGKPIVLIDDIYTTGTTLRHAAKVLLKAGAASVSSLTLAR 234


>gi|332085564|gb|EGI90730.1| protein gntX [Shigella boydii 5216-82]
          Length = 227

 Score = 71.8 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV +TG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGRHMVIVDDVVSTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|302342707|ref|YP_003807236.1| phosphoribosyltransferase [Desulfarculus baarsii DSM 2075]
 gi|301639320|gb|ADK84642.1| phosphoribosyltransferase [Desulfarculus baarsii DSM 2075]
          Length = 225

 Score = 71.4 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 36/59 (61%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF V   ++  V G ++LLIDDV TTGAT     +AL  AGA+ V  LT SR++ +
Sbjct: 162 VSGAFAVNPRLAAQVDGRRVLLIDDVQTTGATLHECTMALLAAGAVQVRALTVSRAMGE 220


>gi|299140246|ref|ZP_07033412.1| phosphoribosyltransferase [Acidobacterium sp. MP5ACTX8]
 gi|298597785|gb|EFI53957.1| phosphoribosyltransferase [Acidobacterium sp. MP5ACTX8]
          Length = 359

 Score = 71.4 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF V +     + G ++LL+DD+ TTGATA+  A  L +AGA  V + T +R+
Sbjct: 276 LRGAFRVERA--DEIRGREVLLVDDILTTGATARECARVLMRAGASKVWVATVARA 329


>gi|270264448|ref|ZP_06192714.1| gluconate periplasmic binding protein [Serratia odorifera 4Rx13]
 gi|270041584|gb|EFA14682.1| gluconate periplasmic binding protein [Serratia odorifera 4Rx13]
          Length = 227

 Score = 71.4 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF   +     +AG  + L+DDV TTG+T       L + GA ++ I    R+L
Sbjct: 175 LRGAFRCHEP----LAGRHVALLDDVVTTGSTVAEITRLLLRQGAASIQIWCVCRTL 227


>gi|256750931|ref|ZP_05491815.1| phosphoribosyltransferase [Thermoanaerobacter ethanolicus CCSD1]
 gi|256750266|gb|EEU63286.1| phosphoribosyltransferase [Thermoanaerobacter ethanolicus CCSD1]
          Length = 229

 Score = 71.4 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF V       + G   LL+DDV TTGAT    A  LK+ GA  V ++T +
Sbjct: 173 VKGAFKVT--YKDTIVGKNALLVDDVLTTGATLDECAKVLKENGAKDVYVVTIA 224


>gi|330874793|gb|EGH08942.1| competence protein ComF [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
          Length = 244

 Score = 71.4 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +       V G  + LIDDV TTG+TA+  A  L  AGA  V +   +R+ K
Sbjct: 186 LRGAFVLIDA--DWVQGKHLALIDDVLTTGSTAEVIARLLNSAGAQRVDVYCLARTPK 241


>gi|125974733|ref|YP_001038643.1| phosphoribosyltransferase [Clostridium thermocellum ATCC 27405]
 gi|281418798|ref|ZP_06249817.1| phosphoribosyltransferase [Clostridium thermocellum JW20]
 gi|125714958|gb|ABN53450.1| phosphoribosyltransferase [Clostridium thermocellum ATCC 27405]
 gi|281407882|gb|EFB38141.1| phosphoribosyltransferase [Clostridium thermocellum JW20]
          Length = 220

 Score = 71.4 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +++AF +       V G  + L+DD+ TTG T    +  LK+AGA  + +   +
Sbjct: 165 VKDAFRITD--RSKVEGKAMFLVDDILTTGTTLNECSRVLKEAGAKKIVVAVIA 216


>gi|326389598|ref|ZP_08211164.1| phosphoribosyltransferase [Thermoanaerobacter ethanolicus JW 200]
 gi|325994313|gb|EGD52739.1| phosphoribosyltransferase [Thermoanaerobacter ethanolicus JW 200]
          Length = 229

 Score = 71.4 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF V       + G   LL+DDV TTGAT    A  LK+ GA  V ++T +
Sbjct: 173 VKGAFKVT--YKDTIVGKNALLVDDVLTTGATLDECAKVLKENGAKDVYVVTIA 224


>gi|312963457|ref|ZP_07777939.1| phosphoribosyltransferase [Pseudomonas fluorescens WH6]
 gi|311282263|gb|EFQ60862.1| phosphoribosyltransferase [Pseudomonas fluorescens WH6]
          Length = 245

 Score = 71.4 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 26/56 (46%), Gaps = 2/56 (3%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            AF +       V      L+DDV TTGATA   A  L  AGA  V +   +R+ K
Sbjct: 189 GAFALAAD--AQVQDRHFALVDDVLTTGATAHSLARLLINAGARQVDVYCLARTPK 242


>gi|322434181|ref|YP_004216393.1| phosphoribosyltransferase [Acidobacterium sp. MP5ACTX9]
 gi|321161908|gb|ADW67613.1| phosphoribosyltransferase [Acidobacterium sp. MP5ACTX9]
          Length = 239

 Score = 71.4 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 35/59 (59%), Gaps = 4/59 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF V       VA  ++LLIDD+ TTGATA+  A  L KAGA  V + T +R+  +
Sbjct: 156 LRGAFEV----RGDVANKEVLLIDDILTTGATARECARVLVKAGASKVWVATVARAQSE 210


>gi|256005256|ref|ZP_05430223.1| phosphoribosyltransferase [Clostridium thermocellum DSM 2360]
 gi|255990807|gb|EEU00922.1| phosphoribosyltransferase [Clostridium thermocellum DSM 2360]
 gi|316941867|gb|ADU75901.1| phosphoribosyltransferase [Clostridium thermocellum DSM 1313]
          Length = 220

 Score = 71.4 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +++AF +       V G  + L+DD+ TTG T    +  LK+AGA  + +   +
Sbjct: 165 VKDAFRITD--RSKVEGKAMFLVDDILTTGTTLNECSRVLKEAGAKKIVVAVIA 216


>gi|144900147|emb|CAM77011.1| competence protein F [Magnetospirillum gryphiswaldense MSR-1]
          Length = 244

 Score = 71.4 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF    +    V G  +LL+DDV TTGAT    +  L + GA  V +LT  R L
Sbjct: 186 VRGAFA--PHPRLDVCGKNVLLVDDVLTTGATLGECSRVLLRQGAARVDVLTLGRVL 240


>gi|240136967|ref|YP_002961436.1| putative phosphoribosyltransferase [Methylobacterium extorquens
           AM1]
 gi|240006933|gb|ACS38159.1| putative phosphoribosyltransferase [Methylobacterium extorquens
           AM1]
          Length = 255

 Score = 71.4 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 38/59 (64%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ AF VP+     +AG ++LLIDDV TTGAT   AA  L + GA +V +LTF+   +D
Sbjct: 195 LQGAFRVPEDARSRIAGRRLLLIDDVATTGATGNAAAPVLLRGGAASVDLLTFATVTRD 253


>gi|218960908|ref|YP_001740683.1| putative gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Candidatus Cloacamonas acidaminovorans]
 gi|167729565|emb|CAO80477.1| putative gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Candidatus Cloacamonas acidaminovorans]
          Length = 240

 Score = 71.1 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  AF V       VAG KI+LIDDV+TTG+T    A  L+ AGA  +  +T +R+
Sbjct: 187 LAGAFQVKN--KNLVAGKKIILIDDVFTTGSTLNEIAKTLRSAGADKICAITVARA 240


>gi|152984307|ref|YP_001345987.1| putative phosphoribosyl transferase [Pseudomonas aeruginosa PA7]
 gi|150959465|gb|ABR81490.1| probable phosphoribosyl transferase [Pseudomonas aeruginosa PA7]
          Length = 241

 Score = 71.1 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 26/58 (44%), Positives = 37/58 (63%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +     K V GL + L+DDV TTGATA+C A  L++AGA  V +   +R+ K
Sbjct: 184 LRHAFALAPG--KEVRGLHLALVDDVLTTGATAECLARLLRRAGAARVDVYCLARTPK 239


>gi|254512068|ref|ZP_05124135.1| competence protein F [Rhodobacteraceae bacterium KLH11]
 gi|221535779|gb|EEE38767.1| competence protein F [Rhodobacteraceae bacterium KLH11]
          Length = 192

 Score = 71.1 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 31/59 (52%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           + NA +V       + G  +LL+DDV T+GAT    A   + +GA  + +L  +R  KD
Sbjct: 133 LANAISVHPKRRHRMQGRDVLLVDDVMTSGATLAACARVCRASGANHIFVLALARVAKD 191


>gi|163732997|ref|ZP_02140441.1| competence protein F, putative [Roseobacter litoralis Och 149]
 gi|161393532|gb|EDQ17857.1| competence protein F, putative [Roseobacter litoralis Och 149]
          Length = 175

 Score = 71.1 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 33/59 (55%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ A          +AG  ILL+DDV+T+GAT   A  A   AG+  V ++T +R +K+
Sbjct: 116 VKGAIRAHPKRRHRLAGRPILLVDDVFTSGATLSSATDACLAAGSGPVYVVTLARVIKN 174


>gi|320352701|ref|YP_004194040.1| phosphoribosyltransferase [Desulfobulbus propionicus DSM 2032]
 gi|320121203|gb|ADW16749.1| phosphoribosyltransferase [Desulfobulbus propionicus DSM 2032]
          Length = 239

 Score = 71.1 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +++AF +   +   V G ++LLIDDV+TTG+T    +  L+  GA  + + T +RSL 
Sbjct: 183 LKDAFILS--MPASVQGKRVLLIDDVFTTGSTVNECSKVLRAGGATRIEVFTLARSLS 238


>gi|146309104|ref|YP_001189569.1| amidophosphoribosyltransferase-like protein [Pseudomonas mendocina
           ymp]
 gi|145577305|gb|ABP86837.1| amidophosphoribosyltransferase-like protein [Pseudomonas mendocina
           ymp]
          Length = 246

 Score = 71.1 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +       VAG  + L+DDV TTGATA   A  L+ AGA  V +   +R+ +
Sbjct: 187 LRQAFTL--DAKAQVAGCHLALVDDVLTTGATAGTLARLLRHAGAQRVDVYCLARTPR 242


>gi|325143108|gb|EGC65455.1| comF/gntX family protein [Neisseria meningitidis 961-5945]
 gi|325197553|gb|ADY93009.1| comF/gntX family protein [Neisseria meningitidis G2136]
          Length = 241

 Score = 71.1 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKMLKKSGANRICCWTLART 237


>gi|269213904|ref|ZP_05983088.2| ComF/gntX family protein [Neisseria cinerea ATCC 14685]
 gi|269145064|gb|EEZ71482.1| ComF/gntX family protein [Neisseria cinerea ATCC 14685]
          Length = 165

 Score = 71.1 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 109 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLGELAKMLKKSGANRICCWTLART 161


>gi|254483220|ref|ZP_05096453.1| hypothetical protein GPB2148_406 [marine gamma proteobacterium
           HTCC2148]
 gi|214036591|gb|EEB77265.1| hypothetical protein GPB2148_406 [marine gamma proteobacterium
           HTCC2148]
          Length = 240

 Score = 71.1 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 26/58 (44%), Positives = 32/58 (55%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +  AF V          L++ LIDDV TTGATA  AA ALK+AGA  V I   +R+  
Sbjct: 180 LSGAFTVSSGCD----NLRVALIDDVLTTGATAGEAARALKQAGAARVEIWCLARTPP 233


>gi|66047912|ref|YP_237753.1| phosphoribosyltransferase [Pseudomonas syringae pv. syringae B728a]
 gi|63258619|gb|AAY39715.1| Phosphoribosyltransferase [Pseudomonas syringae pv. syringae B728a]
 gi|330970893|gb|EGH70959.1| phosphoribosyltransferase [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 244

 Score = 71.1 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +       V G  + L+DDV TTG+TA+  A  L  AGA  V +   +R+ +
Sbjct: 186 LRGAFTLID--PDWVKGRHLALVDDVLTTGSTAEVIAGLLNTAGARRVDVYCLARTPR 241


>gi|170766640|ref|ZP_02901093.1| protein GntX [Escherichia albertii TW07627]
 gi|170124078|gb|EDS93009.1| protein GntX [Escherichia albertii TW07627]
          Length = 227

 Score = 70.7 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|94264829|ref|ZP_01288605.1| competence protein F-like protein [delta proteobacterium MLMS-1]
 gi|93454710|gb|EAT04971.1| competence protein F-like protein [delta proteobacterium MLMS-1]
          Length = 251

 Score = 70.7 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           R AF + Q     V   ++LL+DDV+TTG+T    A  LK AGA  V +LT +R 
Sbjct: 197 RGAFALSQ--PHLVKRRRVLLVDDVFTTGSTVNECAGVLKAAGAAEVQVLTLARV 249


>gi|291615045|ref|YP_003525202.1| phosphoribosyltransferase [Sideroxydans lithotrophicus ES-1]
 gi|291585157|gb|ADE12815.1| phosphoribosyltransferase [Sideroxydans lithotrophicus ES-1]
          Length = 238

 Score = 70.7 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 26/58 (44%), Positives = 33/58 (56%), Gaps = 3/58 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           MR AF      S  V G  I ++DDV TTGA+    A ALK+AGA  VS+   +R+L 
Sbjct: 181 MRQAFVCS---STDVRGKHIAIVDDVMTTGASTGELARALKQAGAREVSVWVVARTLP 235


>gi|196230002|ref|ZP_03128865.1| competence protein F, putative [Chthoniobacter flavus Ellin428]
 gi|196225599|gb|EDY20106.1| competence protein F, putative [Chthoniobacter flavus Ellin428]
          Length = 243

 Score = 70.7 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +RNAF V       V    ++L+DDV+TTG+T    A  L++AGA +V ++T +R
Sbjct: 190 LRNAFRVRHA--SRVQSRHLILVDDVFTTGSTVAECARVLRQAGAASVRVVTVAR 242


>gi|37524220|ref|NP_927564.1| gluconate periplasmic binding protein [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|36783643|emb|CAE12494.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 227

 Score = 70.7 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF +       V G  + ++DDV TTGAT    +  L +AGA +V +    R+L
Sbjct: 175 LRKAFQL----CGSVTGQHVAILDDVITTGATMTEISRLLIRAGARSVQVWAICRTL 227


>gi|255659147|ref|ZP_05404556.1| putative competence protein F [Mitsuokella multacida DSM 20544]
 gi|260848597|gb|EEX68604.1| putative competence protein F [Mitsuokella multacida DSM 20544]
          Length = 218

 Score = 70.7 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 22/54 (40%), Positives = 35/54 (64%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +++AF++ +     V+G  ILL+DD+ TTGAT    A  L++AGA  V +L F+
Sbjct: 163 LKDAFSMARD--ADVSGKHILLLDDILTTGATLSACAAVLRRAGAARVDVLVFA 214


>gi|163759885|ref|ZP_02166969.1| phosphoribosyltransferase [Hoeflea phototrophica DFL-43]
 gi|162282843|gb|EDQ33130.1| phosphoribosyltransferase [Hoeflea phototrophica DFL-43]
          Length = 187

 Score = 70.7 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 36/58 (62%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF VP      ++G K+LL+DDV TTG+T   A  AL +AGA  V ILTF+R   
Sbjct: 122 VRGAFAVPPSQMPRISGYKVLLVDDVLTTGSTVAAATRALNRAGAEQVCILTFARVAS 179


>gi|259910061|ref|YP_002650417.1| gluconate periplasmic binding protein [Erwinia pyrifoliae Ep1/96]
 gi|224965683|emb|CAX57215.1| gluconate periplasmic binding protein [Erwinia pyrifoliae Ep1/96]
 gi|283480161|emb|CAY76077.1| Competence protein F [Erwinia pyrifoliae DSM 12163]
          Length = 227

 Score = 70.7 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF +       V G  I L+DDV TTG+TA   +  L   GA +V I    R+L
Sbjct: 175 LRGAFRL----ETAVRGCHIALLDDVVTTGSTAAEISRVLLANGAASVEIWCLCRTL 227


>gi|161505924|ref|YP_001573035.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160867271|gb|ABX23894.1| hypothetical protein SARI_04105 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 243

 Score = 70.7 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L ++GA TV +    R+L
Sbjct: 191 LKNAFRL----ELPVRGLHMVIVDDVVTTGSTVAEIAQLLLRSGAATVQVWCLCRTL 243


>gi|325111311|ref|YP_004272379.1| phosphoribosyltransferase [Planctomyces brasiliensis DSM 5305]
 gi|324971579|gb|ADY62357.1| phosphoribosyltransferase [Planctomyces brasiliensis DSM 5305]
          Length = 254

 Score = 70.7 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R A++V +     + G ++LL+DD+ TTG+TA+    AL +AGA  V +   +R LK
Sbjct: 197 VRGAYSVHRA--TGLQGARVLLVDDILTTGSTAQVCTRALLEAGAAEVFVAVLARGLK 252


>gi|254784709|ref|YP_003072137.1| competence protein ComF [Teredinibacter turnerae T7901]
 gi|237683729|gb|ACR10993.1| competence protein ComF [Teredinibacter turnerae T7901]
          Length = 234

 Score = 70.3 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +RN++ + +     V    ILL+DDV TTGAT    A  L+ AGA  V I   +R+ K
Sbjct: 180 VRNSYAITR----DVRHRHILLVDDVMTTGATVGAIAQLLRDAGANRVDIACLARTPK 233


>gi|332798810|ref|YP_004460309.1| phosphoribosyltransferase [Tepidanaerobacter sp. Re1]
 gi|332696545|gb|AEE91002.1| phosphoribosyltransferase [Tepidanaerobacter sp. Re1]
          Length = 238

 Score = 70.3 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +  AF V +     +    +LLIDDVYTTGAT      +L +AGA  V ++T +R
Sbjct: 185 LEGAFKVVKNNK--IHDKIVLLIDDVYTTGATTGECTKSLLEAGAKAVYVMTCAR 237


>gi|319411246|emb|CBY91653.1| putative GntX-like protein [Neisseria meningitidis WUE 2594]
          Length = 202

 Score = 70.3 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 146 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 198


>gi|296840875|ref|ZP_06899408.1| ComF/gntX family protein [Neisseria polysaccharea ATCC 43768]
 gi|296839639|gb|EFH23577.1| ComF/gntX family protein [Neisseria polysaccharea ATCC 43768]
          Length = 165

 Score = 70.3 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 109 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 161


>gi|240014974|ref|ZP_04721887.1| hypothetical protein NgonD_10105 [Neisseria gonorrhoeae DGI18]
 gi|240081564|ref|ZP_04726107.1| hypothetical protein NgonF_09685 [Neisseria gonorrhoeae FA19]
 gi|240116577|ref|ZP_04730639.1| hypothetical protein NgonPID1_10148 [Neisseria gonorrhoeae PID18]
 gi|240122043|ref|ZP_04735005.1| hypothetical protein NgonPI_09815 [Neisseria gonorrhoeae PID24-1]
 gi|240129014|ref|ZP_04741675.1| hypothetical protein NgonS_10394 [Neisseria gonorrhoeae SK-93-1035]
 gi|268597659|ref|ZP_06131826.1| competence protein [Neisseria gonorrhoeae FA19]
 gi|268602245|ref|ZP_06136412.1| competence protein [Neisseria gonorrhoeae PID18]
 gi|268687393|ref|ZP_06154255.1| competence protein [Neisseria gonorrhoeae SK-93-1035]
 gi|268551447|gb|EEZ46466.1| competence protein [Neisseria gonorrhoeae FA19]
 gi|268586376|gb|EEZ51052.1| competence protein [Neisseria gonorrhoeae PID18]
 gi|268627677|gb|EEZ60077.1| competence protein [Neisseria gonorrhoeae SK-93-1035]
          Length = 241

 Score = 70.3 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 237


>gi|239999818|ref|ZP_04719742.1| hypothetical protein Ngon3_10123 [Neisseria gonorrhoeae 35/02]
 gi|254494599|ref|ZP_05107770.1| competence protein [Neisseria gonorrhoeae 1291]
 gi|268595627|ref|ZP_06129794.1| competence protein [Neisseria gonorrhoeae 35/02]
 gi|293398086|ref|ZP_06642291.1| hypothetical protein NGNG_01641 [Neisseria gonorrhoeae F62]
 gi|226513639|gb|EEH62984.1| competence protein [Neisseria gonorrhoeae 1291]
 gi|268549016|gb|EEZ44434.1| competence protein [Neisseria gonorrhoeae 35/02]
 gi|291611349|gb|EFF40419.1| hypothetical protein NGNG_01641 [Neisseria gonorrhoeae F62]
          Length = 241

 Score = 70.3 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 237


>gi|194099619|ref|YP_002002750.1| Competence protein [Neisseria gonorrhoeae NCCP11945]
 gi|193934909|gb|ACF30733.1| Competence protein [Neisseria gonorrhoeae NCCP11945]
 gi|317165108|gb|ADV08649.1| hypothetical protein NGTW08_1692 [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 202

 Score = 70.3 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 146 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 198


>gi|48428733|gb|AAT42382.1| putative amidophosphoribosyltransferase [Collimonas fungivorans
           Ter331]
          Length = 236

 Score = 70.3 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 30/56 (53%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF VP      + G  I ++DDV TTG T    A  L++ GA  ++   F+R+
Sbjct: 180 LRQAFIVPPAAMMQIRGRHIGVVDDVMTTGETLHALAQTLRRHGASRITNFVFART 235


>gi|59802047|ref|YP_208759.1| hypothetical protein NGO1726 [Neisseria gonorrhoeae FA 1090]
 gi|59718942|gb|AAW90347.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
          Length = 241

 Score = 70.3 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 237


>gi|325145262|gb|EGC67541.1| comF/gntX family protein [Neisseria meningitidis M01-240013]
          Length = 241

 Score = 70.3 bits (172), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 237


>gi|148266135|ref|YP_001232841.1| amidophosphoribosyltransferase-like protein [Geobacter
           uraniireducens Rf4]
 gi|146399635|gb|ABQ28268.1| amidophosphoribosyltransferase-like protein [Geobacter
           uraniireducens Rf4]
          Length = 238

 Score = 70.3 bits (172), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 25/56 (44%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF V       VAG +++L+DDVYTTG+T    A  LK AGA  V ++T +R 
Sbjct: 184 VRGAFAVTD--KDAVAGKRVILVDDVYTTGSTVAECAKTLKCAGAEAVFVVTAARV 237


>gi|15676193|ref|NP_273325.1| competence protein [Neisseria meningitidis MC58]
 gi|7225493|gb|AAF40723.1| competence protein [Neisseria meningitidis MC58]
 gi|316985199|gb|EFV64151.1| competence protein [Neisseria meningitidis H44/76]
 gi|325141105|gb|EGC63608.1| comF/gntX family protein [Neisseria meningitidis CU385]
 gi|325199472|gb|ADY94927.1| comF/gntX family protein [Neisseria meningitidis H44/76]
          Length = 241

 Score = 70.3 bits (172), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 237


>gi|292900950|ref|YP_003540319.1| competence protein [Erwinia amylovora ATCC 49946]
 gi|291200798|emb|CBJ47932.1| putative competence protein [Erwinia amylovora ATCC 49946]
          Length = 227

 Score = 70.3 bits (172), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF +       V G  I L+DDV TTG+TA   +  L   GA +V I    R+L
Sbjct: 175 LRGAFRL----ETAVRGYHIALLDDVVTTGSTAAEISRVLLANGAASVEIWCLCRTL 227


>gi|218768948|ref|YP_002343460.1| hypothetical protein NMA2217 [Neisseria meningitidis Z2491]
 gi|121052956|emb|CAM09310.1| hypothetical protein NMA2217 [Neisseria meningitidis Z2491]
          Length = 241

 Score = 70.3 bits (172), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 237


>gi|56964847|ref|YP_176578.1| late competence protein ComFC [Bacillus clausii KSM-K16]
 gi|56911090|dbj|BAD65617.1| late competence protein ComFC [Bacillus clausii KSM-K16]
          Length = 234

 Score = 70.3 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 33/55 (60%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +N F V    +  +AG   L++DD+YTTG T + AA  L   GA +VS LT +R+
Sbjct: 179 KNPFCVLSRKTSDIAGKDFLVVDDIYTTGTTVRQAAAILLAHGAKSVSSLTVARA 233


>gi|328542087|ref|YP_004302196.1| phosphoribosyl transferase domain protein [polymorphum gilvum
           SL003B-26A1]
 gi|326411836|gb|ADZ68899.1| Phosphoribosyl transferase domain protein [Polymorphum gilvum
           SL003B-26A1]
          Length = 257

 Score = 70.3 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 32/54 (59%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +R AF +       VAG  ++L+DDV TTG+T    A  LK AGA  V +LTF+
Sbjct: 195 VRGAFRLRAGAEAQVAGRPVVLVDDVLTTGSTVTACARVLKAAGAAGVDVLTFA 248


>gi|240017422|ref|ZP_04723962.1| hypothetical protein NgonFA_09723 [Neisseria gonorrhoeae FA6140]
 gi|240113843|ref|ZP_04728333.1| hypothetical protein NgonM_09808 [Neisseria gonorrhoeae MS11]
 gi|240118801|ref|ZP_04732863.1| hypothetical protein NgonPID_10159 [Neisseria gonorrhoeae PID1]
 gi|240126552|ref|ZP_04739438.1| hypothetical protein NgonSK_10160 [Neisseria gonorrhoeae SK-92-679]
 gi|260439662|ref|ZP_05793478.1| hypothetical protein NgonDG_00973 [Neisseria gonorrhoeae DGI2]
 gi|268599910|ref|ZP_06134077.1| competence protein [Neisseria gonorrhoeae MS11]
 gi|268604511|ref|ZP_06138678.1| competence protein [Neisseria gonorrhoeae PID1]
 gi|268685131|ref|ZP_06151993.1| competence protein [Neisseria gonorrhoeae SK-92-679]
 gi|291042904|ref|ZP_06568645.1| competence protein [Neisseria gonorrhoeae DGI2]
 gi|268584041|gb|EEZ48717.1| competence protein [Neisseria gonorrhoeae MS11]
 gi|268588642|gb|EEZ53318.1| competence protein [Neisseria gonorrhoeae PID1]
 gi|268625415|gb|EEZ57815.1| competence protein [Neisseria gonorrhoeae SK-92-679]
 gi|291013338|gb|EFE05304.1| competence protein [Neisseria gonorrhoeae DGI2]
          Length = 241

 Score = 70.3 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 237


>gi|82702257|ref|YP_411823.1| phosphoribosyltransferase [Nitrosospira multiformis ATCC 25196]
 gi|82410322|gb|ABB74431.1| Phosphoribosyltransferase [Nitrosospira multiformis ATCC 25196]
          Length = 239

 Score = 70.3 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +RNAF       +++ G  I ++DDV TTGAT    A  L+K GA+ +S    +R+L 
Sbjct: 183 IRNAF----DCEENLDGKHIAIVDDVMTTGATLNELARVLRKCGAVHISAWVVARTLP 236


>gi|5921548|emb|CAB56477.1| competence protein ComF [Pseudomonas stutzeri]
          Length = 235

 Score = 70.3 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF + +     + G  + +IDDV+TTGATA+  A  LK+AGA  V I   +R+ K
Sbjct: 177 LRQAFALAEGQV--LHGQHLAVIDDVFTTGATAEALARLLKRAGAARVDIYCLARTPK 232


>gi|134300912|ref|YP_001114408.1| phosphoribosyltransferase [Desulfotomaculum reducens MI-1]
 gi|134053612|gb|ABO51583.1| phosphoribosyltransferase [Desulfotomaculum reducens MI-1]
          Length = 237

 Score = 70.3 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +R AF+V     + + G  IL++DDV+TTG+T    A  L K GA  + ++T +
Sbjct: 182 LRGAFDVN--TPEAIKGKAILIVDDVFTTGSTMAEVAETLHKKGAGKLYVITLA 233


>gi|325205353|gb|ADZ00806.1| comF/gntX family protein [Neisseria meningitidis M04-240196]
          Length = 241

 Score = 70.3 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 237


>gi|310765660|gb|ADP10610.1| gluconate periplasmic binding protein [Erwinia sp. Ejp617]
          Length = 215

 Score = 70.3 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF +       V G  I L+DDV TTG+TA   +  L   GA +V I    R+L
Sbjct: 163 LRGAFRL----ETAVRGCHIALLDDVVTTGSTAAEISRVLLANGAASVEIWCLCRTL 215


>gi|121634139|ref|YP_974384.1| hypothetical protein NMC0263 [Neisseria meningitidis FAM18]
 gi|120865845|emb|CAM09577.1| hypothetical protein NMC0263 [Neisseria meningitidis FAM18]
 gi|325131587|gb|EGC54294.1| comF/gntX family protein [Neisseria meningitidis M6190]
 gi|325139158|gb|EGC61704.1| comF/gntX family protein [Neisseria meningitidis ES14902]
          Length = 241

 Score = 70.3 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 237


>gi|157372865|ref|YP_001480854.1| gluconate periplasmic binding protein [Serratia proteamaculans 568]
 gi|157324629|gb|ABV43726.1| putative competence-related protein F [Serratia proteamaculans 568]
          Length = 227

 Score = 70.3 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF   +     + G  I L+DDV TTG+T    A  L++ G  ++ I    R+L
Sbjct: 175 LRGAFRCHE----SLEGRHIALLDDVVTTGSTVAEIARLLQRQGVASIQIWCVCRTL 227


>gi|92116101|ref|YP_575830.1| phosphoribosyltransferase [Nitrobacter hamburgensis X14]
 gi|91798995|gb|ABE61370.1| phosphoribosyltransferase [Nitrobacter hamburgensis X14]
          Length = 270

 Score = 70.3 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 33/57 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF +    +  + G ++++IDDV T+GAT    A  L +A A  V +L F+R +
Sbjct: 207 VQGAFKIATERTSRIQGRRVIVIDDVLTSGATVDACARVLLRAKAAQVDVLVFARVV 263


>gi|312174099|emb|CBX82352.1| Competence protein F [Erwinia amylovora ATCC BAA-2158]
          Length = 237

 Score = 69.9 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF +       V G  I L+DDV TTG+TA   +  L   GA +V I    R+L
Sbjct: 185 LRGAFRL----ETAVRGYHIALLDDVVTTGSTAAEISRVLLANGAASVEIWCLCRTL 237


>gi|149204345|ref|ZP_01881312.1| competence protein F, putative [Roseovarius sp. TM1035]
 gi|149142230|gb|EDM30277.1| competence protein F, putative [Roseovarius sp. TM1035]
          Length = 232

 Score = 69.9 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 35/59 (59%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           + +A  V       +AG  +L++DDV T+GAT   A  A   AG+  VS++T +R++KD
Sbjct: 173 LTDAIRVTARHRGLIAGRSVLIVDDVMTSGATLSVATQACFSAGSGEVSVVTLARAVKD 231


>gi|134096080|ref|YP_001101155.1| amidophosphoribosyltransferase [Herminiimonas arsenicoxydans]
 gi|133739983|emb|CAL63034.1| Putative amidophosphoribosyltransferase [Herminiimonas
           arsenicoxydans]
          Length = 247

 Score = 69.9 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 33/58 (56%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           MR+AF +P      V G  + ++DDV TTG T    A  LK+ GA+ V+ L F+R+  
Sbjct: 189 MRHAFVLPANADVLVRGRHVGVVDDVMTTGVTLNEIAATLKRHGAVRVTNLVFARTPP 246


>gi|292489915|ref|YP_003532805.1| competence protein F [Erwinia amylovora CFBP1430]
 gi|291555352|emb|CBA23721.1| Competence protein F [Erwinia amylovora CFBP1430]
          Length = 237

 Score = 69.9 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF +       V G  I L+DDV TTG+TA   +  L   GA +V I    R+L
Sbjct: 185 LRGAFRL----ETAVRGYHIALLDDVVTTGSTAAEISRVLLANGAASVEIWCLCRTL 237


>gi|295401188|ref|ZP_06811161.1| phosphoribosyltransferase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|294976781|gb|EFG52386.1| phosphoribosyltransferase [Geobacillus thermoglucosidasius
           C56-YS93]
          Length = 235

 Score = 69.9 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
            N F + +     +    I+LIDD+YTTG T + AA  L KAGA +VS LT +R
Sbjct: 183 ENVFRLSE--QTSLQDKPIVLIDDIYTTGTTLRHAAKVLLKAGAASVSSLTLAR 234


>gi|323706361|ref|ZP_08117926.1| phosphoribosyltransferase [Thermoanaerobacterium xylanolyticum
           LX-11]
 gi|323534323|gb|EGB24109.1| phosphoribosyltransferase [Thermoanaerobacterium xylanolyticum
           LX-11]
          Length = 229

 Score = 69.9 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF V       V    ILL+DDV TTG+T    A  L+++GA  V   T +
Sbjct: 173 LKGAFKVVYG--DLVKDKTILLVDDVLTTGSTLDECAKVLRESGAKDVFAATIA 224


>gi|197265899|ref|ZP_03165973.1| protein GntX [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197244154|gb|EDY26774.1| protein GntX [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
          Length = 227

 Score = 69.9 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|161870794|ref|YP_001599967.1| competence protein [Neisseria meningitidis 053442]
 gi|161596347|gb|ABX74007.1| competence protein [Neisseria meningitidis 053442]
          Length = 179

 Score = 69.9 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +            ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 123 IKNAFEIRTPPP---KNCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 175


>gi|168465219|ref|ZP_02699111.1| protein GntX [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|195632168|gb|EDX50652.1| protein GntX [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
          Length = 227

 Score = 69.9 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|254805688|ref|YP_003083909.1| competence protein [Neisseria meningitidis alpha14]
 gi|254669229|emb|CBA08067.1| competence protein [Neisseria meningitidis alpha14]
          Length = 241

 Score = 69.9 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 237


>gi|257440338|ref|ZP_05616093.1| competence protein F-related protein [Faecalibacterium prausnitzii
           A2-165]
 gi|257197184|gb|EEU95468.1| competence protein F-related protein [Faecalibacterium prausnitzii
           A2-165]
          Length = 259

 Score = 69.9 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  AF V     + V G +ILL+DDV TTGATA   A AL  AGA +V  +  +  
Sbjct: 187 VAGAFRV--ARPEAVEGKRILLVDDVLTTGATASACAQALLDAGAQSVFAVALATV 240


>gi|224585305|ref|YP_002639104.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|224469833|gb|ACN47663.1| putative competence protein [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
          Length = 215

 Score = 69.9 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|16762777|ref|NP_458394.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29144264|ref|NP_807606.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56415425|ref|YP_152500.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197364355|ref|YP_002143992.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|213161412|ref|ZP_03347122.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213420970|ref|ZP_03354036.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E01-6750]
 gi|213426879|ref|ZP_03359629.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213647817|ref|ZP_03377870.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|289824842|ref|ZP_06544285.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|51701439|sp|Q8Z222|GNTX_SALTI RecName: Full=Protein GntX
 gi|25321978|pir||AD0997 probable competence protein STY4286 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16505083|emb|CAD08104.1| putative competence protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29139901|gb|AAO71466.1| putative competence protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56129682|gb|AAV79188.1| putative competence protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197095832|emb|CAR61405.1| putative competence protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 227

 Score = 69.9 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|317494417|ref|ZP_07952831.1| comF family protein [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316917667|gb|EFV39012.1| comF family protein [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 227

 Score = 69.9 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +RNAF       ++ +G  ILL+DDV+TTG+T    +  L   GA ++ ++   R+L
Sbjct: 175 LRNAFT----CQQNPSGKHILLVDDVFTTGSTIGEVSRLLIAQGAKSIQVVCLCRTL 227


>gi|304389097|ref|ZP_07371141.1| ComF/gntX family protein [Neisseria meningitidis ATCC 13091]
 gi|304336970|gb|EFM03160.1| ComF/gntX family protein [Neisseria meningitidis ATCC 13091]
          Length = 241

 Score = 69.9 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 237


>gi|62182012|ref|YP_218429.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161616553|ref|YP_001590518.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|205354866|ref|YP_002228667.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|207858750|ref|YP_002245401.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|62129645|gb|AAX67348.1| putative amidophosphoribosyltransferase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161365917|gb|ABX69685.1| hypothetical protein SPAB_04369 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|205274647|emb|CAR39701.1| putative competence protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|206710553|emb|CAR34911.1| putative competence protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|322716500|gb|EFZ08071.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|326630012|gb|EGE36355.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 227

 Score = 69.9 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|257483057|ref|ZP_05637098.1| competence protein ComF [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|331011709|gb|EGH91765.1| competence protein ComF [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 244

 Score = 69.9 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF +         G  + L+DDV TTG+TA+  A  L KAGA  V +   +R+ K
Sbjct: 186 LRDAFTLVDPDWA--QGKHLALVDDVLTTGSTAEVIARLLNKAGARRVDVYCLARTPK 241


>gi|328953683|ref|YP_004371017.1| phosphoribosyltransferase [Desulfobacca acetoxidans DSM 11109]
 gi|328454007|gb|AEB09836.1| phosphoribosyltransferase [Desulfobacca acetoxidans DSM 11109]
          Length = 239

 Score = 69.9 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 38/56 (67%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF V +     + G  +LL+DDVYTTGAT K   +AL++AGA TV++LT +R 
Sbjct: 183 VKGAFAVAK--PDAIIGRSVLLLDDVYTTGATVKECTLALRRAGAHTVTVLTVARV 236


>gi|325135072|gb|EGC57700.1| comF/gntX family protein [Neisseria meningitidis M13399]
          Length = 241

 Score = 69.9 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 237


>gi|194445852|ref|YP_002042762.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194404515|gb|ACF64737.1| protein GntX [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
          Length = 227

 Score = 69.9 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|168232649|ref|ZP_02657707.1| protein GntX [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|194469779|ref|ZP_03075763.1| protein GntX [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194456143|gb|EDX44982.1| protein GntX [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|205333040|gb|EDZ19804.1| protein GntX [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
          Length = 227

 Score = 69.9 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|242237774|ref|YP_002985955.1| gluconate periplasmic binding protein [Dickeya dadantii Ech703]
 gi|242129831|gb|ACS84133.1| gluconate periplasmic binding protein [Dickeya dadantii Ech703]
          Length = 233

 Score = 69.5 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF         + G ++ L+DDV TTG+T +  +  L  AGA  V I    R+L
Sbjct: 181 LKGAFE----CRMALDGKRVALLDDVVTTGSTVEEISRTLLAAGAAQVQIWCLCRTL 233


>gi|325130995|gb|EGC53722.1| comF/gntX family protein [Neisseria meningitidis OX99.30304]
 gi|325137094|gb|EGC59690.1| comF/gntX family protein [Neisseria meningitidis M0579]
 gi|325202904|gb|ADY98358.1| comF/gntX family protein [Neisseria meningitidis M01-240149]
 gi|325207297|gb|ADZ02749.1| comF/gntX family protein [Neisseria meningitidis NZ-05/33]
          Length = 241

 Score = 69.5 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +   +        ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPIP---ENCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 237


>gi|290512006|ref|ZP_06551374.1| gluconate periplasmic binding protein [Klebsiella sp. 1_1_55]
 gi|289775796|gb|EFD83796.1| gluconate periplasmic binding protein [Klebsiella sp. 1_1_55]
          Length = 224

 Score = 69.5 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL I ++DDV TTG+T    +  L + GA TV +    R+L
Sbjct: 172 LKNAFQL----EFAVEGLHIAIVDDVVTTGSTVAEISRLLLRNGAATVQVWCLCRTL 224


>gi|288933202|ref|YP_003437261.1| phosphoribosyltransferase [Klebsiella variicola At-22]
 gi|288887931|gb|ADC56249.1| phosphoribosyltransferase [Klebsiella variicola At-22]
          Length = 224

 Score = 69.5 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL I ++DDV TTG+T    +  L + GA TV +    R+L
Sbjct: 172 LKNAFQL----EFAVEGLHIAIVDDVVTTGSTVAEISRLLLRNGAATVQVWCLCRTL 224


>gi|16766798|ref|NP_462413.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|167549283|ref|ZP_02343042.1| protein GntX [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|167990715|ref|ZP_02571814.1| protein GntX [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|168241652|ref|ZP_02666584.1| protein GntX [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|194449324|ref|YP_002047535.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|200388063|ref|ZP_03214675.1| protein GntX [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|51701442|sp|Q8ZLI8|GNTX_SALTY RecName: Full=Protein GntX
 gi|16422069|gb|AAL22372.1| putative amidophosphoribosyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|194407628|gb|ACF67847.1| protein GntX [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|199605161|gb|EDZ03706.1| protein GntX [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|205325670|gb|EDZ13509.1| protein GntX [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|205330741|gb|EDZ17505.1| protein GntX [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205339021|gb|EDZ25785.1| protein GntX [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|261248665|emb|CBG26503.1| putative competence protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267995732|gb|ACY90617.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301160053|emb|CBW19572.1| putative competence protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312914534|dbj|BAJ38508.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321226561|gb|EFX51611.1| protein GntX [Salmonella enterica subsp. enterica serovar
           Typhimurium str. TN061786]
 gi|323131870|gb|ADX19300.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|332990362|gb|AEF09345.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 227

 Score = 69.5 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|238921501|ref|YP_002935016.1| hypothetical protein NT01EI_3653 [Edwardsiella ictaluri 93-146]
 gi|238871070|gb|ACR70781.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 226

 Score = 69.5 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF   +     +AG ++LL+DDV TTG+T    +  L   G M+V  +   R+L
Sbjct: 174 LRGAFAAHRA----LAGRRVLLVDDVITTGSTLSEISRLLIAQGVMSVETICLCRTL 226


>gi|300822788|ref|ZP_07102925.1| ComF family protein [Escherichia coli MS 119-7]
 gi|300524788|gb|EFK45857.1| ComF family protein [Escherichia coli MS 119-7]
          Length = 123

 Score = 69.5 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 71  LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 123


>gi|118588528|ref|ZP_01545937.1| phosphoribosyltransferase [Stappia aggregata IAM 12614]
 gi|118439234|gb|EAV45866.1| phosphoribosyltransferase [Stappia aggregata IAM 12614]
          Length = 253

 Score = 69.5 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 33/56 (58%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R+AF V    +  V G  ++LIDDV TTG+T       L  +GA +V +LTF++ 
Sbjct: 188 VRSAFKVDSARADLVQGRHVVLIDDVLTTGSTVSACCKCLLSSGAASVDVLTFAQV 243


>gi|261391800|emb|CAX49255.1| putative GntX-like protein [Neisseria meningitidis 8013]
          Length = 241

 Score = 69.5 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +            ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPPP---KNCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 237


>gi|242278332|ref|YP_002990461.1| phosphoribosyltransferase [Desulfovibrio salexigens DSM 2638]
 gi|242121226|gb|ACS78922.1| phosphoribosyltransferase [Desulfovibrio salexigens DSM 2638]
          Length = 247

 Score = 69.5 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/57 (45%), Positives = 34/57 (59%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +  AF     +   VA  +ILLIDDVYTTG+T    A  L +AGA  V ++T SR+L
Sbjct: 193 LHTAFTASPSI---VADKRILLIDDVYTTGSTVDECARTLLEAGAARVEVMTLSRAL 246


>gi|304322117|ref|YP_003855760.1| competence protein F [Parvularcula bermudensis HTCC2503]
 gi|303301019|gb|ADM10618.1| competence protein F [Parvularcula bermudensis HTCC2503]
          Length = 284

 Score = 69.5 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 34/58 (58%), Gaps = 1/58 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +  AF V +     + G   +L+DDV TTGAT    A  L++AGA++VS +T +R L 
Sbjct: 216 VSGAFAVREN-DDIIRGRSFVLVDDVLTTGATLLSCARPLRQAGALSVSAVTLARVLP 272


>gi|198244770|ref|YP_002217470.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|197939286|gb|ACH76619.1| protein GntX [Salmonella enterica subsp. enterica serovar Dublin
           str. CT_02021853]
          Length = 227

 Score = 69.5 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|168235105|ref|ZP_02660163.1| protein GntX [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|194736680|ref|YP_002116453.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|194712182|gb|ACF91403.1| protein GntX [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197291553|gb|EDY30905.1| protein GntX [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
          Length = 227

 Score = 69.5 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|110835082|ref|YP_693941.1| hypothetical protein ABO_2221 [Alcanivorax borkumensis SK2]
 gi|110648193|emb|CAL17669.1| conserved hypothetical protein [Alcanivorax borkumensis SK2]
          Length = 247

 Score = 69.5 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 34/58 (58%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF         V GL+++L+DDV TTG++A+ AA  L   GA  V + T +R+L 
Sbjct: 190 LRQAFR----CQHSVTGLRLILVDDVMTTGSSARAAAQCLLDQGAKDVRVWTLARTLP 243


>gi|323174048|gb|EFZ59676.1| protein gntX [Escherichia coli LT-68]
          Length = 129

 Score = 69.5 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 77  LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 129


>gi|320175495|gb|EFW50593.1| gluconate periplasmic binding protein [Shigella dysenteriae CDC
           74-1112]
          Length = 116

 Score = 69.5 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V G  ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 64  LKNAFRL----ELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 116


>gi|188535340|ref|YP_001909137.1| Predicted amidophosphoribosyltransferase GntX [Erwinia tasmaniensis
           Et1/99]
 gi|188030382|emb|CAO98273.1| Predicted amidophosphoribosyltransferase GntX [Erwinia tasmaniensis
           Et1/99]
          Length = 237

 Score = 69.5 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF +       V G  I+L+DDV TTG+TA   +  L  +GA +V I    R+L
Sbjct: 185 LRGAFRL----ETAVRGYHIVLLDDVLTTGSTAAEISRILLASGAASVEIWCLCRTL 237


>gi|154247019|ref|YP_001417977.1| phosphoribosyltransferase [Xanthobacter autotrophicus Py2]
 gi|154161104|gb|ABS68320.1| phosphoribosyltransferase [Xanthobacter autotrophicus Py2]
          Length = 255

 Score = 69.5 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 25/57 (43%), Positives = 37/57 (64%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +  AF      + H+ G ++LL+DDV+TTGAT    A AL++AGA+ V  LTF+R +
Sbjct: 196 VAGAFAACGNAASHLEGRRVLLVDDVFTTGATLDACAQALRRAGAIQVDALTFARVV 252


>gi|73666726|ref|YP_302742.1| competence protein F [Ehrlichia canis str. Jake]
 gi|72393867|gb|AAZ68144.1| competence protein F [Ehrlichia canis str. Jake]
          Length = 230

 Score = 69.5 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           AF V       +    ILL+DDV TTG TA+     L +AGA  V ++T +R+L
Sbjct: 179 AFIVKN--QHLITNKTILLVDDVITTGITARTCTNKLIEAGAKEVRVITLARTL 230


>gi|46204162|ref|ZP_00050412.2| COG1040: Predicted amidophosphoribosyltransferases
           [Magnetospirillum magnetotacticum MS-1]
          Length = 138

 Score = 69.5 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 37/59 (62%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ AF VP+     + G ++LLIDDV TTGAT   AA  L +AGA  V +LTF+   +D
Sbjct: 78  LQGAFRVPEGSRARIQGRRLLLIDDVSTTGATGNAAARVLLRAGAARVDLLTFATVTRD 136


>gi|298370454|ref|ZP_06981770.1| ComF/gntX family protein [Neisseria sp. oral taxon 014 str. F0314]
 gi|298281914|gb|EFI23403.1| ComF/gntX family protein [Neisseria sp. oral taxon 014 str. F0314]
          Length = 240

 Score = 69.5 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF++   V        ILLIDDV TTG+T    A  LKK+GA  V   + +R+
Sbjct: 184 VKNAFSIENDV---FKKRNILLIDDVVTTGSTFGELAQTLKKSGAEKVFCWSLARA 236


>gi|94496926|ref|ZP_01303500.1| amidophosphoribosyltransferase [Sphingomonas sp. SKA58]
 gi|94423602|gb|EAT08629.1| amidophosphoribosyltransferase [Sphingomonas sp. SKA58]
          Length = 256

 Score = 69.5 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF +        AG ++LLIDDV T+GATA   A  LK+ GA  V +L ++R+L D
Sbjct: 190 VRGAFALAAG--HGFAGRRVLLIDDVRTSGATAAACARMLKRGGATNVRLLCWARALPD 246


>gi|168260763|ref|ZP_02682736.1| protein GntX [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|168818675|ref|ZP_02830675.1| protein GntX [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|197251427|ref|YP_002148434.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|204928749|ref|ZP_03219948.1| protein GntX [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|238910485|ref|ZP_04654322.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|197215130|gb|ACH52527.1| protein GntX [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
 gi|204322182|gb|EDZ07380.1| protein GntX [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|205344315|gb|EDZ31079.1| protein GntX [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|205350305|gb|EDZ36936.1| protein GntX [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|320087926|emb|CBY97688.1| Protein gntX [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
 gi|322614116|gb|EFY11052.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322618008|gb|EFY14901.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625378|gb|EFY22204.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322629843|gb|EFY26616.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322632268|gb|EFY29019.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322636381|gb|EFY33088.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322643237|gb|EFY39806.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322644761|gb|EFY41297.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322651214|gb|EFY47598.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322654918|gb|EFY51233.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322659175|gb|EFY55427.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322663124|gb|EFY59328.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322668610|gb|EFY64763.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674586|gb|EFY70679.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322678208|gb|EFY74269.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322682535|gb|EFY78556.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322684248|gb|EFY80254.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323192197|gb|EFZ77429.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323196377|gb|EFZ81529.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323201822|gb|EFZ86885.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323206364|gb|EFZ91325.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323211957|gb|EFZ96784.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323216863|gb|EGA01586.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323222262|gb|EGA06645.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323224277|gb|EGA08566.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323228205|gb|EGA12336.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323233528|gb|EGA17621.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323237010|gb|EGA21077.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323243775|gb|EGA27791.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323245983|gb|EGA29970.1| DNA utilization protein GntX [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323250759|gb|EGA34637.1| DNA utilization protein GntX [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323255770|gb|EGA39520.1| DNA utilization protein GntX [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323261372|gb|EGA44958.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323267655|gb|EGA51137.1| DNA utilization protein GntX [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323268535|gb|EGA52002.1| DNA utilization protein GntX [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 227

 Score = 69.5 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|315923979|ref|ZP_07920207.1| competence protein F [Pseudoramibacter alactolyticus ATCC 23263]
 gi|315622819|gb|EFV02772.1| competence protein F [Pseudoramibacter alactolyticus ATCC 23263]
          Length = 248

 Score = 69.5 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +  AF V       +AG +++L+DDV TTGAT +  A ALK +GA  V +LT + + 
Sbjct: 194 VAGAFRVNPDQR--IAGKRLVLVDDVMTTGATLRACASALKASGAAAVYVLTCAATT 248


>gi|325128978|gb|EGC51829.1| comF/gntX family protein [Neisseria meningitidis N1568]
          Length = 241

 Score = 69.5 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +            ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPPP---KNCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 237


>gi|58038532|ref|YP_190496.1| competence protein F [Gluconobacter oxydans 621H]
 gi|58000946|gb|AAW59840.1| Competence protein F [Gluconobacter oxydans 621H]
          Length = 228

 Score = 69.5 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 35/58 (60%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           M +A  V +     + G  +LL+DDV TTG+TA    +AL KAGA +V IL  +R+ +
Sbjct: 160 MEHAVRVRKGRGARIEGQAVLLVDDVLTTGSTASACTMALMKAGAASVDILVAARTGR 217


>gi|296105107|ref|YP_003615253.1| gluconate periplasmic binding protein [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295059566|gb|ADF64304.1| gluconate periplasmic binding protein [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 215

 Score = 69.5 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL I ++DDV TTG+T    +  L ++GA +V +    R+L
Sbjct: 163 LKNAFRL----EFAVKGLHIAIVDDVVTTGSTVAELSRLLLQSGAASVQVWCLCRTL 215


>gi|254671567|emb|CBA09213.1| competence protein F [Neisseria meningitidis alpha153]
          Length = 241

 Score = 69.1 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +            ILLIDDV+TTGAT    A  LKK+GA  +   T +R+
Sbjct: 185 IKNAFEIRTPPP---KNCNILLIDDVFTTGATLDELAKTLKKSGANRICCWTLART 237


>gi|326625251|gb|EGE31596.1| protein GntX [Salmonella enterica subsp. enterica serovar Dublin
           str. 3246]
          Length = 215

 Score = 69.1 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 163 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 215


>gi|294638122|ref|ZP_06716378.1| competence protein F [Edwardsiella tarda ATCC 23685]
 gi|291088689|gb|EFE21250.1| competence protein F [Edwardsiella tarda ATCC 23685]
          Length = 226

 Score = 69.1 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF         + G ++LL+DDV TTG+T    +  L   G M+V ++   R+L
Sbjct: 174 LRGAFTCHPA----LTGRRVLLVDDVVTTGSTLSEISQRLIAQGVMSVEVICLCRTL 226


>gi|297569953|ref|YP_003691297.1| phosphoribosyltransferase [Desulfurivibrio alkaliphilus AHT2]
 gi|296925868|gb|ADH86678.1| phosphoribosyltransferase [Desulfurivibrio alkaliphilus AHT2]
          Length = 255

 Score = 69.1 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF  PQ     V    +LL+DDV+TTGAT    A  L++AGA  V + T +R 
Sbjct: 200 LKGAFVAPQPAM--VRKRSLLLVDDVFTTGATVNECAKVLRQAGAARVDVFTLARV 253


>gi|237728732|ref|ZP_04559213.1| gluconate periplasmic binding protein [Citrobacter sp. 30_2]
 gi|226909354|gb|EEH95272.1| gluconate periplasmic binding protein [Citrobacter sp. 30_2]
          Length = 227

 Score = 69.1 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|58697413|ref|ZP_00372723.1| competence protein F, interruption-N [Wolbachia endosymbiont of
           Drosophila simulans]
 gi|225630605|ref|YP_002727396.1| putative competence protein F [Wolbachia sp. wRi]
 gi|58536171|gb|EAL59759.1| competence protein F, interruption-N [Wolbachia endosymbiont of
           Drosophila simulans]
 gi|225592586|gb|ACN95605.1| putative competence protein F [Wolbachia sp. wRi]
          Length = 243

 Score = 69.1 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ AF       K +    ++L+DDV TTGAT +  +  +  +GA  V +L+ +R++ D
Sbjct: 180 LKKAFK--TSNKKIIENKIVILVDDVVTTGATVRSCSQEILNSGAKEVRVLSLARTVND 236


>gi|187735075|ref|YP_001877187.1| competence protein F, [Akkermansia muciniphila ATCC BAA-835]
 gi|187425127|gb|ACD04406.1| competence protein F, putative [Akkermansia muciniphila ATCC
           BAA-835]
          Length = 249

 Score = 69.1 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/61 (37%), Positives = 36/61 (59%), Gaps = 5/61 (8%)

Query: 1   MRNAFNV-----PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +R+A  +      +     V G  +LL+DDV+TTGATA   A  L ++GA +V +LT +R
Sbjct: 183 LRHARKIYAADEKRMKRSPVRGRDVLLVDDVFTTGATADSCARLLLRSGAASVCVLTLAR 242

Query: 56  S 56
           +
Sbjct: 243 T 243


>gi|253987621|ref|YP_003038977.1| hypothetical protein PAU_00138 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253779071|emb|CAQ82231.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 154

 Score = 69.1 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF +       VAG  + ++DDV TTGAT    +  L +AGA +V +    R+L
Sbjct: 102 LRKAFQL----CGPVAGQHVAILDDVITTGATITEISRLLIRAGARSVQVWAICRTL 154


>gi|171910308|ref|ZP_02925778.1| Phosphoribosyltransferase [Verrucomicrobium spinosum DSM 4136]
          Length = 255

 Score = 69.1 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 33/58 (56%), Gaps = 3/58 (5%)

Query: 1   MRNAFNVPQYV--SKHVAGLKILLIDDVYTTGATAKCAAIALK-KAGAMTVSILTFSR 55
           ++ AF V   +     + G  ILLIDDV TTG+TA   A  L  +AGA  V +LT +R
Sbjct: 197 LKRAFRVKPSLVRRGRLKGKTILLIDDVLTTGSTASECAKVLLQEAGAARVWVLTVAR 254


>gi|88606693|ref|YP_505817.1| comF family protein [Anaplasma phagocytophilum HZ]
 gi|88597756|gb|ABD43226.1| comF family protein [Anaplasma phagocytophilum HZ]
          Length = 217

 Score = 69.1 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           + N+F V   V     G  ++LIDDV TTGA+ +  A  LK +GA  V  LT +R++ 
Sbjct: 162 VWNSFKVTNSV--LFRGKVVVLIDDVVTTGASLQECARVLKNSGAKEVLGLTLARTMS 217


>gi|298528419|ref|ZP_07015823.1| phosphoribosyltransferase [Desulfonatronospira thiodismutans
           ASO3-1]
 gi|298512071|gb|EFI35973.1| phosphoribosyltransferase [Desulfonatronospira thiodismutans
           ASO3-1]
          Length = 262

 Score = 69.1 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++ AF     V   V G  ILL+DD+YTTG+T +     L KAGA  V +L  +R
Sbjct: 208 LKGAFEAHAGV---VRGQSILLVDDIYTTGSTLEECTRTLIKAGASRVQVLFLAR 259


>gi|296116147|ref|ZP_06834765.1| competence protein F [Gluconacetobacter hansenii ATCC 23769]
 gi|295977253|gb|EFG84013.1| competence protein F [Gluconacetobacter hansenii ATCC 23769]
          Length = 282

 Score = 69.1 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 30/56 (53%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  A  V  +    + G  ++L+DDV TTG+T     +AL+  GA  V +L+ +R 
Sbjct: 214 LHGAITVRSHRMAALRGRHVILVDDVMTTGSTLAACTVALRDHGAARVDVLSATRV 269


>gi|238927403|ref|ZP_04659163.1| possible competence protein F [Selenomonas flueggei ATCC 43531]
 gi|238884685|gb|EEQ48323.1| possible competence protein F [Selenomonas flueggei ATCC 43531]
          Length = 171

 Score = 69.1 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +R AF +       V G  ILL+DD+ TTGAT    A  L   GA  V  +  +
Sbjct: 116 LRGAFALAAD--ADVQGKDILLVDDIMTTGATLTECARVLHHGGARRVYAIALA 167


>gi|213581450|ref|ZP_03363276.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
          Length = 201

 Score = 69.1 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 149 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 201


>gi|157148995|ref|YP_001456315.1| gluconate periplasmic binding protein [Citrobacter koseri ATCC
           BAA-895]
 gi|157086200|gb|ABV15878.1| hypothetical protein CKO_04833 [Citrobacter koseri ATCC BAA-895]
          Length = 243

 Score = 69.1 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 191 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 243


>gi|304413199|ref|ZP_07394672.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain [Candidatus Regiella
           insecticola LSR1]
 gi|304284042|gb|EFL92435.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain [Candidatus Regiella
           insecticola LSR1]
          Length = 236

 Score = 69.1 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R  F    + + +V G  + L+DDV TTG+T K  A  L   GA +V +    R+L
Sbjct: 184 LRGVF----HCTDNVRGQHLALLDDVITTGSTMKEMAKLLLAQGATSVQVWCLCRTL 236


>gi|83592076|ref|YP_425828.1| phosphoribosyltransferase [Rhodospirillum rubrum ATCC 11170]
 gi|83574990|gb|ABC21541.1| Phosphoribosyltransferase [Rhodospirillum rubrum ATCC 11170]
          Length = 246

 Score = 69.1 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF V +     +AG +++LIDDV TTGATA   A AL  AGA  V +LT +R 
Sbjct: 188 VQGAFVVVR--PDEIAGRRVVLIDDVLTTGATANACARALLAAGATGVDVLTLARV 241


>gi|86136799|ref|ZP_01055377.1| competence protein F, putative [Roseobacter sp. MED193]
 gi|85826123|gb|EAQ46320.1| competence protein F, putative [Roseobacter sp. MED193]
          Length = 242

 Score = 69.1 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 28/58 (48%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +  A          + G  +LL+DDV T+GAT    A A ++AGA  V +   +R  +
Sbjct: 184 LSRAIVAHPRHRALMQGRVVLLVDDVMTSGATLTACADACREAGAADVRVAVLARVTR 241


>gi|297618073|ref|YP_003703232.1| phosphoribosyltransferase [Syntrophothermus lipocalidus DSM 12680]
 gi|297145910|gb|ADI02667.1| phosphoribosyltransferase [Syntrophothermus lipocalidus DSM 12680]
          Length = 239

 Score = 69.1 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 36/54 (66%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF+V     + + G  ILL+DDVYTTG+TAK  A  L  AGA  VS++T++
Sbjct: 183 LKGAFDVRD--CEKIRGKNILLVDDVYTTGSTAKECATVLLDAGANRVSVITWA 234


>gi|30250228|ref|NP_842298.1| hypothetical protein NE2301 [Nitrosomonas europaea ATCC 19718]
 gi|30181023|emb|CAD86213.1| conserved hypothetical protein [Nitrosomonas europaea ATCC 19718]
          Length = 258

 Score = 69.1 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +RNAF   +    + +G ++ ++DDV T+GAT    A  +++ GA  V     +R+  
Sbjct: 182 VRNAFTCNR----NFSGKRVAIVDDVMTSGATLNELAKVIRRHGATDVRAWVIARAFP 235


>gi|238896880|ref|YP_002921625.1| putative periplasmic gluconate-binding protein in GNT I transport
           system [Klebsiella pneumoniae NTUH-K2044]
 gi|238549207|dbj|BAH65558.1| putative periplasmic gluconate-binding protein in GNT I transport
           system [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
          Length = 224

 Score = 69.1 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL I L+DDV TTG+T    +  L + GA TV +    R+L
Sbjct: 172 LKNAFQL----EFAVQGLHIALVDDVVTTGSTVAEISRLLLRNGAATVQVWCLCRTL 224


>gi|206579882|ref|YP_002236214.1| protein GntX [Klebsiella pneumoniae 342]
 gi|206568940|gb|ACI10716.1| protein GntX [Klebsiella pneumoniae 342]
          Length = 224

 Score = 69.1 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL I ++DDV TTG+T    +  L + GA TV +    R+L
Sbjct: 172 LKNAFQL----EFAVQGLHIAIVDDVVTTGSTVAEISRLLLRNGAATVQVWCLCRTL 224


>gi|332703113|ref|ZP_08423201.1| phosphoribosyltransferase [Desulfovibrio africanus str. Walvis Bay]
 gi|332553262|gb|EGJ50306.1| phosphoribosyltransferase [Desulfovibrio africanus str. Walvis Bay]
          Length = 280

 Score = 69.1 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 3/54 (5%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
            AF         V G ++LL+DD+ TTGAT +  A+ LK AGA  V +L  +R+
Sbjct: 230 GAFR---ADEAQVEGRRVLLVDDIMTTGATIEQCALVLKAAGASVVDVLVLARA 280


>gi|330838209|ref|YP_004412789.1| phosphoribosyltransferase [Selenomonas sputigena ATCC 35185]
 gi|329745973|gb|AEB99329.1| phosphoribosyltransferase [Selenomonas sputigena ATCC 35185]
          Length = 229

 Score = 68.7 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 33/57 (57%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSK---HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +R AF++ +        +AG  I+L+DD+ TTGAT    A  LKKAGA +V  L  +
Sbjct: 169 VRGAFSLSEAGKGGAGEIAGKSIVLLDDILTTGATLTSCAAVLKKAGAGSVYALALA 225


>gi|262045249|ref|ZP_06018275.1| GNTI system gluconate periplasmic binding protein with
           phosphoribosyltransferase domain [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
 gi|259037459|gb|EEW38704.1| GNTI system gluconate periplasmic binding protein with
           phosphoribosyltransferase domain [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
          Length = 212

 Score = 68.7 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL I L+DDV TTG+T    +  L + GA TV +    R+L
Sbjct: 160 LKNAFQL----EFAVQGLHIALVDDVVTTGSTVAEISRLLLRNGAATVQVWCLCRTL 212


>gi|254464782|ref|ZP_05078193.1| competence protein F [Rhodobacterales bacterium Y4I]
 gi|206685690|gb|EDZ46172.1| competence protein F [Rhodobacterales bacterium Y4I]
          Length = 242

 Score = 68.7 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 25/54 (46%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           A +        + G  +L++DDV T+GAT      A  +AGA  V +   +R  
Sbjct: 187 AISAHPGRLNRIRGRSVLIVDDVMTSGATLSACTDACLRAGASEVRVAVLARVT 240


>gi|124268368|ref|YP_001022372.1| putative phosphoribosyl transferase [Methylibium petroleiphilum
           PM1]
 gi|124261143|gb|ABM96137.1| putative phosphoribosyl transferase [Methylibium petroleiphilum
           PM1]
          Length = 230

 Score = 68.7 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 27/56 (48%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF V       +    + L DDV TTGATA      L  AGA +V +   +R+
Sbjct: 173 LRGAFAVEPLALAALRDRHVALADDVMTTGATAAELTRVLYAAGAASVQVWVVART 228


>gi|311031944|ref|ZP_07710034.1| late competence protein [Bacillus sp. m3-13]
          Length = 237

 Score = 68.7 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/55 (50%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
            N F VP    + V G  ILLIDD+YTTG T + AA  LK AGA  +S  T  RS
Sbjct: 185 ENTFYVPN--PEQVKGKNILLIDDIYTTGTTVRMAAKVLKDAGAKEISSFTLVRS 237


>gi|302391038|ref|YP_003826858.1| phosphoribosyltransferase [Acetohalobium arabaticum DSM 5501]
 gi|302203115|gb|ADL11793.1| phosphoribosyltransferase [Acetohalobium arabaticum DSM 5501]
          Length = 238

 Score = 68.7 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 30/54 (55%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           + N F         V   +ILLIDD+YTTGAT    A  L +AGA +VS LT +
Sbjct: 177 VSNIFYCEPDKLGVVEDKEILLIDDIYTTGATVNECAKVLLRAGAESVSALTLA 230


>gi|330012477|ref|ZP_08307391.1| comF family protein [Klebsiella sp. MS 92-3]
 gi|328533828|gb|EGF60507.1| comF family protein [Klebsiella sp. MS 92-3]
          Length = 212

 Score = 68.7 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL I L+DDV TTG+T    +  L + GA TV +    R+L
Sbjct: 160 LKNAFQL----EFAVQGLHIALVDDVVTTGSTVAEISRLLLRNGAATVQVWCLCRTL 212


>gi|255527645|ref|ZP_05394505.1| hypoxanthine phosphoribosyltransferase [Clostridium carboxidivorans
           P7]
 gi|296186910|ref|ZP_06855311.1| hypoxanthine phosphoribosyltransferase [Clostridium carboxidivorans
           P7]
 gi|255508658|gb|EET85038.1| hypoxanthine phosphoribosyltransferase [Clostridium carboxidivorans
           P7]
 gi|296048624|gb|EFG88057.1| hypoxanthine phosphoribosyltransferase [Clostridium carboxidivorans
           P7]
          Length = 181

 Score = 68.7 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 10/51 (19%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   + G  +L+++D+  +G T       LK  GA ++ I   
Sbjct: 80  GVVRILKDLDFEIEGKHVLIVEDIIDSGTTLSYLIEYLKGRGAESIEIACL 130


>gi|148284486|ref|YP_001248576.1| competence protein F [Orientia tsutsugamushi str. Boryong]
 gi|146739925|emb|CAM79923.1| competence protein F [Orientia tsutsugamushi str. Boryong]
          Length = 249

 Score = 68.7 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  +F +    S+ +   KI+L+DDV TTG T    A  LK AGA +V +L  + +
Sbjct: 196 ISGSFKINN--SEIIKNKKIILLDDVVTTGTTVNLCAKLLKNAGAKSVFVLCIAYT 249


>gi|224368951|ref|YP_002603115.1| ComF [Desulfobacterium autotrophicum HRM2]
 gi|223691668|gb|ACN14951.1| ComF [Desulfobacterium autotrophicum HRM2]
          Length = 291

 Score = 68.7 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 38/56 (67%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF V       + G +ILLIDDV+TTGAT+  AA+ L KAGA++V +L  +R+
Sbjct: 238 LRGAFTVRGTEK--IEGRRILLIDDVFTTGATSGEAALTLFKAGALSVDLLVLARA 291


>gi|325981843|ref|YP_004294245.1| phosphoribosyltransferase [Nitrosomonas sp. AL212]
 gi|325531362|gb|ADZ26083.1| phosphoribosyltransferase [Nitrosomonas sp. AL212]
          Length = 228

 Score = 68.7 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 4/59 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R+AF      +  ++G  + L+DDV TTGAT    A  L+K G + +S    +R+L +
Sbjct: 165 IRSAF----DCTIDLSGKHVALVDDVMTTGATLNEVAKTLRKRGVIEISNWIIARALSE 219


>gi|288550254|ref|ZP_05969771.2| competence protein F [Enterobacter cancerogenus ATCC 35316]
 gi|288315815|gb|EFC54753.1| competence protein F [Enterobacter cancerogenus ATCC 35316]
          Length = 163

 Score = 68.4 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL I L+DDV TTG+T    +  L ++GA +V +    R+L
Sbjct: 111 LKNAFRL----ELPVNGLHIALVDDVVTTGSTVAELSRLLLQSGAASVQVWCLCRTL 163


>gi|114570814|ref|YP_757494.1| phosphoribosyltransferase [Maricaulis maris MCS10]
 gi|114341276|gb|ABI66556.1| phosphoribosyltransferase [Maricaulis maris MCS10]
          Length = 255

 Score = 68.4 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 24/59 (40%), Positives = 35/59 (59%), Gaps = 2/59 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF VP      VAG  ++L+DDV TTGAT    A  LK+AGA +V ++   R +++
Sbjct: 194 VAAAFTVPD--RNAVAGKHLVLVDDVITTGATVSACAYQLKRAGAASVRVVALCRVVRE 250


>gi|330994801|ref|ZP_08318723.1| Protein gntX [Gluconacetobacter sp. SXCC-1]
 gi|329758062|gb|EGG74584.1| Protein gntX [Gluconacetobacter sp. SXCC-1]
          Length = 236

 Score = 68.4 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 29/56 (51%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           M  A  V  +    + G  ++++DDV TTGAT      AL  AGA  V +L  +R+
Sbjct: 174 MHGAVGVRAHRQAAIQGRHMIVVDDVMTTGATLAACTRALLAAGAGRVDVLAAARA 229


>gi|152972291|ref|YP_001337437.1| putative periplasmic gluconate-binding protein in GNT I transport
           system [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|150957140|gb|ABR79170.1| putative periplasmic gluconate-binding protein in GNT I transport
           system [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
          Length = 212

 Score = 68.4 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL I L+DDV TTG+T    +  L + GA TV +    R+L
Sbjct: 160 LKNAFQL----EFAVQGLHIALVDDVVTTGSTVAEISRLLLRNGAATVQVWCLCRTL 212


>gi|189502636|ref|YP_001958353.1| hypothetical protein Aasi_1314 [Candidatus Amoebophilus asiaticus
           5a2]
 gi|189498077|gb|ACE06624.1| hypothetical protein Aasi_1314 [Candidatus Amoebophilus asiaticus
           5a2]
          Length = 226

 Score = 68.4 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           +R+AF V       + G  +LL+DD+ TTGAT +  A+ L  AGA  VSI   
Sbjct: 172 LRDAFYVVNT--SLIQGKHVLLVDDIITTGATLEACALPLLAAGAKEVSIAAI 222


>gi|119899106|ref|YP_934319.1| putative competence protein F [Azoarcus sp. BH72]
 gi|119671519|emb|CAL95432.1| putative competence protein F [Azoarcus sp. BH72]
          Length = 230

 Score = 68.4 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF      +  + G ++L++DDV TTGAT   AA  LK+ GA  V  L  +R+  
Sbjct: 175 VRGAF----DSATDLRGRRVLVLDDVMTTGATLGEAARILKRRGAERVDNLVIARTPP 228


>gi|119946807|ref|YP_944487.1| amidophosphoribosyltransferase [Psychromonas ingrahamii 37]
 gi|119865411|gb|ABM04888.1| amidophosphoribosyltransferase [Psychromonas ingrahamii 37]
          Length = 226

 Score = 68.4 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 31/56 (55%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  AF++   + + + G  I++IDDV TTGAT       L +AGA  + I   SR+
Sbjct: 164 LNGAFSICPSMQQEIIGAYIVIIDDVVTTGATVNSLCHTLLEAGAQRIDIWCISRT 219


>gi|156936424|ref|YP_001440340.1| hypothetical protein ESA_04325 [Cronobacter sakazakii ATCC BAA-894]
 gi|156534678|gb|ABU79504.1| hypothetical protein ESA_04325 [Cronobacter sakazakii ATCC BAA-894]
          Length = 186

 Score = 68.4 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 25/57 (43%), Positives = 34/57 (59%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF V       VAGL I+++DDV TTG+T    A  LK+ GA TV +    R+L
Sbjct: 134 LKNAFRV----ELPVAGLHIVIVDDVVTTGSTVAQIARLLKRNGAATVQVWCLCRTL 186


>gi|150388558|ref|YP_001318607.1| phosphoribosyltransferase [Alkaliphilus metalliredigens QYMF]
 gi|149948420|gb|ABR46948.1| phosphoribosyltransferase [Alkaliphilus metalliredigens QYMF]
          Length = 242

 Score = 68.4 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++ AF V       +   K+LLIDD+ TTGAT K  +  L +AGA +V+ LT +R
Sbjct: 185 VKQAFMVKN--PGLIVNQKLLLIDDIVTTGATLKACSRVLLEAGAQSVTALTLAR 237


>gi|300718786|ref|YP_003743589.1| gluconate periplasmic binding protein [Erwinia billingiae Eb661]
 gi|299064622|emb|CAX61742.1| Gluconate periplasmic binding protein [Erwinia billingiae Eb661]
          Length = 231

 Score = 68.4 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF V       V GL I L DDV TTG+T    +  L  AGA +V + +  R+L
Sbjct: 179 LRGAFRV----EIAVKGLHIALTDDVVTTGSTVGEISRILLAAGAASVQVWSLCRTL 231


>gi|58699163|ref|ZP_00373983.1| putative amidophosphoribosyltransferase [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|58534319|gb|EAL58498.1| putative amidophosphoribosyltransferase [Wolbachia endosymbiont of
           Drosophila ananassae]
          Length = 194

 Score = 68.4 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ AF       K +    ++L+DDV TTGAT +  +  +  +GA  V +L+ +R++ D
Sbjct: 131 LKKAFK--TSNKKIIENKIVILVDDVVTTGATVRSCSQEILNSGAKEVRVLSLARTVND 187


>gi|332971725|gb|EGK10673.1| putative competence protein F [Desmospora sp. 8437]
          Length = 157

 Score = 68.4 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 30/55 (54%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +  AF +    +      K L++DDVYTTG+T    A  LK AGA  V  LT++R
Sbjct: 103 LSGAFRLNPRSAGTAMDKKWLVVDDVYTTGSTLAECAKTLKAAGAKQVCSLTWAR 157


>gi|325690461|gb|EGD32464.1| hypothetical protein HMPREF9382_0397 [Streptococcus sanguinis
           SK115]
          Length = 410

 Score = 68.4 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 31/54 (57%), Gaps = 4/54 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           + N F V +     + G  IL+IDDV TTGAT K  A AL +AGA  VS   F+
Sbjct: 301 VENVFTVTK----DLTGKNILVIDDVVTTGATLKACAEALFQAGAENVSFFVFA 350


>gi|160932697|ref|ZP_02080086.1| hypothetical protein CLOLEP_01538 [Clostridium leptum DSM 753]
 gi|156867771|gb|EDO61143.1| hypothetical protein CLOLEP_01538 [Clostridium leptum DSM 753]
          Length = 227

 Score = 68.4 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++  + + +     V G  +LL DD+ T+GAT   A   L + GA  V  ++  R+ K
Sbjct: 167 VKGVYRLKR--KIDVRGKTVLLCDDIVTSGATMWEAGRVLLQHGAKAVYGVSLCRAKK 222


>gi|304317615|ref|YP_003852760.1| phosphoribosyltransferase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302779117|gb|ADL69676.1| phosphoribosyltransferase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 229

 Score = 68.4 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF V       V    ILL+DDV TTG+T    A  LK+ GA  V   T +
Sbjct: 173 LKGAFKVV--YEDMVKNKIILLVDDVLTTGSTLDECAKVLKEGGAKDVFATTIA 224


>gi|149912918|ref|ZP_01901452.1| competence protein F, putative [Roseobacter sp. AzwK-3b]
 gi|149813324|gb|EDM73150.1| competence protein F, putative [Roseobacter sp. AzwK-3b]
          Length = 190

 Score = 68.4 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 26/57 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
             F      + H+ G  ILL+DDV T+GAT           GA  V +L  +R  KD
Sbjct: 133 GVFRAHPGRAHHLKGRTILLVDDVMTSGATLSALTQICLAGGATDVRVLVLARVSKD 189


>gi|323698874|ref|ZP_08110786.1| phosphoribosyltransferase [Desulfovibrio sp. ND132]
 gi|323458806|gb|EGB14671.1| phosphoribosyltransferase [Desulfovibrio desulfuricans ND132]
          Length = 246

 Score = 68.4 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 34/59 (57%), Gaps = 3/59 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ AF     +   V G ++LL+DDVYTTG+T    A  L +AG   + +L  +R+ ++
Sbjct: 186 IKGAFAADPAL---VRGRRLLLVDDVYTTGSTLNECARTLLRAGCTGLDVLVLARTQRE 241


>gi|253995944|ref|YP_003048008.1| hypothetical protein Mmol_0571 [Methylotenera mobilis JLW8]
 gi|253982623|gb|ACT47481.1| conserved hypothetical protein [Methylotenera mobilis JLW8]
          Length = 253

 Score = 68.4 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           MR AF    +    +  L I ++DDV TTG +    A  LK+AGA  V     +R+L 
Sbjct: 199 MRGAF----HCQPSLHNLNIAVVDDVMTTGTSLNELAKTLKQAGAARVECWVMARTLP 252


>gi|56694999|ref|YP_165345.1| competence protein F, putative [Ruegeria pomeroyi DSS-3]
 gi|56676736|gb|AAV93402.1| competence protein F, putative [Ruegeria pomeroyi DSS-3]
          Length = 242

 Score = 68.4 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 31/59 (52%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  A +V       +   K+LLIDDV T+GAT   +A A   AGA  V +L  +R  ++
Sbjct: 183 LSGAISVHPKRRHRLTARKLLLIDDVMTSGATLAASAQACLNAGADQVFVLVLARVTRE 241


>gi|89900468|ref|YP_522939.1| ComF family protein [Rhodoferax ferrireducens T118]
 gi|89345205|gb|ABD69408.1| ComF family protein [Rhodoferax ferrireducens T118]
          Length = 230

 Score = 68.0 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 36/56 (64%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +++AF V   +   + G +++L+DDV T+GA+  CAA  L+ AGA  ++ L  +R+
Sbjct: 174 LKDAFAVDPLLVAQLKGARVVLVDDVMTSGASLFCAARTLRAAGAAHITGLVIART 229


>gi|304438488|ref|ZP_07398428.1| competence protein F [Selenomonas sp. oral taxon 149 str. 67H29BP]
 gi|304368571|gb|EFM22256.1| competence protein F [Selenomonas sp. oral taxon 149 str. 67H29BP]
          Length = 220

 Score = 68.0 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +R+AF +       V G  +LL+DD+ TTGAT    A  L+  GA  V  +  +
Sbjct: 165 LRSAFALVHG--ADVQGKDLLLVDDIMTTGATLTECAHVLRHGGARRVYAIALA 216


>gi|226327548|ref|ZP_03803066.1| hypothetical protein PROPEN_01419 [Proteus penneri ATCC 35198]
 gi|225204074|gb|EEG86428.1| hypothetical protein PROPEN_01419 [Proteus penneri ATCC 35198]
          Length = 166

 Score = 68.0 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +   V   V+G  + LIDDV TTGAT K     L +AGA +V +    R+L
Sbjct: 112 LKNAFILNNTV--SVSGKNLALIDDVITTGATLKSIVPLLFRAGARSVEVWAICRTL 166


>gi|292669715|ref|ZP_06603141.1| competence protein F [Selenomonas noxia ATCC 43541]
 gi|292648512|gb|EFF66484.1| competence protein F [Selenomonas noxia ATCC 43541]
          Length = 131

 Score = 68.0 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           +R AF V + +   V+G  ILL+DD+ TTGAT    A  LK+AGA  V  +  
Sbjct: 76  LRGAFAVTEAM--DVSGQDILLLDDIMTTGATLTECARTLKRAGARNVYAVAL 126


>gi|226324394|ref|ZP_03799912.1| hypothetical protein COPCOM_02175 [Coprococcus comes ATCC 27758]
 gi|225206842|gb|EEG89196.1| hypothetical protein COPCOM_02175 [Coprococcus comes ATCC 27758]
          Length = 246

 Score = 68.0 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 27/53 (50%), Positives = 33/53 (62%), Gaps = 4/53 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           +R AF V +    +V G  I+LIDD+YTTG+T   AA  LKKAGA  V  LT 
Sbjct: 192 IRGAFAVQK----NVKGENIVLIDDIYTTGSTLDEAARVLKKAGAEKVYFLTV 240


>gi|322804439|emb|CBZ01989.1| comf operon protein C [Clostridium botulinum H04402 065]
          Length = 225

 Score = 68.0 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 25/56 (44%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + N+F V       +   K+LLIDDV TTGAT+   A  LKK GA  + ILT ++S
Sbjct: 170 VENSFKVYNEKC--IKNKKVLLIDDVLTTGATSFYCANELKKRGAKEIFILTAAKS 223


>gi|170754829|ref|YP_001779798.1| comF protein,-like protein [Clostridium botulinum B1 str. Okra]
 gi|169120041|gb|ACA43877.1| comF protein, homolog [Clostridium botulinum B1 str. Okra]
          Length = 225

 Score = 68.0 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 25/56 (44%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + N+F V       +   K+LLIDDV TTGAT+   A  LKK GA  + ILT ++S
Sbjct: 170 VENSFKVYNEKC--IKNKKVLLIDDVLTTGATSFYCANELKKRGAKEIFILTAAKS 223


>gi|153940823|ref|YP_001389534.1| comF protein,-like protein [Clostridium botulinum F str. Langeland]
 gi|152936719|gb|ABS42217.1| ComF protein homolog [Clostridium botulinum F str. Langeland]
 gi|295317632|gb|ADF98009.1| ComF protein-like protein [Clostridium botulinum F str. 230613]
          Length = 225

 Score = 68.0 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 25/56 (44%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + N+F V       +   K+LLIDDV TTGAT+   A  LKK GA  + ILT ++S
Sbjct: 170 VENSFKVYNEKC--IKNKKVLLIDDVLTTGATSFYCANELKKRGAKEIFILTAAKS 223


>gi|153932646|ref|YP_001382575.1| comF protein-like protein [Clostridium botulinum A str. ATCC 19397]
 gi|153937133|ref|YP_001386128.1| comF protein-like protein [Clostridium botulinum A str. Hall]
 gi|168177503|ref|ZP_02612167.1| comF protein homolog [Clostridium botulinum NCTC 2916]
 gi|226947393|ref|YP_002802484.1| comF protein, homolog [Clostridium botulinum A2 str. Kyoto]
 gi|152928690|gb|ABS34190.1| comF protein, homolog [Clostridium botulinum A str. ATCC 19397]
 gi|152933047|gb|ABS38546.1| comF protein, homolog [Clostridium botulinum A str. Hall]
 gi|182671613|gb|EDT83587.1| comF protein homolog [Clostridium botulinum NCTC 2916]
 gi|226842576|gb|ACO85242.1| comF protein, homolog [Clostridium botulinum A2 str. Kyoto]
          Length = 225

 Score = 68.0 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 25/56 (44%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + N+F V       +   K+LLIDDV TTGAT+   A  LKK GA  + ILT ++S
Sbjct: 170 VENSFKVYNEKC--IKNKKVLLIDDVLTTGATSFYCANELKKRGAKEIFILTAAKS 223


>gi|148378175|ref|YP_001252716.1| phosphoribosyl transferase [Clostridium botulinum A str. ATCC 3502]
 gi|148287659|emb|CAL81724.1| putative phosphoribosyl transferase [Clostridium botulinum A str.
           ATCC 3502]
          Length = 207

 Score = 68.0 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 25/56 (44%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + N+F V       +   K+LLIDDV TTGAT+   A  LKK GA  + ILT ++S
Sbjct: 152 VENSFKVYNEKC--IKNKKVLLIDDVLTTGATSFYCANELKKRGAKEIFILTAAKS 205


>gi|257465154|ref|ZP_05629525.1| competence protein F [Actinobacillus minor 202]
 gi|257450814|gb|EEV24857.1| competence protein F [Actinobacillus minor 202]
          Length = 229

 Score = 68.0 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 28/56 (50%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF             +I +IDDV TTG+T     + LKKAG   V + T +R+
Sbjct: 174 LKGAFRYQPQRQAGKFYQRIAIIDDVVTTGSTLNTICLELKKAGVKEVQVWTLARA 229


>gi|240949768|ref|ZP_04754100.1| competence protein F [Actinobacillus minor NM305]
 gi|240295800|gb|EER46487.1| competence protein F [Actinobacillus minor NM305]
          Length = 229

 Score = 68.0 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 28/56 (50%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF             +I +IDDV TTG+T     + LKKAG   V + T +R+
Sbjct: 174 LKGAFRYQPQRQAGKFYQRIAIIDDVVTTGSTLNTICLELKKAGVKEVQVWTLARA 229


>gi|260888482|ref|ZP_05899745.1| competence protein F [Selenomonas sputigena ATCC 35185]
 gi|260861679|gb|EEX76179.1| competence protein F [Selenomonas sputigena ATCC 35185]
          Length = 185

 Score = 68.0 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 33/57 (57%), Gaps = 3/57 (5%)

Query: 1   MRNAFNVPQYVSK---HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +R AF++ +        +AG  I+L+DD+ TTGAT    A  LKKAGA +V  L  +
Sbjct: 125 VRGAFSLSEAGKGGAGEIAGKSIVLLDDILTTGATLTSCAAVLKKAGAGSVYALALA 181


>gi|77920166|ref|YP_357981.1| amidophosphoribosyltransferase [Pelobacter carbinolicus DSM 2380]
 gi|77546249|gb|ABA89811.1| predicted amidophosphoribosyltransferase [Pelobacter carbinolicus
           DSM 2380]
          Length = 247

 Score = 68.0 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 35/56 (62%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF + Q     +AG ++LL+DDV TTGATA+  A  L   GA +V++   +R+
Sbjct: 190 LKGAFALTQ----KLAGQRVLLVDDVLTTGATARECAATLLAGGASSVAVAVLARA 241


>gi|126738463|ref|ZP_01754168.1| competence protein F, putative [Roseobacter sp. SK209-2-6]
 gi|126720262|gb|EBA16968.1| competence protein F, putative [Roseobacter sp. SK209-2-6]
          Length = 242

 Score = 68.0 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 25/58 (43%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +  A          + G  ++L+DDV T+GAT    A     AGA  V +   +R  +
Sbjct: 184 LSRAIVAHPRHQALMQGRVVVLVDDVMTSGATLTACADVCLAAGAAEVRVAVLARVTR 241


>gi|189184533|ref|YP_001938318.1| hypothetical protein OTT_1626 [Orientia tsutsugamushi str. Ikeda]
 gi|189181304|dbj|BAG41084.1| hypothetical protein OTT_1626 [Orientia tsutsugamushi str. Ikeda]
          Length = 248

 Score = 68.0 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  +F +    S+ +   KI+L+DDV TTG T       LK AGA +V +L  + +
Sbjct: 195 ISGSFRINN--SEIIKNKKIILLDDVVTTGTTVNLCTKLLKNAGAKSVFVLCIAYT 248


>gi|148260495|ref|YP_001234622.1| phosphoribosyltransferase [Acidiphilium cryptum JF-5]
 gi|146402176|gb|ABQ30703.1| phosphoribosyltransferase [Acidiphilium cryptum JF-5]
          Length = 217

 Score = 68.0 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 32/56 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ A  + +    H+AG  ILL+DDV TTGATA   A  L  AGA  V +L  +R 
Sbjct: 156 LKGAIGIREGREAHIAGRTILLVDDVLTTGATASACADTLYAAGAAAVDVLAIARV 211


>gi|303240176|ref|ZP_07326696.1| phosphoribosyltransferase [Acetivibrio cellulolyticus CD2]
 gi|302592267|gb|EFL61995.1| phosphoribosyltransferase [Acetivibrio cellulolyticus CD2]
          Length = 195

 Score = 68.0 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +++AF V       V G  IL++DD+ TTG T       LK AGA  ++    +
Sbjct: 139 VKDAFRVTN--VNAVDGKSILILDDILTTGTTLNECCKVLKNAGASKITAAVVA 190


>gi|188579651|ref|YP_001923096.1| competence protein F [Methylobacterium populi BJ001]
 gi|179343149|gb|ACB78561.1| competence protein F [Methylobacterium populi BJ001]
          Length = 255

 Score = 68.0 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 36/59 (61%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ AF V       +AG ++LLIDDV TTGAT   AA  L +AGA  V +LTF+   +D
Sbjct: 195 LQGAFRVADRARLRIAGRRLLLIDDVSTTGATGNAAARVLLRAGAAGVDLLTFATVARD 253


>gi|329888704|ref|ZP_08267302.1| phosphoribosyl transferase domain protein [Brevundimonas diminuta
           ATCC 11568]
 gi|328847260|gb|EGF96822.1| phosphoribosyl transferase domain protein [Brevundimonas diminuta
           ATCC 11568]
          Length = 268

 Score = 67.6 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 35/56 (62%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF V +   + + G ++LLIDDV TTGATA+  A AL +AGA  V +   +R 
Sbjct: 205 VKAAFAVTEVGRRRIKGRRLLLIDDVLTTGATAEACARALIEAGARAVDLAVIARV 260


>gi|227528912|ref|ZP_03958961.1| hypoxanthine phosphoribosyltransferase [Lactobacillus vaginalis
           ATCC 49540]
 gi|227351186|gb|EEJ41477.1| hypoxanthine phosphoribosyltransferase [Lactobacillus vaginalis
           ATCC 49540]
          Length = 180

 Score = 67.6 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 16/51 (31%), Positives = 25/51 (49%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + Q +   V G  IL+++D+  TG T K     LK+ GA +V + T 
Sbjct: 77  GKVKLVQDLKSDVRGRSILIMEDIVDTGHTLKYLIDLLKERGAKSVKVCTL 127


>gi|218507724|ref|ZP_03505602.1| competence protein F (phosphoribosyltransferase protein)
          [Rhizobium etli Brasil 5]
          Length = 61

 Score = 67.6 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 41/59 (69%)

Query: 1  MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
          +R AF + +   K + G +I+LIDDVY TGAT   A+  L+KAGA  +++LTF+R+L +
Sbjct: 1  VRGAFAIAKGREKDIFGRRIVLIDDVYRTGATVAAASRTLRKAGAAEITVLTFARALSE 59


>gi|170723998|ref|YP_001751686.1| competence protein ComF [Pseudomonas putida W619]
 gi|169762001|gb|ACA75317.1| competence protein ComF [Pseudomonas putida W619]
          Length = 245

 Score = 67.6 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++ AF V       + GL + ++DDV TTGATA+  A  L+ AGA  V +   +R+ K
Sbjct: 186 LQQAFAVVD--EGALHGLHVAVVDDVLTTGATAQSIAALLRGAGARRVDVYCLARTAK 241


>gi|56475996|ref|YP_157585.1| hypothetical protein ebA1065 [Aromatoleum aromaticum EbN1]
 gi|56312039|emb|CAI06684.1| conserved hypothetical protein,predicted phosphoribosyltransferase
           family [Aromatoleum aromaticum EbN1]
          Length = 236

 Score = 67.6 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 28/58 (48%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           MR AF          AG  ++++DDV TTGAT    A  LK  GA  V  L  +R+  
Sbjct: 181 MRGAFR----CEASFAGRTVIVVDDVMTTGATLDELARTLKMHGAARVENLVVARTPS 234


>gi|319795688|ref|YP_004157328.1| phosphoribosyltransferase [Variovorax paradoxus EPS]
 gi|315598151|gb|ADU39217.1| phosphoribosyltransferase [Variovorax paradoxus EPS]
          Length = 238

 Score = 67.6 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 34/56 (60%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF V    +  +   +I+L+DDV T+GA+   AA  L+ AGA+ ++ +  +R+
Sbjct: 179 LRGAFAVEPLRADRLREKRIVLVDDVMTSGASLFAAAGVLRMAGAVHITAVVLART 234


>gi|320539834|ref|ZP_08039493.1| putative gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system [Serratia
           symbiotica str. Tucson]
 gi|320030020|gb|EFW12040.1| putative gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system [Serratia
           symbiotica str. Tucson]
          Length = 239

 Score = 67.6 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +RNAF       + VAG  I L+DDV TTG+T    A  L + GA+++ I    R+L
Sbjct: 187 LRNAF----DCDEQVAGRHIALLDDVVTTGSTVAEIATLLHRQGAVSLQIWCICRTL 239


>gi|308273050|emb|CBX29654.1| hypothetical protein N47_J06350 [uncultured Desulfobacterium sp.]
          Length = 276

 Score = 67.6 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 26/57 (45%), Positives = 37/57 (64%), Gaps = 2/57 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF V ++    V   +ILLIDDVYTTGATA   A AL +AG  +V +LT + ++
Sbjct: 222 IKGAFTVNKHCK--VKKTRILLIDDVYTTGATADECAKALFEAGVQSVDVLTIAGAI 276


>gi|187777240|ref|ZP_02993713.1| hypothetical protein CLOSPO_00787 [Clostridium sporogenes ATCC
           15579]
 gi|187774168|gb|EDU37970.1| hypothetical protein CLOSPO_00787 [Clostridium sporogenes ATCC
           15579]
          Length = 225

 Score = 67.6 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 25/56 (44%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++++F V       V   +ILLIDDV TTGAT+   A  LKK+GA  + ILT ++S
Sbjct: 170 VKDSFKVYNERY--VENKRILLIDDVLTTGATSFYCANELKKSGAKEIFILTAAKS 223


>gi|254520269|ref|ZP_05132325.1| ComF protein [Clostridium sp. 7_2_43FAA]
 gi|226914018|gb|EEH99219.1| ComF protein [Clostridium sp. 7_2_43FAA]
          Length = 214

 Score = 67.2 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  AF +     K++    I+LIDDV TTGAT       LKK+GA ++ ILT ++S
Sbjct: 159 IEGAFGIKSN--KNIKDKNIILIDDVITTGATLLECEKLLKKSGANSIKILTVAKS 212


>gi|74316335|ref|YP_314075.1| hypothetical protein Tbd_0317 [Thiobacillus denitrificans ATCC
           25259]
 gi|74055830|gb|AAZ96270.1| conserved hypothetical protein [Thiobacillus denitrificans ATCC
           25259]
          Length = 230

 Score = 67.2 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF      S  + G+ + +IDDV TTG +    A  LK+AGA  VS    +R+L 
Sbjct: 174 LRGAFA----CSTDLGGMHVAVIDDVMTTGTSLNELAATLKRAGAREVSCWVAARTLP 227


>gi|149184493|ref|ZP_01862811.1| amidophosphoribosyltransferase [Erythrobacter sp. SD-21]
 gi|148831813|gb|EDL50246.1| amidophosphoribosyltransferase [Erythrobacter sp. SD-21]
          Length = 262

 Score = 67.2 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  A  V +   + +AG  +LL+DDV T+GAT+     ALK+AGA TV+I  F+R L +
Sbjct: 200 LAGAIEVSR--PERIAGRNVLLVDDVLTSGATSTACVRALKRAGARTVTISCFARVLDE 256


>gi|290473230|ref|YP_003466095.1| putative periplasmic gluconate-binding protein in GNT I transport
           system [Xenorhabdus bovienii SS-2004]
 gi|289172528|emb|CBJ79295.1| putative periplasmic gluconate-binding protein in GNT I transport
           system [Xenorhabdus bovienii SS-2004]
          Length = 227

 Score = 67.2 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +++AF +            + + DDV TTG T   A+  L +AGA +V      R+L
Sbjct: 175 LKHAFQL----RGDFTDQNVAIFDDVITTGTTLHEASQLLIRAGAHSVQAWAICRTL 227


>gi|167644905|ref|YP_001682568.1| phosphoribosyltransferase [Caulobacter sp. K31]
 gi|167347335|gb|ABZ70070.1| phosphoribosyltransferase [Caulobacter sp. K31]
          Length = 215

 Score = 67.2 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 27/57 (47%), Positives = 34/57 (59%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +  AF VP+     V G K+LLIDDV TTGATA+  A AL  AGA  V++   +R  
Sbjct: 152 VAAAFAVPEARRHRVTGRKVLLIDDVLTTGATAEGCARALLAAGATQVTLAVVARVT 208


>gi|91203265|emb|CAJ72904.1| similar to competence protein F [Candidatus Kuenenia
           stuttgartiensis]
          Length = 249

 Score = 67.2 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF +       + G ++LL+DDV TTG T +  A  LKK GA ++ +  F+
Sbjct: 192 VQKAFFIKNPAI--MKGKRVLLVDDVLTTGLTMRECAKKLKKTGAKSIHLFVFA 243


>gi|284008806|emb|CBA75561.1| gluconate metabolism protein [Arsenophonus nasoniae]
          Length = 227

 Score = 67.2 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 26/57 (45%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           + NAF + +          I ++DDV TTG T    A  L  AGA +V      R+L
Sbjct: 175 LSNAFRIKKT----FQDCHIAVLDDVITTGTTMNEVAKLLISAGANSVQAWAICRTL 227


>gi|168699233|ref|ZP_02731510.1| phosphoribosyltransferase [Gemmata obscuriglobus UQM 2246]
          Length = 244

 Score = 67.2 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           MR+ F V       VAG  +LL+DDV TTG+TA  AA AL+ AGA  V +   +R
Sbjct: 191 MRDVFRVRSSAR--VAGKAVLLVDDVMTTGSTASVAAKALRDAGAERVVVAVLAR 243


>gi|294789652|ref|ZP_06754886.1| ComF/gntX family protein [Simonsiella muelleri ATCC 29453]
 gi|294482453|gb|EFG30146.1| ComF/gntX family protein [Simonsiella muelleri ATCC 29453]
          Length = 211

 Score = 67.2 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           + ++F +       V GL IL+IDD+ TTGAT      +LK AGA  + I   +R
Sbjct: 160 IHDSFQI----KYDVRGLNILIIDDILTTGATLTELTRSLKNAGANHIYIWVVAR 210


>gi|291326979|ref|ZP_06574150.1| competence protein F [Providencia rettgeri DSM 1131]
 gi|291312103|gb|EFE52556.1| competence protein F [Providencia rettgeri DSM 1131]
          Length = 152

 Score = 67.2 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF +       V+ L + +IDDV TTG+T   AA  L  AGA TV   +  R+L
Sbjct: 100 LKGAFTLN----DSVSNLHVAVIDDVITTGSTMNAAAQLLICAGARTVDAWSLCRTL 152


>gi|170760534|ref|YP_001785499.1| comF protein,-like protein [Clostridium botulinum A3 str. Loch
           Maree]
 gi|169407523|gb|ACA55934.1| comF protein, homolog [Clostridium botulinum A3 str. Loch Maree]
          Length = 225

 Score = 67.2 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + ++F V       +   K+LLIDDV TTGAT+   A  LKK GA  + ILT ++S
Sbjct: 170 VEDSFKVYNEKC--IKNKKVLLIDDVLTTGATSFYCANELKKRGAKEIFILTAAKS 223


>gi|146296670|ref|YP_001180441.1| phosphoribosyltransferase [Caldicellulosiruptor saccharolyticus DSM
           8903]
 gi|145410246|gb|ABP67250.1| phosphoribosyltransferase [Caldicellulosiruptor saccharolyticus DSM
           8903]
          Length = 232

 Score = 66.8 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 29/54 (53%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++N     +     V G  +LL+DD++TTGATA   +  L K+GA  V +   +
Sbjct: 172 IKNRIAFKKGYENIVKGKTVLLVDDIFTTGATADECSKVLLKSGANKVYVSVLA 225


>gi|192361736|ref|YP_001980949.1| competence protein ComF [Cellvibrio japonicus Ueda107]
 gi|190687901|gb|ACE85579.1| competence protein ComF [Cellvibrio japonicus Ueda107]
          Length = 252

 Score = 66.8 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 30/56 (53%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF         + G  + L+DDV TT ATA+C +  L +AGA  V I   +R+
Sbjct: 188 LRRAFAQEPKRCPAIQGKHLALVDDVVTTSATARCLSELLVRAGAARVDIWALART 243


>gi|163789843|ref|ZP_02184279.1| competence protein F [Carnobacterium sp. AT7]
 gi|159874783|gb|EDP68851.1| competence protein F [Carnobacterium sp. AT7]
          Length = 228

 Score = 66.8 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 30/51 (58%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           F V +   +++ G  I+L+DD+YTTG T   AA  L + GA ++   + SR
Sbjct: 178 FKVAEIFQENIKGKSIILVDDIYTTGRTFFHAADCLFENGAKSIETFSISR 228


>gi|313896725|ref|ZP_07830273.1| comF family protein [Selenomonas sp. oral taxon 137 str. F0430]
 gi|312974642|gb|EFR40109.1| comF family protein [Selenomonas sp. oral taxon 137 str. F0430]
          Length = 216

 Score = 66.8 bits (163), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
            AF         +AG  ILL+DD+ TTG T    A  LK+AGA  +  L  +
Sbjct: 163 GAFVCANG--AQIAGRHILLLDDIMTTGTTLLECARTLKRAGAENIYALVLA 212


>gi|28377597|ref|NP_784489.1| late competence protein [Lactobacillus plantarum WCFS1]
 gi|254555776|ref|YP_003062193.1| late competence protein [Lactobacillus plantarum JDM1]
 gi|308179751|ref|YP_003923879.1| late competence protein [Lactobacillus plantarum subsp. plantarum
           ST-III]
 gi|28270430|emb|CAD63332.1| late competence protein [Lactobacillus plantarum WCFS1]
 gi|254044703|gb|ACT61496.1| late competence protein [Lactobacillus plantarum JDM1]
 gi|308045242|gb|ADN97785.1| late competence protein [Lactobacillus plantarum subsp. plantarum
           ST-III]
          Length = 224

 Score = 66.8 bits (163), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 20/41 (48%), Positives = 30/41 (73%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +AG ++LL+DD+YTTG T + AA  L + GA +V+ LT +R
Sbjct: 184 LAGRRVLLVDDIYTTGRTMRHAATLLLENGAKSVTGLTLAR 224


>gi|77464774|ref|YP_354278.1| competence protein F [Rhodobacter sphaeroides 2.4.1]
 gi|77389192|gb|ABA80377.1| Competence protein F [Rhodobacter sphaeroides 2.4.1]
          Length = 240

 Score = 66.8 bits (163), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 31/59 (52%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           M  A        + + G  +L++DDV T+GAT   A  A + AGA +VS+   +R  KD
Sbjct: 181 MTGAILPHPRRGRLLKGRPVLILDDVMTSGATLATATEACQAAGATSVSVAVLARVAKD 239


>gi|330505323|ref|YP_004382192.1| amidophosphoribosyltransferase-like protein [Pseudomonas mendocina
           NK-01]
 gi|328919609|gb|AEB60440.1| amidophosphoribosyltransferase-like protein [Pseudomonas mendocina
           NK-01]
          Length = 192

 Score = 66.8 bits (163), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF++   V   +AG  + LIDDV TTGATA   A  L++AGA+ V +   +R+ +
Sbjct: 133 LRQAFSLQ--VQAAIAGAHLALIDDVLTTGATADMLAQLLRRAGALRVDVYCLARTPR 188


>gi|189425986|ref|YP_001953163.1| competence protein F [Geobacter lovleyi SZ]
 gi|189422245|gb|ACD96643.1| competence protein F, putative [Geobacter lovleyi SZ]
          Length = 243

 Score = 66.8 bits (163), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF V       V    ++L+DDV+TTG+T    A+ L++AG  TVS +T + +
Sbjct: 189 LRGAFAVT--TPDSVNNRHVMLVDDVFTTGSTLAECALVLQRAGCHTVSAVTVAHA 242


>gi|114762234|ref|ZP_01441702.1| Competence protein F [Pelagibaca bermudensis HTCC2601]
 gi|114545258|gb|EAU48261.1| Competence protein F [Roseovarius sp. HTCC2601]
          Length = 241

 Score = 66.8 bits (163), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 31/59 (52%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           + +A ++       +    +LL+DDV T+GAT   A  A   AGA  V + T +R +KD
Sbjct: 182 LSDAISLDPKRGGLMRDRPLLLVDDVMTSGATLSAATEACLAAGAGDVCVCTLARVVKD 240


>gi|295097022|emb|CBK86112.1| Predicted amidophosphoribosyltransferases [Enterobacter cloacae
           subsp. cloacae NCTC 9394]
          Length = 210

 Score = 66.8 bits (163), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 4/56 (7%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +NAF +       V GL I ++DDV TTG+T    +  L ++GA +V +    R+L
Sbjct: 159 KNAFRL----ELPVNGLHIAIVDDVVTTGSTVAELSRLLLQSGAASVQVWCLCRTL 210


>gi|238788980|ref|ZP_04632770.1| Predicted amidophosphoribosyltransferase [Yersinia frederiksenii
           ATCC 33641]
 gi|238723007|gb|EEQ14657.1| Predicted amidophosphoribosyltransferase [Yersinia frederiksenii
           ATCC 33641]
          Length = 281

 Score = 66.8 bits (163), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           MR AF       + V G  I L+DDV TTG+T    A  L   G  ++ +    R+L
Sbjct: 229 MRGAFR----CRETVRGQHIALLDDVVTTGSTLNEIAKLLWGQGIASLQVWCLCRTL 281


>gi|134300215|ref|YP_001113711.1| hypoxanthine phosphoribosyltransferase [Desulfotomaculum reducens
           MI-1]
 gi|134052915|gb|ABO50886.1| hypoxanthine phosphoribosyltransferase [Desulfotomaculum reducens
           MI-1]
          Length = 179

 Score = 66.8 bits (163), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + + K + G  I++++D+  TG T +     +K  G  +V + T 
Sbjct: 77  GVVRILKDLDKSIEGKHIIIVEDIVDTGLTLQYMVENIKSRGPASVKVCTL 127


>gi|319650648|ref|ZP_08004788.1| hypothetical protein HMPREF1013_01393 [Bacillus sp. 2_A_57_CT2]
 gi|317397829|gb|EFV78527.1| hypothetical protein HMPREF1013_01393 [Bacillus sp. 2_A_57_CT2]
          Length = 110

 Score = 66.8 bits (163), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 32/50 (64%)

Query: 6   NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
            V Q ++ H+   KI+LIDD+YTTG+T   AA  LK  GA +V  LT +R
Sbjct: 60  QVFQPLNLHIENKKIILIDDIYTTGSTLYHAAKVLKAGGAASVCSLTLAR 109


>gi|288575565|ref|ZP_05977205.2| ComF/gntX family protein [Neisseria mucosa ATCC 25996]
 gi|288567578|gb|EFC89138.1| ComF/gntX family protein [Neisseria mucosa ATCC 25996]
          Length = 250

 Score = 66.8 bits (163), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 3/55 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++NAF +  ++S       ILLIDDV+TTG+T    A  LKK+GA  +   + +R
Sbjct: 194 IKNAFEINGHIS---KNCNILLIDDVFTTGSTLDELARTLKKSGAGKIFCWSLAR 245


>gi|73540017|ref|YP_294537.1| putative amidophosphoribosyltransferase [Ralstonia eutropha JMP134]
 gi|72117430|gb|AAZ59693.1| putative amidophosphoribosyltransferases [Ralstonia eutropha
           JMP134]
          Length = 222

 Score = 66.8 bits (163), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF + +     +AG+ + L+DDV TTGAT   AA  LK  GA  VS++   R+
Sbjct: 168 VRGAFRISRSRP--LAGMHVGLVDDVMTTGATLDEAARTLKAHGAARVSVIVALRT 221


>gi|326796484|ref|YP_004314304.1| phosphoribosyltransferase [Marinomonas mediterranea MMB-1]
 gi|326547248|gb|ADZ92468.1| phosphoribosyltransferase [Marinomonas mediterranea MMB-1]
          Length = 243

 Score = 66.8 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 17/40 (42%), Positives = 24/40 (60%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            ++LIDDV TTGAT +     L KAGA +V +   +R+  
Sbjct: 202 HVVLIDDVMTTGATLEACTKTLLKAGASSVDVWVIARTPP 241


>gi|90408320|ref|ZP_01216484.1| competence protein ComF, putative [Psychromonas sp. CNPT3]
 gi|90310551|gb|EAS38672.1| competence protein ComF, putative [Psychromonas sp. CNPT3]
          Length = 217

 Score = 66.8 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 15/59 (25%), Positives = 28/59 (47%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ AF + +     +    +++IDDV ++GAT       L + GA  V I    R+ + 
Sbjct: 152 LKGAFTLQKEQQASLKDAYVVIIDDVVSSGATVNSLCTILLQGGARRVDIWAICRTSRQ 210


>gi|283787952|ref|YP_003367817.1| competence protein [Citrobacter rodentium ICC168]
 gi|282951406|emb|CBG91105.1| putative competence protein [Citrobacter rodentium ICC168]
          Length = 227

 Score = 66.8 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL + ++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 175 LKNAFRL----ELPVRGLHMAIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 227


>gi|225077353|ref|ZP_03720552.1| hypothetical protein NEIFLAOT_02413 [Neisseria flavescens
           NRL30031/H210]
 gi|224951345|gb|EEG32554.1| hypothetical protein NEIFLAOT_02413 [Neisseria flavescens
           NRL30031/H210]
          Length = 165

 Score = 66.8 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++NAF +   +        ILLIDDV+TTG+T    A  LKK+GA  +   + +R
Sbjct: 109 IKNAFKIKAELP---KACNILLIDDVFTTGSTLNELAKTLKKSGAGKIFCWSLAR 160


>gi|170749082|ref|YP_001755342.1| competence protein F [Methylobacterium radiotolerans JCM 2831]
 gi|170655604|gb|ACB24659.1| competence protein F [Methylobacterium radiotolerans JCM 2831]
          Length = 253

 Score = 66.8 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 33/54 (61%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +  AF V       + G ++LL+DDV TTGAT   AA AL + GA +V +LTF+
Sbjct: 193 LSGAFRVTAAEQHRIRGRRVLLVDDVMTTGATGNAAARALLRGGATSVDLLTFA 246


>gi|168182220|ref|ZP_02616884.1| protein ComF homolog [Clostridium botulinum Bf]
 gi|237793489|ref|YP_002861041.1| putative ComF protein [Clostridium botulinum Ba4 str. 657]
 gi|182674670|gb|EDT86631.1| protein ComF homolog [Clostridium botulinum Bf]
 gi|229262460|gb|ACQ53493.1| putative ComF protein [Clostridium botulinum Ba4 str. 657]
          Length = 225

 Score = 66.8 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + ++F V       +   K+LLIDDV TTGAT+   A  LKK GA  + ILT ++S
Sbjct: 170 VEDSFKVYNEKC--IKNKKVLLIDDVLTTGATSFYCANELKKRGAKEIFILTAAKS 223


>gi|88705178|ref|ZP_01102889.1| conserved hypothetical protein [Congregibacter litoralis KT71]
 gi|88700268|gb|EAQ97376.1| conserved hypothetical protein [Congregibacter litoralis KT71]
          Length = 239

 Score = 66.8 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF V       V G ++ ++DDV TTGAT    A AL +AGA  V ++  +R+  
Sbjct: 185 LRDAFAVT----GDVRGCRVGIVDDVCTTGATGNAMATALLQAGASEVHLICLARTPS 238


>gi|99082742|ref|YP_614896.1| competence protein F, putative [Ruegeria sp. TM1040]
 gi|99039022|gb|ABF65634.1| competence protein F putative [Ruegeria sp. TM1040]
          Length = 243

 Score = 66.8 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 30/57 (52%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           + +A      ++  + G ++LL+DDV T+G+T    A A   AGA + ++   +R  
Sbjct: 185 LSDAIRPNPRMASRLKGRRVLLVDDVMTSGSTLSACARACMDAGAKSTNVAVLARVT 241


>gi|320530105|ref|ZP_08031175.1| ComF family protein [Selenomonas artemidis F0399]
 gi|320137538|gb|EFW29450.1| ComF family protein [Selenomonas artemidis F0399]
          Length = 172

 Score = 66.8 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
            AF         +AG  ILL+DD+ TTG T    A  LK+AGA  +  L  +
Sbjct: 119 GAFVCANG--AQIAGRHILLLDDIMTTGTTLLECARTLKRAGAENIYALVLA 168


>gi|78224524|ref|YP_386271.1| phosphoribosyltransferase [Geobacter metallireducens GS-15]
 gi|78195779|gb|ABB33546.1| Phosphoribosyltransferase [Geobacter metallireducens GS-15]
          Length = 242

 Score = 66.8 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF V       +AG ++LL+DDV TTG+T    A  LK AGA  V ++T + +  
Sbjct: 185 VRGAFAVSG--PAGIAGRRVLLMDDVVTTGSTVAECARVLKDAGASAVFVITVALAPP 240


>gi|312877563|ref|ZP_07737522.1| phosphoribosyltransferase [Caldicellulosiruptor lactoaceticus 6A]
 gi|311795638|gb|EFR12008.1| phosphoribosyltransferase [Caldicellulosiruptor lactoaceticus 6A]
          Length = 231

 Score = 66.8 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 14/54 (25%), Positives = 28/54 (51%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++    + +     +   +++L+DD++TTGATA   +  L K GA  V +   +
Sbjct: 172 IKGKIELKKGYENIIKDKRVILVDDIFTTGATANECSKVLLKNGAKCVFVSVLA 225


>gi|255065466|ref|ZP_05317321.1| ComF/gntX family protein [Neisseria sicca ATCC 29256]
 gi|255050291|gb|EET45755.1| ComF/gntX family protein [Neisseria sicca ATCC 29256]
          Length = 268

 Score = 66.4 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 3/55 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++NAF +  ++S       ILLIDDV+TTG+T    A  LKK+GA  +   + +R
Sbjct: 194 IKNAFEINGHIS---KNCNILLIDDVFTTGSTLNELAQTLKKSGAGKIFCWSLAR 245


>gi|260429468|ref|ZP_05783445.1| competence protein F [Citreicella sp. SE45]
 gi|260420091|gb|EEX13344.1| competence protein F [Citreicella sp. SE45]
          Length = 162

 Score = 66.4 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 28/59 (47%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           + +A  V       +    +LL+DDV T+GAT   A  A   AGA  V +   +R  KD
Sbjct: 103 LDDAIRVAPKWQPLLRDRPVLLVDDVMTSGATLSMATEACVAAGASEVCVCVLARVAKD 161


>gi|253690286|ref|YP_003019476.1| gluconate periplasmic binding protein [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|251756864|gb|ACT14940.1| gluconate periplasmic binding protein [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 233

 Score = 66.4 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF+        ++G +++L+DDV TTG+TA   +  L   GA  V +    R+L
Sbjct: 181 LRGAFS----CDVSLSGQQVVLLDDVVTTGSTAAEISRLLLAQGAAGVQVWCLCRTL 233


>gi|227112202|ref|ZP_03825858.1| gluconate periplasmic binding protein [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 233

 Score = 66.4 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF+        ++G +++L+DDV TTG+TA   +  L   GA  V +    R+L
Sbjct: 181 LRGAFS----CDVSLSGQQVVLLDDVVTTGSTAAEISRLLLAQGAAGVQVWCLCRTL 233


>gi|312793874|ref|YP_004026797.1| phosphoribosyltransferase [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312181014|gb|ADQ41184.1| phosphoribosyltransferase [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 231

 Score = 66.4 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 14/54 (25%), Positives = 28/54 (51%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++    + +     +   +++L+DD++TTGATA   +  L K GA  V +   +
Sbjct: 172 IKGKIELKKGYENIIKDKRVILVDDIFTTGATANECSKVLLKNGAKCVFVSVLA 225


>gi|212711653|ref|ZP_03319781.1| hypothetical protein PROVALCAL_02728 [Providencia alcalifaciens DSM
           30120]
 gi|212685755|gb|EEB45283.1| hypothetical protein PROVALCAL_02728 [Providencia alcalifaciens DSM
           30120]
          Length = 227

 Score = 66.4 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 25/57 (43%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF +       V+GL I +IDDV TTGAT   AA  L  AGA TV   +  R+L
Sbjct: 175 LKKAFAL----ETSVSGLHIAIIDDVITTGATMHAAAQLLICAGAHTVDAWSLCRTL 227


>gi|197286754|ref|YP_002152626.1| gluconate metabolism protein [Proteus mirabilis HI4320]
 gi|194684241|emb|CAR45762.1| putative gluconate metabolism protein [Proteus mirabilis HI4320]
          Length = 230

 Score = 66.4 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           + NAF V + V   VAG  + LIDDV TT AT       L +AGA +V +    R+L
Sbjct: 176 LNNAFIVNRTV--SVAGKDLALIDDVITTSATLNAIVPLLFRAGARSVEVWAICRTL 230


>gi|315635109|ref|ZP_07890387.1| competence protein F [Aggregatibacter segnis ATCC 33393]
 gi|315476071|gb|EFU66825.1| competence protein F [Aggregatibacter segnis ATCC 33393]
          Length = 185

 Score = 66.4 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 1/56 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +            + LIDDV TTGAT    A  L+KA    + +   +R+
Sbjct: 131 LKNAFQLSAKAR-DFPYRHVALIDDVITTGATLNEIAKLLRKANVTHIQVWGLART 185


>gi|171060486|ref|YP_001792835.1| putative phosphoribosyl transferase [Leptothrix cholodnii SP-6]
 gi|170777931|gb|ACB36070.1| putative phosphoribosyl transferase [Leptothrix cholodnii SP-6]
          Length = 266

 Score = 66.4 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 30/56 (53%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R A+ +       VA   + ++DDV TTGAT    A+ L++ GA +V     +R+
Sbjct: 208 VRGAYALTAAGQIAVAARHVAIVDDVMTTGATLAELALTLQRGGAASVQAWVLART 263


>gi|241764400|ref|ZP_04762425.1| ComF family protein [Acidovorax delafieldii 2AN]
 gi|241366190|gb|EER60761.1| ComF family protein [Acidovorax delafieldii 2AN]
          Length = 186

 Score = 66.4 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 36/56 (64%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF V    +  + GL+++LIDDV TTGAT   AA  L++AGA  ++ L  +R+
Sbjct: 128 LRVAFAVEPARAAGLRGLRLVLIDDVMTTGATLDAAARVLREAGAAHITALVVART 183


>gi|325291342|ref|YP_004267523.1| phosphoribosyltransferase [Syntrophobotulus glycolicus DSM 8271]
 gi|324966743|gb|ADY57522.1| phosphoribosyltransferase [Syntrophobotulus glycolicus DSM 8271]
          Length = 246

 Score = 66.4 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF +      +VA   I L DDV TTG T    A  L +AGA  V     +
Sbjct: 187 LKGAFQLRPNF--NVAAKVIWLADDVTTTGTTFNECAKVLMEAGAEKVYGFCLA 238


>gi|146278666|ref|YP_001168825.1| amidophosphoribosyltransferase-like protein [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145556907|gb|ABP71520.1| amidophosphoribosyltransferase-like protein [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 240

 Score = 66.4 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 29/59 (49%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           M  A          + G ++L++DDV T+GAT   A  A   AGA  V++   +R  KD
Sbjct: 181 MTGAILPHPKRGTLLRGRRVLIVDDVMTSGATLAAATEACHGAGATHVTVAVLARVAKD 239


>gi|227832721|ref|YP_002834428.1| ribose-phosphate pyrophosphokinase [Corynebacterium aurimucosum
           ATCC 700975]
 gi|262182790|ref|ZP_06042211.1| ribose-phosphate pyrophosphokinase [Corynebacterium aurimucosum
           ATCC 700975]
 gi|227453737|gb|ACP32490.1| ribose-phosphate pyrophosphokinase [Corynebacterium aurimucosum
           ATCC 700975]
          Length = 324

 Score = 66.4 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 24/54 (44%)

Query: 6   NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            V   V   V G   +L+DD+  TG T   A   LK+AGA +V I        D
Sbjct: 212 TVSNRVVGDVEGKDCILLDDMIDTGGTIAGAVRVLKEAGAKSVVIACTHGVFSD 265


>gi|296271398|ref|YP_003654030.1| hypoxanthine phosphoribosyltransferase [Thermobispora bispora DSM
           43833]
 gi|296094185|gb|ADG90137.1| hypoxanthine phosphoribosyltransferase [Thermobispora bispora DSM
           43833]
          Length = 182

 Score = 66.4 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 14/53 (26%), Positives = 24/53 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               V + +   +AG  +L+++D+  +G T       LK  G  +V I T  R
Sbjct: 77  GVVRVLKDLDTDIAGRHVLIVEDIIDSGLTLSWLVNNLKSRGPASVEICTLLR 129


>gi|291280268|ref|YP_003497103.1| hypothetical protein DEFDS_1895 [Deferribacter desulfuricans SSM1]
 gi|290754970|dbj|BAI81347.1| conserved hypothetical protein [Deferribacter desulfuricans SSM1]
          Length = 221

 Score = 66.4 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 4/55 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +  AF        ++ GLKILL+DD+ TTGAT    +  L K GA  V +   ++
Sbjct: 167 ISGAFK----AKANLKGLKILLVDDIMTTGATINECSKVLLKNGAKKVDVFCLTK 217


>gi|83942062|ref|ZP_00954524.1| Competence protein F [Sulfitobacter sp. EE-36]
 gi|83847882|gb|EAP85757.1| Competence protein F [Sulfitobacter sp. EE-36]
          Length = 242

 Score = 66.4 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 32/59 (54%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  A       +  + G  +LL+DDV T+GAT + +A A  +A A  + ++T +R  KD
Sbjct: 183 LDGAITAHPRRADLLRGRPVLLVDDVMTSGATLQASARACLEARAGPICVVTLARVAKD 241


>gi|113866369|ref|YP_724858.1| amidophosphoribosyltransferase [Ralstonia eutropha H16]
 gi|113525145|emb|CAJ91490.1| predicted amidophosphoribosyltransferase [Ralstonia eutropha H16]
          Length = 285

 Score = 66.4 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF + +       G+ + L+DDV T+GAT   AA  LK  GA  VS++   R+
Sbjct: 231 LRGAFRLARAARLD--GMHVALVDDVMTSGATLHEAAGVLKAHGAARVSVIVALRT 284


>gi|319638737|ref|ZP_07993496.1| competence protein [Neisseria mucosa C102]
 gi|317399978|gb|EFV80640.1| competence protein [Neisseria mucosa C102]
          Length = 238

 Score = 66.4 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++NAF +   +        ILLIDDV+TTG+T    A  LKK+GA  +   + +R
Sbjct: 182 IKNAFKIKAELP---KACNILLIDDVFTTGSTLDELAKTLKKSGAGKIFCWSLAR 233


>gi|114565757|ref|YP_752911.1| phosphoribosyltransferase [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|114336692|gb|ABI67540.1| phosphoribosyltransferase [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
          Length = 239

 Score = 66.4 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           AF V Q     V G KILL+DDVYTTG+T +     L +AGA  VS++T++
Sbjct: 186 AFKVTQPQK--VLGKKILLVDDVYTTGSTIRECTRVLLEAGAERVSVITWA 234


>gi|71279715|ref|YP_266985.1| competence protein,-like protein [Colwellia psychrerythraea 34H]
 gi|71145455|gb|AAZ25928.1| competence protein, homolog [Colwellia psychrerythraea 34H]
          Length = 273

 Score = 66.4 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 35/59 (59%), Gaps = 2/59 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           + NAF + + +  H+    +L++DDV TTG T    +  LK+AG  TV+++T   ++ +
Sbjct: 208 LANAFALQRKLGSHI--KHVLIVDDVVTTGTTVSEISKLLKQAGVETVTLVTVCLTVPN 264


>gi|254448931|ref|ZP_05062386.1| ComF family protein [gamma proteobacterium HTCC5015]
 gi|198261468|gb|EDY85758.1| ComF family protein [gamma proteobacterium HTCC5015]
          Length = 249

 Score = 66.4 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 4/53 (7%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           AF+V +     V    ++L+DDV T+GAT +  + AL KAGA +V +   +R+
Sbjct: 194 AFSVVE----DVRDKHLVLVDDVMTSGATLEALSDALLKAGAASVRLAVLART 242


>gi|331701708|ref|YP_004398667.1| phosphoribosyltransferase [Lactobacillus buchneri NRRL B-30929]
 gi|329129051|gb|AEB73604.1| phosphoribosyltransferase [Lactobacillus buchneri NRRL B-30929]
          Length = 230

 Score = 66.4 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 30/51 (58%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           F + +     V    +LL+DDVYTTG T + AA  +++AGA +V   T +R
Sbjct: 180 FEMIESQKNQVKNRAVLLVDDVYTTGTTIRHAAALIQQAGAASVKGFTLAR 230


>gi|91776533|ref|YP_546289.1| hypothetical protein Mfla_2181 [Methylobacillus flagellatus KT]
 gi|91710520|gb|ABE50448.1| conserved hypothetical protein [Methylobacillus flagellatus KT]
          Length = 227

 Score = 66.4 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 4/59 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           M+ AF         +  ++++L+DDV TTGA+    A  +K AGA  V     +R++ +
Sbjct: 173 MQGAFA----CQAELTDMRVILLDDVMTTGASLNALAKTVKAAGASRVECWVIARTIAE 227


>gi|311695378|gb|ADP98251.1| competence protein ComF [marine bacterium HP15]
          Length = 247

 Score = 66.4 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 5/56 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R  F V   V + +A     ++DDV TTGAT +  + AL++AGA  + +   +R+
Sbjct: 195 LRGVFEVIPPVPERIA-----IVDDVVTTGATVRVLSSALREAGARNIQVWALART 245


>gi|296132307|ref|YP_003639554.1| hypoxanthine phosphoribosyltransferase [Thermincola sp. JR]
 gi|296030885|gb|ADG81653.1| hypoxanthine phosphoribosyltransferase [Thermincola potens JR]
          Length = 179

 Score = 66.1 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + + + V    +L+++D+  +G T K     LK  G  +V + T 
Sbjct: 77  GVVRILKDLDQSVENKHVLIVEDIIDSGLTLKYLVEILKSRGPASVKVCTL 127


>gi|241760595|ref|ZP_04758687.1| competence protein [Neisseria flavescens SK114]
 gi|241318776|gb|EER55302.1| competence protein [Neisseria flavescens SK114]
          Length = 238

 Score = 66.1 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++NAF +   +        ILLIDDV+TTG+T    A  LKK+GA  +   + +R
Sbjct: 182 IKNAFEIKAELP---KACNILLIDDVFTTGSTLNELAKTLKKSGAGKIFCWSLAR 233


>gi|284799525|ref|ZP_05984223.2| ComF/gntX family protein [Neisseria subflava NJ9703]
 gi|284798135|gb|EFC53482.1| ComF/gntX family protein [Neisseria subflava NJ9703]
          Length = 165

 Score = 66.1 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++NAF +   +        ILLIDDV+TTG+T    A  LKK+GA  +   + +R
Sbjct: 109 IKNAFKIKTELP---KACNILLIDDVFTTGSTLNELAKTLKKSGAGKIFCWSLAR 160


>gi|206890480|ref|YP_002248775.1| phosphoribosyltransferase [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|206742418|gb|ACI21475.1| phosphoribosyltransferase [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 219

 Score = 66.1 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NA+ V   + K +    + L+DDV TTGAT    A  LKKAG   V  +T +R++
Sbjct: 167 VKNAYKVT-GLMKEIK---VGLVDDVVTTGATLMECAKTLKKAGIKEVHAITLARTI 219


>gi|329902630|ref|ZP_08273189.1| Competence protein F [Oxalobacteraceae bacterium IMCC9480]
 gi|327548688|gb|EGF33333.1| Competence protein F [Oxalobacteraceae bacterium IMCC9480]
          Length = 210

 Score = 66.1 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 31/58 (53%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +  AF VP      V G  + ++DDV TTGAT    A  LK+ GA  V+ L F+R+  
Sbjct: 152 IHAAFVVPVQAMASVDGRHVGVVDDVMTTGATLHEVAATLKRYGARRVTNLVFARTPP 209


>gi|302390143|ref|YP_003825964.1| phosphoribosyltransferase [Thermosediminibacter oceani DSM 16646]
 gi|302200771|gb|ADL08341.1| phosphoribosyltransferase [Thermosediminibacter oceani DSM 16646]
          Length = 240

 Score = 66.1 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +  AF V       +    +LLIDDVYTTG+TA   + AL +AGA  V +LT +R
Sbjct: 187 VAGAFAVKDG--SAIKEKTLLLIDDVYTTGSTADECSKALLQAGASGVYVLTAAR 239


>gi|50123053|ref|YP_052220.1| gluconate periplasmic-binding protein [Pectobacterium atrosepticum
           SCRI1043]
 gi|49613579|emb|CAG77030.1| conserved hypothetical protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 233

 Score = 66.1 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF+        ++G +++L+DDV TTG+TA   +  L   GA  V +    R+L
Sbjct: 181 LRGAFS----CDVPLSGQQVVLLDDVVTTGSTAAEISRLLLAQGAAGVQVWCLCRTL 233


>gi|296118200|ref|ZP_06836781.1| ribose-phosphate pyrophosphokinase [Corynebacterium ammoniagenes
           DSM 20306]
 gi|295968758|gb|EFG82002.1| ribose-phosphate pyrophosphokinase [Corynebacterium ammoniagenes
           DSM 20306]
          Length = 324

 Score = 66.1 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 24/54 (44%)

Query: 6   NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            V   V   + G   +L+DD+  TG T   A   L++AGA +V I        D
Sbjct: 212 TVSNRVVGDIEGKDCILLDDMIDTGGTIAGAVRVLREAGARSVVIACTHGVFSD 265


>gi|331005762|ref|ZP_08329121.1| Competence protein F [gamma proteobacterium IMCC1989]
 gi|330420399|gb|EGG94706.1| Competence protein F [gamma proteobacterium IMCC1989]
          Length = 249

 Score = 66.1 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +++ F V       +  L +++IDDV TTGAT      ALKKAGA  VS    +R  K
Sbjct: 196 LKHGFTVTSP----LNNLHVVIIDDVMTTGATVDAMTTALKKAGAGKVSAWVLARVPK 249


>gi|289812183|ref|ZP_06542812.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhi str. AG3]
          Length = 146

 Score = 66.1 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 94  LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 146


>gi|54298222|ref|YP_124591.1| hypothetical protein lpp2280 [Legionella pneumophila str. Paris]
 gi|53752007|emb|CAH13433.1| hypothetical protein lpp2280 [Legionella pneumophila str. Paris]
          Length = 234

 Score = 66.1 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 5/57 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R+AF VP      V    ++++DD+ TTG+TA   A  LK AG   V I   +R++
Sbjct: 180 LRHAFYVPP-----VTYEHVMIVDDLLTTGSTANEIAHTLKNAGVKRVDICCCARAV 231


>gi|126724616|ref|ZP_01740459.1| Competence protein F [Rhodobacterales bacterium HTCC2150]
 gi|126705780|gb|EBA04870.1| Competence protein F [Rhodobacterales bacterium HTCC2150]
          Length = 240

 Score = 66.1 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 30/57 (52%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            A +V       + G  +L+IDDV T+GA    +  A K+AGA  V + T +R  KD
Sbjct: 183 GAIDVHPKAQDFIKGRSVLIIDDVMTSGAILAASTEAAKQAGADDVFVATLARVAKD 239


>gi|51244132|ref|YP_064016.1| competence protein F [Desulfotalea psychrophila LSv54]
 gi|50875169|emb|CAG35009.1| related to competence protein F [Desulfotalea psychrophila LSv54]
          Length = 238

 Score = 66.1 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           AF +     + + G KI L+DDV+TTG T    +  L+K GA  V +LT +R +
Sbjct: 184 AFTLRDA--EMIRGRKICLVDDVFTTGTTVDECSKVLRKNGAAEVEVLTLARVI 235


>gi|160935942|ref|ZP_02083316.1| hypothetical protein CLOBOL_00837 [Clostridium bolteae ATCC
           BAA-613]
 gi|158441184|gb|EDP18901.1| hypothetical protein CLOBOL_00837 [Clostridium bolteae ATCC
           BAA-613]
          Length = 177

 Score = 66.1 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 9/51 (17%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + + + + G  +L+++D+  +G T       LK+ G  ++ + T 
Sbjct: 76  GVVRIVKDLDESLEGKDVLIVEDIIDSGRTLAYLIEVLKQRGPKSIHLCTL 126


>gi|322381176|ref|ZP_08055179.1| hypoxanthine-guanine phosphoribosyltransferase-like protein
           [Paenibacillus larvae subsp. larvae B-3650]
 gi|321154752|gb|EFX47023.1| hypoxanthine-guanine phosphoribosyltransferase-like protein
           [Paenibacillus larvae subsp. larvae B-3650]
          Length = 190

 Score = 65.7 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 25/51 (49%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V G  IL+++D+  +G T       LK+  A +VS++T 
Sbjct: 88  GVVKIIKDLDTSVEGRDILIVEDIIDSGLTLSYLIDVLKRRNAKSVSVVTL 138


>gi|254504618|ref|ZP_05116769.1| Phosphoribosyl transferase domain protein [Labrenzia alexandrii
           DFL-11]
 gi|222440689|gb|EEE47368.1| Phosphoribosyl transferase domain protein [Labrenzia alexandrii
           DFL-11]
          Length = 200

 Score = 65.7 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 35/54 (64%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +R AF V     + +AG +++L+DDVYTTG+T       LK AGA TV +LTF+
Sbjct: 133 VRRAFQVSGDQLQKLAGRRVVLVDDVYTTGSTVSACTKVLKSAGAGTVDVLTFA 186


>gi|291086353|ref|ZP_06355549.2| hypothetical protein CIT292_10203 [Citrobacter youngae ATCC 29220]
 gi|291067974|gb|EFE06083.1| putative competence protein ComF [Citrobacter youngae ATCC 29220]
          Length = 139

 Score = 65.7 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 87  LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 139


>gi|254436580|ref|ZP_05050074.1| hypothetical protein OA307_1450 [Octadecabacter antarcticus 307]
 gi|198252026|gb|EDY76340.1| hypothetical protein OA307_1450 [Octadecabacter antarcticus 307]
          Length = 239

 Score = 65.7 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 30/59 (50%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  A          +AG K+LLIDDV T+GAT   A      AGA  V +L  +R +K+
Sbjct: 180 LSGAIAANPKRMAQLAGRKVLLIDDVMTSGATFAAATEPCYGAGADDVCVLALARVVKN 238


>gi|317125626|ref|YP_004099738.1| phosphoribosyltransferase [Intrasporangium calvum DSM 43043]
 gi|315589714|gb|ADU49011.1| phosphoribosyltransferase [Intrasporangium calvum DSM 43043]
          Length = 282

 Score = 65.7 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 30/58 (51%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +++A  V    +  V G + LL+DDV TTG+T    A AL  AGA  V     + + +
Sbjct: 196 LQSAMEVRGSAAHRVRGRRCLLVDDVMTTGSTLAEGARALHDAGAADVHAAVIAATPR 253


>gi|289547848|ref|YP_003472836.1| amidophosphoribosyltransferase-like protein [Thermocrinis albus DSM
           14484]
 gi|289181465|gb|ADC88709.1| amidophosphoribosyltransferase-like protein [Thermocrinis albus DSM
           14484]
          Length = 214

 Score = 65.7 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 18/48 (37%), Positives = 26/48 (54%)

Query: 7   VPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           + +     V G +ILL+DD+ TTGAT+   A  L +AGA  V     +
Sbjct: 160 LKENTKPFVEGKRILLVDDILTTGATSSKLAQLLYEAGAREVHAFFVA 207


>gi|326387515|ref|ZP_08209122.1| phosphoribosyltransferase [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326208004|gb|EGD58814.1| phosphoribosyltransferase [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 281

 Score = 65.7 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 30/59 (50%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +     V    +  + G  +LLIDDV T+GAT      AL +AGA  V I  F+R + +
Sbjct: 198 LAGTIRVNARRAARLKGANVLLIDDVLTSGATTNACMAALHRAGAARVRIACFARVVDE 256


>gi|300725235|ref|YP_003714563.1| putative periplasmic gluconate-binding protein in GNT I transport
           system [Xenorhabdus nematophila ATCC 19061]
 gi|297631780|emb|CBJ92499.1| putative periplasmic gluconate-binding protein in GNT I transport
           system [Xenorhabdus nematophila ATCC 19061]
          Length = 227

 Score = 65.7 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +++AF +      +     + + DDV TTG T    +  L +AGA +V      R+L
Sbjct: 175 LKHAFQL----RGNFVDQHVAIFDDVITTGTTLHETSQLLIRAGARSVQAWAICRTL 227


>gi|331084363|ref|ZP_08333467.1| hypothetical protein HMPREF0992_02391 [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|330401627|gb|EGG81208.1| hypothetical protein HMPREF0992_02391 [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 234

 Score = 65.7 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 35/54 (64%), Gaps = 4/54 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           M+NAF V + + +      ILL+DD+YTTG+T + AA  LKKAGA  +  LT +
Sbjct: 180 MKNAFIVRKKLKEE----NILLVDDIYTTGSTIEEAAKELKKAGAQNIFFLTIA 229


>gi|260590047|ref|ZP_05855960.1| ComF family protein [Blautia hansenii DSM 20583]
 gi|260539559|gb|EEX20128.1| ComF family protein [Blautia hansenii DSM 20583]
          Length = 212

 Score = 65.7 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 35/54 (64%), Gaps = 4/54 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           M+NAF V + + +      ILL+DD+YTTG+T + AA  LKKAGA  +  LT +
Sbjct: 158 MKNAFIVRKKLKEE----NILLVDDIYTTGSTIEEAAKELKKAGAQNIFFLTIA 207


>gi|126730067|ref|ZP_01745879.1| Competence protein F [Sagittula stellata E-37]
 gi|126709447|gb|EBA08501.1| Competence protein F [Sagittula stellata E-37]
          Length = 237

 Score = 65.7 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 30/59 (50%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +          +  +AG ++LL+DDV TTGAT    A A   AGA  V +   +R +KD
Sbjct: 178 LSGRIAARAGRAGLMAGRRVLLVDDVMTTGATLAACAEACLSAGAQQVCVSVLARVVKD 236


>gi|68171519|ref|ZP_00544900.1| competence protein F [Ehrlichia chaffeensis str. Sapulpa]
 gi|88658293|ref|YP_506971.1| putative competence protein F [Ehrlichia chaffeensis str. Arkansas]
 gi|67999066|gb|EAM85736.1| competence protein F [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599750|gb|ABD45219.1| putative competence protein F [Ehrlichia chaffeensis str. Arkansas]
          Length = 230

 Score = 65.7 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +F V       +    ILL+DDV TTG T +     L ++GA  V ++T +R+L
Sbjct: 179 SFTVKN--QHLINNKIILLVDDVITTGITVRTCTHKLIESGAKEVRVITLARTL 230


>gi|323142221|ref|ZP_08077055.1| comF family protein [Phascolarctobacterium sp. YIT 12067]
 gi|322413284|gb|EFY04169.1| comF family protein [Phascolarctobacterium sp. YIT 12067]
          Length = 241

 Score = 65.7 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +   F +  +    V+G  +LL DD+YTTG+T   AA  L  AGA  VS L    +
Sbjct: 183 LAGCFAMLPHAR--VSGKHVLLCDDIYTTGSTFAEAAQVLLDAGAARVSALALCAA 236


>gi|254516149|ref|ZP_05128209.1| phosphoribosyltransferase [gamma proteobacterium NOR5-3]
 gi|219675871|gb|EED32237.1| phosphoribosyltransferase [gamma proteobacterium NOR5-3]
          Length = 131

 Score = 65.7 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF V      +V G  I ++DDV TT AT    A  L  AGA  V +   +R+
Sbjct: 77  LKGAFRVH----GNVQGRTIGIVDDVCTTAATGNAMAETLLDAGAAEVHLYCLART 128


>gi|317472164|ref|ZP_07931496.1| comF family protein [Anaerostipes sp. 3_2_56FAA]
 gi|316900568|gb|EFV22550.1| comF family protein [Anaerostipes sp. 3_2_56FAA]
          Length = 234

 Score = 65.7 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/44 (47%), Positives = 28/44 (63%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
            S  V G ++LL+DD+YTTGATA+    ALK AGA  V +   +
Sbjct: 186 ASDEVKGKRVLLVDDIYTTGATAESCTRALKAAGAEDVWVFCVA 229


>gi|254429751|ref|ZP_05043458.1| hypothetical protein ADG881_2981 [Alcanivorax sp. DG881]
 gi|196195920|gb|EDX90879.1| hypothetical protein ADG881_2981 [Alcanivorax sp. DG881]
          Length = 248

 Score = 65.7 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/49 (40%), Positives = 31/49 (63%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +    V GL+++L+DDV TTG++A+ AA  L   GA  V + T +R+L 
Sbjct: 196 HCQHPVTGLRLILVDDVMTTGSSARAAAQCLLDHGAKDVRVWTLARTLP 244


>gi|301059590|ref|ZP_07200502.1| ComF family protein [delta proteobacterium NaphS2]
 gi|300446355|gb|EFK10208.1| ComF family protein [delta proteobacterium NaphS2]
          Length = 246

 Score = 65.7 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +++AF V +  S  +    ILL+DDV+TTG T    A  L + GA  V  +T +R++
Sbjct: 191 VQDAF-VLKNPSGVLK-KNILLVDDVFTTGNTLNECAKVLMQGGAEAVFCVTLARAV 245


>gi|261823347|ref|YP_003261453.1| gluconate periplasmic binding protein [Pectobacterium wasabiae
           WPP163]
 gi|261607360|gb|ACX89846.1| gluconate periplasmic binding protein [Pectobacterium wasabiae
           WPP163]
          Length = 233

 Score = 65.7 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF+        ++G +++L+DDV TTG+TA   +  L   GA  V +    R+L
Sbjct: 181 LRGAFS----CDVSLSGQQVVLLDDVVTTGSTAAEISRLLLTQGAAGVQVWCLCRTL 233


>gi|325294534|ref|YP_004281048.1| phosphoribosyltransferase [Desulfurobacterium thermolithotrophum
           DSM 11699]
 gi|325064982|gb|ADY72989.1| phosphoribosyltransferase [Desulfurobacterium thermolithotrophum
           DSM 11699]
          Length = 245

 Score = 65.7 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++  F V +     V G +ILL DDV+TTG+T    +  LK+ GA  V + + +RS+
Sbjct: 193 IKGIFEVVE----KVWGKRILLFDDVFTTGSTVNEISRVLKENGASKVFVYSVARSI 245


>gi|332982900|ref|YP_004464341.1| phosphoribosyltransferase [Mahella australiensis 50-1 BON]
 gi|332700578|gb|AEE97519.1| phosphoribosyltransferase [Mahella australiensis 50-1 BON]
          Length = 243

 Score = 65.7 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 23/54 (42%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +  AF+V     K + G  I+LIDD+ TTGATA   A AL   GA  V + T +
Sbjct: 187 IAGAFDVKDA--KDIKGKTIMLIDDILTTGATADACAQALLVGGANAVYVFTLA 238


>gi|149911005|ref|ZP_01899634.1| ComF-related protein [Moritella sp. PE36]
 gi|149805908|gb|EDM65894.1| ComF-related protein [Moritella sp. PE36]
          Length = 237

 Score = 65.7 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 30/59 (50%), Gaps = 4/59 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           M NAF V Q  S       I LIDDV TTG T K A + L  AG   + I   +R+L D
Sbjct: 183 MHNAFQVTQRFSV----KHIALIDDVVTTGETIKAACLTLFAAGIERIDIWCIARTLAD 237


>gi|262273565|ref|ZP_06051379.1| predicted amidophosphoribosyltransferase [Grimontia hollisae CIP
           101886]
 gi|262222543|gb|EEY73854.1| predicted amidophosphoribosyltransferase [Grimontia hollisae CIP
           101886]
          Length = 282

 Score = 65.3 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 28/59 (47%), Gaps = 5/59 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +++AF+V   +        + L+DDV TTGAT       L++ G   + +    R+  D
Sbjct: 227 LKSAFSVNGKLPP-----HVALVDDVVTTGATIAQICSLLRRHGVERIDVYCLCRTPPD 280


>gi|269140628|ref|YP_003297329.1| putative competence-related protein F [Edwardsiella tarda EIB202]
 gi|267986289|gb|ACY86118.1| putative competence-related protein F [Edwardsiella tarda EIB202]
 gi|304560414|gb|ADM43078.1| conserved hypothetical protein [Edwardsiella tarda FL6-60]
          Length = 226

 Score = 65.3 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF   +     +AG ++LL+DDV TT +T    +  L   G M+V  +   R+L
Sbjct: 174 LRGAFAAHRG----LAGRRVLLVDDVITTSSTLSEISRLLIAQGVMSVETICLCRTL 226


>gi|258591131|emb|CBE67426.1| putative competence protein F (COMF) (fragment) [NC10 bacterium
           'Dutch sediment']
          Length = 165

 Score = 65.3 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF V +     V G K+LLIDDV+TTGATA   A  L  AGA  V + T +R 
Sbjct: 111 VKGAFVVIR--PDGVKGKKLLLIDDVFTTGATAAECARTLLAAGAADVGVYTLARV 164


>gi|229541556|ref|ZP_04430616.1| phosphoribosyltransferase [Bacillus coagulans 36D1]
 gi|229325976|gb|EEN91651.1| phosphoribosyltransferase [Bacillus coagulans 36D1]
          Length = 235

 Score = 65.3 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 30/47 (63%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
                + G  +LL+DD+YTTG+T + AA  L++AGA  +  LT +RS
Sbjct: 189 EKEVSIEGRSVLLVDDIYTTGSTVRHAAKVLREAGARKIVSLTVARS 235


>gi|257877559|ref|ZP_05657212.1| competence protein ComFC [Enterococcus casseliflavus EC20]
 gi|257811725|gb|EEV40545.1| competence protein ComFC [Enterococcus casseliflavus EC20]
          Length = 226

 Score = 65.3 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 30/51 (58%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           F V   V+  + G K+LLIDDVYTTG T   AA AL+  G  ++   + +R
Sbjct: 176 FAVKPDVACEIKGKKLLLIDDVYTTGRTLYHAAEALQSFGPQSIRSFSIAR 226


>gi|257867480|ref|ZP_05647133.1| competence protein ComFC [Enterococcus casseliflavus EC30]
 gi|257873809|ref|ZP_05653462.1| competence protein ComFC [Enterococcus casseliflavus EC10]
 gi|257801536|gb|EEV30466.1| competence protein ComFC [Enterococcus casseliflavus EC30]
 gi|257807973|gb|EEV36795.1| competence protein ComFC [Enterococcus casseliflavus EC10]
          Length = 226

 Score = 65.3 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 30/51 (58%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           F V   V+  + G K+LLIDDVYTTG T   AA AL+  G  ++   + +R
Sbjct: 176 FAVKPDVACEIKGKKLLLIDDVYTTGRTLYHAAEALQSFGPQSIRSFSIAR 226


>gi|213023195|ref|ZP_03337642.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
           enterica serovar Typhi str. 404ty]
          Length = 134

 Score = 65.3 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 82  LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 134


>gi|167465128|ref|ZP_02330217.1| hypothetical protein Plarl_21636 [Paenibacillus larvae subsp.
           larvae BRL-230010]
          Length = 188

 Score = 65.3 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 25/51 (49%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V G  IL+++D+  +G T       LK+  A +VSI+T 
Sbjct: 86  GVVKIIKDLDTSVEGRDILIVEDIIDSGLTLSYLIDVLKRRNAKSVSIVTL 136


>gi|227327614|ref|ZP_03831638.1| gluconate periplasmic binding protein [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 233

 Score = 65.3 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF+        ++G +++L+DDV TTG+TA   +  L   GA  V +    R+L
Sbjct: 181 LRGAFS----CDVSLSGQQVVLLDDVVTTGSTAAEISRLLLGQGAAGVQVWCLCRTL 233


>gi|154499872|ref|ZP_02037910.1| hypothetical protein BACCAP_03529 [Bacteroides capillosus ATCC
           29799]
 gi|150271470|gb|EDM98727.1| hypothetical protein BACCAP_03529 [Bacteroides capillosus ATCC
           29799]
          Length = 220

 Score = 65.3 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            A+   +   + VAG +ILLIDDV TTGAT    A  L  AGA  V   T +R+  
Sbjct: 165 GAYACTE--PELVAGKRILLIDDVITTGATISECARTLLTAGAEKVVCATLARARS 218


>gi|163782323|ref|ZP_02177321.1| hypothetical protein HG1285_06035 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882356|gb|EDP75862.1| hypothetical protein HG1285_06035 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 216

 Score = 65.3 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 30/55 (54%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +++AF V +     V G ++L+ DD+ TTGAT++  +  L   GA  V     SR
Sbjct: 158 VKDAFGVREEFIDAVEGKRVLVFDDILTTGATSRAVSELLLSLGASEVFFYFLSR 212


>gi|254780309|ref|YP_003064722.1| comF family protein [Candidatus Liberibacter asiaticus str.
          psy62]
 gi|254039986|gb|ACT56782.1| comF family protein [Candidatus Liberibacter asiaticus str.
          psy62]
          Length = 59

 Score = 65.3 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 59/59 (100%), Positives = 59/59 (100%)

Query: 1  MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
          MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD
Sbjct: 1  MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59


>gi|15607029|ref|NP_214411.1| hypothetical protein aq_2059 [Aquifex aeolicus VF5]
 gi|2984284|gb|AAC07809.1| hypothetical protein aq_2059 [Aquifex aeolicus VF5]
          Length = 213

 Score = 65.3 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++ A+ V      +V G ++L+ DD+ TTG+TAK  +  L ++GA  V      +
Sbjct: 162 LKGAYKV----RGNVKGKRVLVFDDILTTGSTAKSVSKTLLESGAKEVYFYFLCK 212


>gi|89067454|ref|ZP_01154967.1| Competence protein F [Oceanicola granulosus HTCC2516]
 gi|89047023|gb|EAR53077.1| Competence protein F [Oceanicola granulosus HTCC2516]
          Length = 237

 Score = 65.3 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 34/59 (57%), Gaps = 1/59 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           + +A  +         G  +LL+DDV T+GAT   +  AL+ AGA  V +LT +R++KD
Sbjct: 179 LADAIALHPRRRLE-EGGAVLLVDDVMTSGATLAASTEALRAAGAGRVCVLTLARAVKD 236


>gi|302877488|ref|YP_003846052.1| phosphoribosyltransferase [Gallionella capsiferriformans ES-2]
 gi|302580277|gb|ADL54288.1| phosphoribosyltransferase [Gallionella capsiferriformans ES-2]
          Length = 237

 Score = 65.3 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 4/59 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R+AF      +  ++G  I L+DDV T+GA+    A A++K GA  +S+   +R+  +
Sbjct: 181 VRDAF----DCTLDLSGKHIALVDDVLTSGASMNELARAVQKWGANKISVWVAARATSN 235


>gi|255327318|ref|ZP_05368392.1| ribose-phosphate diphosphokinase [Rothia mucilaginosa ATCC 25296]
 gi|255295598|gb|EET74941.1| ribose-phosphate diphosphokinase [Rothia mucilaginosa ATCC 25296]
          Length = 326

 Score = 65.3 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 22/54 (40%)

Query: 6   NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            V + V   + G   +LIDD+  TG T   A   L   GA  V I      L D
Sbjct: 214 AVSKTVVGDIEGRTCVLIDDMIDTGGTIAGAVKVLMDKGAKEVIIAATHPVLSD 267


>gi|312868558|ref|ZP_07728755.1| comF family protein [Lactobacillus oris PB013-T2-3]
 gi|311095929|gb|EFQ54176.1| comF family protein [Lactobacillus oris PB013-T2-3]
          Length = 226

 Score = 65.3 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           F +   V   +AG ++LL+DDVYTTG T   AA  L +AGA  V  ++ +R
Sbjct: 177 FALSGPV-ADLAGKRVLLVDDVYTTGRTLYHAADLLYQAGAANVISISLAR 226


>gi|289423614|ref|ZP_06425414.1| phosphoribosyltransferase [Peptostreptococcus anaerobius 653-L]
 gi|289155982|gb|EFD04647.1| phosphoribosyltransferase [Peptostreptococcus anaerobius 653-L]
          Length = 273

 Score = 65.3 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 30/53 (56%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           +R  F V    +K++    + ++DD++TTG+T    A  LK +GA  V  LTF
Sbjct: 207 LRGVFKVQDDYTKYLEDRVVAVVDDIFTTGSTLNEIAKVLKLSGAKEVIGLTF 259


>gi|300692667|ref|YP_003753662.1| amidophosphoribosyltransferase, comF/gntX family [Ralstonia
           solanacearum PSI07]
 gi|299079727|emb|CBJ52403.1| putative amidophosphoribosyltransferase, comF/gntX family
           [Ralstonia solanacearum PSI07]
          Length = 240

 Score = 65.3 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF+VP      +AG  + ++DDV TTGAT    A  LK+AGA  V+     R+
Sbjct: 186 LQGAFDVPDPAR--IAGRHVGVVDDVMTTGATLSEIATQLKRAGAARVTNCVALRT 239


>gi|300767559|ref|ZP_07077469.1| late competence protein [Lactobacillus plantarum subsp. plantarum
           ATCC 14917]
 gi|300494544|gb|EFK29702.1| late competence protein [Lactobacillus plantarum subsp. plantarum
           ATCC 14917]
          Length = 147

 Score = 64.9 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 20/41 (48%), Positives = 30/41 (73%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +AG ++LL+DD+YTTG T + AA  L + GA +V+ LT +R
Sbjct: 107 LAGRRVLLVDDIYTTGRTMRHAATLLLENGAKSVTGLTLAR 147


>gi|323703201|ref|ZP_08114854.1| hypoxanthine phosphoribosyltransferase [Desulfotomaculum
           nigrificans DSM 574]
 gi|323531860|gb|EGB21746.1| hypoxanthine phosphoribosyltransferase [Desulfotomaculum
           nigrificans DSM 574]
          Length = 179

 Score = 64.9 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 25/51 (49%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
            A  + + + K + G  +++++D+  TG T +     +K  G  ++ I T 
Sbjct: 77  GAVRILKDLDKSIEGKHVIIVEDIVDTGLTLQYLVENMKARGPASLKICTL 127


>gi|310639529|ref|YP_003944287.1| hypoxanthine phosphoribosyltransferase [Paenibacillus polymyxa SC2]
 gi|309244479|gb|ADO54046.1| Hypoxanthine phosphoribosyltransferase [Paenibacillus polymyxa SC2]
          Length = 179

 Score = 64.9 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V G  +L+++D+  +G T       LK   A +V ++T 
Sbjct: 77  GVVKIIKDLDASVEGRDVLIVEDIIDSGLTLTHLIELLKNRNANSVCVVTL 127


>gi|71422640|ref|XP_812198.1| phosphoribosylpyrophosphate synthetase [Trypanosoma cruzi strain CL
           Brener]
 gi|70876951|gb|EAN90347.1| phosphoribosylpyrophosphate synthetase, putative [Trypanosoma
           cruzi]
          Length = 390

 Score = 64.9 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 22/49 (44%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +   V G   +++DD+  TG T   AA  L++ GA  V        L D
Sbjct: 228 LVGEVEGCDCIIVDDMIDTGGTLCKAAEVLRENGAKEVHAWATHGILTD 276


>gi|172058472|ref|YP_001814932.1| competence protein F [Exiguobacterium sibiricum 255-15]
 gi|171990993|gb|ACB61915.1| competence protein F [Exiguobacterium sibiricum 255-15]
          Length = 215

 Score = 64.9 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 31/48 (64%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +V + V G  ILL+DDVYTTG T   AA  L +AGA  +S +T  RS+
Sbjct: 168 HVMQPVTGKTILLVDDVYTTGTTLHQAASRLYEAGAKEISAVTLFRSV 215


>gi|261420591|ref|YP_003254273.1| late competence protein [Geobacillus sp. Y412MC61]
 gi|319768261|ref|YP_004133762.1| phosphoribosyltransferase [Geobacillus sp. Y412MC52]
 gi|261377048|gb|ACX79791.1| late competence protein [Geobacillus sp. Y412MC61]
 gi|317113127|gb|ADU95619.1| phosphoribosyltransferase [Geobacillus sp. Y412MC52]
          Length = 230

 Score = 64.9 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 22/45 (48%), Positives = 30/45 (66%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
              +AG +I+LIDD+YTTG T + AA+ L +AGA  V  LT  R+
Sbjct: 186 RPPLAGKRIVLIDDIYTTGITIRHAALVLLEAGAAEVWALTLVRA 230


>gi|149197780|ref|ZP_01874829.1| predicted amidophosphoribosyltransferase [Lentisphaera araneosa
           HTCC2155]
 gi|149139001|gb|EDM27405.1| predicted amidophosphoribosyltransferase [Lentisphaera araneosa
           HTCC2155]
          Length = 227

 Score = 64.9 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +++ F         +    ILLIDD+ TTGAT      AL++     +S+LT +R
Sbjct: 174 VKDLF--SPKNRDKIKDRSILLIDDILTTGATLNACCKALQQEKPKEISVLTIAR 226


>gi|300113674|ref|YP_003760249.1| competence protein F [Nitrosococcus watsonii C-113]
 gi|299539611|gb|ADJ27928.1| competence protein F [Nitrosococcus watsonii C-113]
          Length = 237

 Score = 64.9 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +   ++       + ++DDV TTG T       L++ GA  V + T +R L 
Sbjct: 183 LRGAFALNNTLTA----RHVAIMDDVLTTGHTVAELTKTLRRGGAQMVEVWTCARVLP 236


>gi|212702061|ref|ZP_03310189.1| hypothetical protein DESPIG_00063 [Desulfovibrio piger ATCC 29098]
 gi|212674576|gb|EEB35059.1| hypothetical protein DESPIG_00063 [Desulfovibrio piger ATCC 29098]
          Length = 186

 Score = 64.9 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 5/56 (8%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            +F      +  V GL + L+DD+ TTG+T + A   L +AGA  V +L  +R+ +
Sbjct: 135 GSFR-----AADVRGLHLWLVDDIITTGSTLRAAGAELLRAGAARVDVLALARTPR 185


>gi|300742495|ref|ZP_07072516.1| hypoxanthine phosphoribosyltransferase [Rothia dentocariosa M567]
 gi|311112390|ref|YP_003983612.1| hypoxanthine phosphoribosyltransferase [Rothia dentocariosa ATCC
           17931]
 gi|300381680|gb|EFJ78242.1| hypoxanthine phosphoribosyltransferase [Rothia dentocariosa M567]
 gi|310943884|gb|ADP40178.1| hypoxanthine phosphoribosyltransferase [Rothia dentocariosa ATCC
           17931]
          Length = 183

 Score = 64.9 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 14/56 (25%), Positives = 25/56 (44%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
               + + +   + G  +L+++D+  +G T       LK  GA +V I T  R  K
Sbjct: 82  GVVRILKDLDTDLTGRNVLIVEDIIDSGLTLAWLQQNLKSRGAESVEICTLLRKPK 137


>gi|307824520|ref|ZP_07654745.1| phosphoribosyltransferase [Methylobacter tundripaludum SV96]
 gi|307734504|gb|EFO05356.1| phosphoribosyltransferase [Methylobacter tundripaludum SV96]
          Length = 235

 Score = 64.9 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF++   +        I ++DDV TTG+T    A  LKKAGA  V +   +R+
Sbjct: 184 LKNAFSIINPIHA----RHIAILDDVMTTGSTTHELAYLLKKAGASRVDVWVCARA 235


>gi|260220118|emb|CBA27337.1| hypothetical protein Csp_A01770 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 253

 Score = 64.9 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 35/56 (62%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R+AF +       V+  +I+L+DDV T+GA+   AA  L+ AGA  ++ L F+R+
Sbjct: 191 VRHAFAMEPLRQGAVSDKRIVLLDDVMTSGASMSAAATTLRHAGAAHITALVFART 246


>gi|56421681|ref|YP_148999.1| late competence protein [Geobacillus kaustophilus HTA426]
 gi|56381523|dbj|BAD77431.1| late competence protein [Geobacillus kaustophilus HTA426]
          Length = 230

 Score = 64.9 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 21/45 (46%), Positives = 28/45 (62%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
              + G +I+LIDD+YTTG T + AA  L +AGA  V  LT  R+
Sbjct: 186 HPPLDGKRIVLIDDIYTTGITIRHAARVLLEAGAAEVWALTLVRA 230


>gi|255325402|ref|ZP_05366506.1| ribose-Phosphate pyrophosphokinase [Corynebacterium
           tuberculostearicum SK141]
 gi|311740784|ref|ZP_07714611.1| phosphoribosyl pyrophosphate synthetase [Corynebacterium
           pseudogenitalium ATCC 33035]
 gi|255297488|gb|EET76801.1| ribose-Phosphate pyrophosphokinase [Corynebacterium
           tuberculostearicum SK141]
 gi|311304304|gb|EFQ80380.1| phosphoribosyl pyrophosphate synthetase [Corynebacterium
           pseudogenitalium ATCC 33035]
          Length = 324

 Score = 64.9 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 22/54 (40%)

Query: 6   NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            V   V   V G   +L+DD+  TG T   A   LK AGA  V I        D
Sbjct: 212 TVSNRVVGDVEGKDCVLLDDMIDTGGTIAGAVRVLKDAGAKKVIIACTHGVFSD 265


>gi|311745081|ref|ZP_07718866.1| competence protein F-related protein [Algoriphagus sp. PR1]
 gi|126577594|gb|EAZ81814.1| competence protein F-related protein [Algoriphagus sp. PR1]
          Length = 230

 Score = 64.9 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +   F +     + V+GL++LL+DDV TTGAT    A  L   GA  V ++T +
Sbjct: 176 VEGVFELKPG--QSVSGLRVLLVDDVMTTGATLCACANVLLANGAKMVDLVTIA 227


>gi|227501530|ref|ZP_03931579.1| ribose-phosphate pyrophosphokinase [Corynebacterium accolens ATCC
           49725]
 gi|306835691|ref|ZP_07468697.1| phosphoribosyl pyrophosphate synthetase [Corynebacterium accolens
           ATCC 49726]
 gi|227077555|gb|EEI15518.1| ribose-phosphate pyrophosphokinase [Corynebacterium accolens ATCC
           49725]
 gi|304568409|gb|EFM43968.1| phosphoribosyl pyrophosphate synthetase [Corynebacterium accolens
           ATCC 49726]
          Length = 324

 Score = 64.9 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 23/54 (42%)

Query: 6   NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            V   V   V G   +L+DD+  TG T   A   LK+AGA  V I        D
Sbjct: 212 TVSNRVVGEVEGKDCVLLDDMIDTGGTIAGAVRVLKEAGAKKVIIACTHGVFSD 265


>gi|260424718|ref|ZP_05733052.2| ComF family protein [Dialister invisus DSM 15470]
 gi|260402941|gb|EEW96488.1| ComF family protein [Dialister invisus DSM 15470]
          Length = 149

 Score = 64.5 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 33/54 (61%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           MR  F+V +     V G KILL DD+YTTGAT + AA  L +AGA  V  +T +
Sbjct: 94  MRGVFHVNKG--TSVKGKKILLADDIYTTGATMESAAHELMRAGAEKVVGITIA 145


>gi|307611175|emb|CBX00819.1| hypothetical protein LPW_25231 [Legionella pneumophila 130b]
          Length = 234

 Score = 64.5 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 5/57 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R+AF VP      V    ++++DD+ TTG+TA   A  LK AG   V I   +R++
Sbjct: 180 LRHAFYVPP-----VTYEHVMIVDDLLTTGSTANEMAHTLKNAGVKRVDICCCARAV 231


>gi|291521618|emb|CBK79911.1| hypoxanthine phosphoribosyltransferase [Coprococcus catus GD/7]
          Length = 175

 Score = 64.5 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 10/51 (19%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
            A  + + + + + G  +L+++D+  +G T       L K    ++ I T 
Sbjct: 76  GAVRIVKDLDEPLEGKDVLIVEDIIDSGNTLHYLVEILYKRKPNSIKICTL 126


>gi|259418155|ref|ZP_05742074.1| competence protein F [Silicibacter sp. TrichCH4B]
 gi|259347061|gb|EEW58875.1| competence protein F [Silicibacter sp. TrichCH4B]
          Length = 243

 Score = 64.5 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 32/57 (56%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           + +A      +S+ + G ++LL+DDV T+G+T    A A   AGA  VS++  +R  
Sbjct: 185 LADAIRPNPRMSERLTGRQVLLVDDVMTSGSTLSACARACIDAGADGVSVVVLARVT 241


>gi|298242607|ref|ZP_06966414.1| amidophosphoribosyltransferase [Ktedonobacter racemifer DSM 44963]
 gi|297555661|gb|EFH89525.1| amidophosphoribosyltransferase [Ktedonobacter racemifer DSM 44963]
          Length = 194

 Score = 64.5 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 25/57 (43%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 1   MRNAF-NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           M  AF  V    +  VA  KIL+IDDV TTGAT    A  L  AGA +V+ L  + +
Sbjct: 134 MMGAFLYVSTAATPGVANRKILIIDDVCTTGATLDACARPLFAAGARSVTGLVLASA 190


>gi|269797854|ref|YP_003311754.1| amidophosphoribosyltransferase-like protein [Veillonella parvula
           DSM 2008]
 gi|269094483|gb|ACZ24474.1| amidophosphoribosyltransferase-like protein [Veillonella parvula
           DSM 2008]
          Length = 231

 Score = 64.5 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 1   MRNAFNVPQYVSK-HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           + +AF +        +    IL++DD+YTTGAT +  A  L+K  A+ V  LT +
Sbjct: 173 IDDAFVIRADYKDIDLTNKNILIVDDIYTTGATIEAVAKVLQKHNALRVDALTLA 227


>gi|311743364|ref|ZP_07717171.1| hypoxanthine phosphoribosyltransferase [Aeromicrobium marinum DSM
           15272]
 gi|311313432|gb|EFQ83342.1| hypoxanthine phosphoribosyltransferase [Aeromicrobium marinum DSM
           15272]
          Length = 185

 Score = 64.5 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 13/53 (24%), Positives = 24/53 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + +   +AG  +L+++D+  TG T       L+  G  +V I T  R
Sbjct: 84  GVVRILKDLDTDIAGRDVLIVEDIIDTGLTLSWLVANLRSRGPASVEIATLLR 136


>gi|117618528|ref|YP_854828.1| comF family protein [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
 gi|117559935|gb|ABK36883.1| comF family protein [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
          Length = 242

 Score = 64.5 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 5/58 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +  +     A   + L+DDV TTGATA      L ++G   V +    R+LK
Sbjct: 187 LRGAFQIRPH-----AYQHVALLDDVVTTGATAGHLTRLLHESGVTKVEVWAVCRTLK 239


>gi|261250553|ref|ZP_05943128.1| predicted amidophosphoribosyltransferase [Vibrio orientalis CIP
           102891]
 gi|260939122|gb|EEX95109.1| predicted amidophosphoribosyltransferase [Vibrio orientalis CIP
           102891]
          Length = 232

 Score = 64.5 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 14/56 (25%), Positives = 27/56 (48%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  AF +   + +  +   + ++DDV TTG+T +     L  +G  +V I    R+
Sbjct: 175 LNGAFRL---LKEENSYRHVAIVDDVVTTGSTVQHLCKLLLDSGVKSVDIYCICRT 227


>gi|114332104|ref|YP_748326.1| hypothetical protein Neut_2139 [Nitrosomonas eutropha C91]
 gi|114309118|gb|ABI60361.1| conserved hypothetical protein [Nitrosomonas eutropha C91]
          Length = 236

 Score = 64.5 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +RNAF   Q+     +G ++ ++DDV T+GAT    A  + + GA +V     +R+  
Sbjct: 182 VRNAFICTQH----FSGKQVAIVDDVMTSGATLNELARVILRQGAGSVRAWVVARAFP 235


>gi|118581139|ref|YP_902389.1| competence protein F [Pelobacter propionicus DSM 2379]
 gi|118503849|gb|ABL00332.1| competence protein F, putative [Pelobacter propionicus DSM 2379]
          Length = 245

 Score = 64.5 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R+AF V       V+G ++LL+DDV+TTG+T +  +  L +AG   + ++T SR 
Sbjct: 190 VRDAFRVKNA--SLVSGKRVLLVDDVFTTGSTVEECSRILMQAGTGELLVVTVSRV 243


>gi|27364311|ref|NP_759839.1| putative amidophosphoribosyltransferase [Vibrio vulnificus CMCP6]
 gi|27360429|gb|AAO09366.1| Predicted amidophosphoribosyltransferase [Vibrio vulnificus CMCP6]
          Length = 212

 Score = 64.5 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 14/56 (25%), Positives = 25/56 (44%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  AF + +    H     + ++DDV TTG+T +     L   G  ++ I    R+
Sbjct: 153 LAGAFRLNRSALPHAIPKHVAIVDDVVTTGSTVRQLCQLLLAVGVESIDIYCLCRT 208


>gi|37678412|ref|NP_933021.1| amidophosphoribosyltransferase [Vibrio vulnificus YJ016]
 gi|37197151|dbj|BAC92992.1| predicted amidophosphoribosyltransferase [Vibrio vulnificus YJ016]
          Length = 268

 Score = 64.5 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 14/56 (25%), Positives = 25/56 (44%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  AF + +    H     + ++DDV TTG+T +     L   G  ++ I    R+
Sbjct: 209 LAGAFRLNRSALPHAIPKHVAIVDDVVTTGSTVRQLCQLLLAVGVESIDIYCLCRT 264


>gi|329122311|ref|ZP_08250899.1| competence protein F [Haemophilus aegyptius ATCC 11116]
 gi|327473872|gb|EGF19289.1| competence protein F [Haemophilus aegyptius ATCC 11116]
          Length = 228

 Score = 64.1 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF++   +       +I L+DDV TTG+T    +  L+K G   + +   +R+
Sbjct: 174 LKNAFSLA-VLKNEFPYRRIALVDDVITTGSTLNEISKLLRKLGVEEIQVWGLARA 228


>gi|301169134|emb|CBW28731.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Haemophilus influenzae 10810]
          Length = 228

 Score = 64.1 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF++   +       +I L+DDV TTG+T    +  L+K G   + +   +R+
Sbjct: 174 LKNAFSLA-VLKNEFPYRRIALVDDVITTGSTLNEISKLLRKLGVEEIQVWGLARA 228


>gi|229846520|ref|ZP_04466628.1| recombination protein RecR [Haemophilus influenzae 7P49H1]
 gi|229810613|gb|EEP46331.1| recombination protein RecR [Haemophilus influenzae 7P49H1]
          Length = 228

 Score = 64.1 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF++   +       +I L+DDV TTG+T    +  L+K G   + +   +R+
Sbjct: 174 LKNAFSLA-VLKNEFPYRRIALVDDVITTGSTLNEISKLLRKLGVEEIQVWGLARA 228


>gi|145640399|ref|ZP_01795983.1| competence protein F [Haemophilus influenzae R3021]
 gi|145274985|gb|EDK14847.1| competence protein F [Haemophilus influenzae 22.4-21]
          Length = 228

 Score = 64.1 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF++   +       +I L+DDV TTG+T    +  L+K G   + +   +R+
Sbjct: 174 LKNAFSLA-VLKNEFPYRRIALVDDVITTGSTLNEISKLLRKLGVEEIQVWGLARA 228


>gi|145630390|ref|ZP_01786171.1| recombination protein RecR [Haemophilus influenzae R3021]
 gi|144984125|gb|EDJ91562.1| recombination protein RecR [Haemophilus influenzae R3021]
          Length = 228

 Score = 64.1 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF++   +       +I L+DDV TTG+T    +  L+K G   + +   +R+
Sbjct: 174 LKNAFSLA-VLKNEFPYRRIALVDDVITTGSTLNEISKLLRKLGVEEIQVWGLARA 228


>gi|86134891|ref|ZP_01053473.1| ribose-phosphate pyrophosphokinase [Polaribacter sp. MED152]
 gi|85821754|gb|EAQ42901.1| ribose-phosphate pyrophosphokinase [Polaribacter sp. MED152]
          Length = 313

 Score = 64.1 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 25/49 (51%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            +   V G  ++L+DD+  TG T   AA  +K+ GA++V  +     L 
Sbjct: 207 ELIGDVKGKNVILVDDMIDTGGTLAHAANLMKERGALSVRAICTHPILS 255


>gi|309972409|gb|ADO95610.1| Competence protein F [Haemophilus influenzae R2846]
          Length = 228

 Score = 64.1 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF++   +       +I L+DDV TTG+T    +  L+K G   + +   +R+
Sbjct: 174 LKNAFSLA-VLKNEFPYRRIALVDDVITTGSTLNEISKLLRKLGVEEIQVWGLARA 228


>gi|261403930|ref|YP_003240171.1| hypoxanthine phosphoribosyltransferase [Paenibacillus sp. Y412MC10]
 gi|261280393|gb|ACX62364.1| hypoxanthine phosphoribosyltransferase [Paenibacillus sp. Y412MC10]
          Length = 179

 Score = 64.1 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V G  +L+++D+  +G T       LK   A +V ++T 
Sbjct: 77  GVVKIIKDLDASVEGRDVLIVEDIIDSGLTLSHLIELLKSRKANSVRVVTL 127


>gi|145219107|ref|YP_001129816.1| phosphoribosyltransferase [Prosthecochloris vibrioformis DSM 265]
 gi|145205271|gb|ABP36314.1| phosphoribosyltransferase [Chlorobium phaeovibrioides DSM 265]
          Length = 230

 Score = 64.1 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 34/59 (57%), Gaps = 4/59 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF         V G+ +LL+DDV TTG+T   A+ AL  AGA  +S+ + + +LK+
Sbjct: 176 LEGAFK----AVGDVGGMHVLLVDDVVTTGSTMAAASKALLGAGAARISLASVALALKE 230


>gi|259047953|ref|ZP_05738354.1| hypoxanthine phosphoribosyltransferase [Granulicatella adiacens
           ATCC 49175]
 gi|259035373|gb|EEW36628.1| hypoxanthine phosphoribosyltransferase [Granulicatella adiacens
           ATCC 49175]
          Length = 180

 Score = 64.1 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + + + V    +++++D+  TG T K     LK   A +V ++T 
Sbjct: 78  GEVRILKDLGQSVKDRHVIIVEDIIDTGRTLKHVVELLKHRQAASVKVVTL 128


>gi|238897768|ref|YP_002923447.1| putative periplasmic gluconate-binding protein in GNT I transport
           system [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229465525|gb|ACQ67299.1| putative periplasmic gluconate-binding protein in GNT I transport
           system [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 231

 Score = 64.1 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF         + G  + L+DDV TTG+T    +  L K G  ++ IL   R+L 
Sbjct: 175 LRGAFQ----SHLSLKGQSVALVDDVVTTGSTINEISELLIKEGVASLQILCICRTLS 228


>gi|21241163|ref|NP_640745.1| competence protein F [Xanthomonas axonopodis pv. citri str. 306]
 gi|21106468|gb|AAM35281.1| competence protein F [Xanthomonas axonopodis pv. citri str. 306]
          Length = 243

 Score = 64.1 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 29/56 (51%), Gaps = 5/56 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R+AF V   +        + L+DDV TTGAT   AA AL+KAG   V     +R 
Sbjct: 192 LRDAFEVRGALPA-----HVALVDDVMTTGATLHAAAKALRKAGVQRVDAWVCARV 242


>gi|301155451|emb|CBW14917.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system
           [Haemophilus parainfluenzae T3T1]
          Length = 229

 Score = 64.1 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF V           ++ L+DDV TTG+T    A  L+K G   + +   +R+
Sbjct: 176 LKNAFAVNTQKPFPYE--RVALVDDVITTGSTLAEIAKQLRKLGVKEIQVWGLARA 229


>gi|260913510|ref|ZP_05919988.1| competence protein F [Pasteurella dagmatis ATCC 43325]
 gi|260632450|gb|EEX50623.1| competence protein F [Pasteurella dagmatis ATCC 43325]
          Length = 188

 Score = 64.1 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 1/56 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R+AF +            + LIDDV TTG+T    A  L+KAG   + +   +R+
Sbjct: 134 LRHAFQLS-DKQSKCRYQSVALIDDVITTGSTLNEIAKLLRKAGIQHIQVWGLART 188


>gi|125623816|ref|YP_001032299.1| amidophosphoribosyltransferase [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|4097534|gb|AAD12627.1| phosphoribosylpyrophosphate amidotransferase [Lactococcus lactis]
 gi|124492624|emb|CAL97569.1| amidophosphoribosyltransferase [Lactococcus lactis subsp. cremoris
           MG1363]
          Length = 506

 Score = 64.1 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 25/49 (51%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            V   V G +++++DD    G T++     LK AGA  V +   S +LK
Sbjct: 377 AVRGVVEGKRVIMVDDSIVRGTTSRRIVKLLKDAGAAEVHVAIASPALK 425


>gi|77361761|ref|YP_341336.1| hypothetical protein PSHAa2858 [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76876672|emb|CAI87894.1| conserved protein of unknown function [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 225

 Score = 64.1 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +++AF         ++G  + ++DD+ TTGAT   A  ALK+AGA  V   T   +
Sbjct: 172 LKDAFICT----ADMSGKTVAIVDDIMTTGATLNAATQALKQAGAKQVWAFTTCLT 223


>gi|227504121|ref|ZP_03934170.1| ribose-phosphate pyrophosphokinase [Corynebacterium striatum ATCC
           6940]
 gi|227199288|gb|EEI79336.1| ribose-phosphate pyrophosphokinase [Corynebacterium striatum ATCC
           6940]
          Length = 324

 Score = 64.1 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 24/54 (44%)

Query: 6   NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            V   V   V G   +L+DD+  TG T   A   LK+AGA +V I        +
Sbjct: 212 TVSNRVVGEVEGKDCILLDDMIDTGGTIAGAVRVLKEAGAKSVVIACTHGVFSN 265


>gi|332186893|ref|ZP_08388635.1| hypothetical protein SUS17_1939 [Sphingomonas sp. S17]
 gi|332013226|gb|EGI55289.1| hypothetical protein SUS17_1939 [Sphingomonas sp. S17]
          Length = 216

 Score = 64.1 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 35/54 (64%), Gaps = 2/54 (3%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           AF V     + V G  I+L+DDVYTTGATA     AL +AGA +V+IL ++R +
Sbjct: 157 AFRVHD--REAVVGRHIVLVDDVYTTGATAGACVRALLRAGAASVAILCWARVI 208


>gi|188591075|ref|YP_001795675.1| amidophosphoribosyltransferase, comf/gntx family [Cupriavidus
           taiwanensis LMG 19424]
 gi|170937969|emb|CAP62953.1| putative amidophosphoribosyltransferase, comF/gntX family
           [Cupriavidus taiwanensis LMG 19424]
          Length = 285

 Score = 64.1 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF + + +     GL + L+DDV T+GAT   AA  LK  GA  VS++   R+
Sbjct: 231 LQGAFALTRAMRLD--GLHVALVDDVMTSGATLHEAAAVLKARGASRVSVIVALRT 284


>gi|118443133|ref|YP_877129.1| hypoxanthine phosphoribosyltransferase [Clostridium novyi NT]
 gi|118133589|gb|ABK60633.1| hypoxanthine phosphoribosyltransferase [Clostridium novyi NT]
          Length = 179

 Score = 64.1 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 21/51 (41%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V G  IL+++D+  TG T +     LK     +V +   
Sbjct: 77  GVVRILKDLEFEVEGKDILIVEDIVDTGTTLEYLKRYLKAKKPNSVEVACL 127


>gi|313894680|ref|ZP_07828243.1| hypoxanthine phosphoribosyltransferase [Veillonella sp. oral taxon
           158 str. F0412]
 gi|313440870|gb|EFR59299.1| hypoxanthine phosphoribosyltransferase [Veillonella sp. oral taxon
           158 str. F0412]
          Length = 181

 Score = 64.1 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + + + V G  +L+++D+  TG T       L   GA +V +   
Sbjct: 79  GVVRILKDLDRSVEGKHVLVVEDIVDTGTTLHYLLENLHARGAKSVRLAAL 129


>gi|196249411|ref|ZP_03148109.1| phosphoribosyltransferase [Geobacillus sp. G11MC16]
 gi|196211168|gb|EDY05929.1| phosphoribosyltransferase [Geobacillus sp. G11MC16]
          Length = 230

 Score = 64.1 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 21/44 (47%), Positives = 29/44 (65%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
             + G +I+LIDD+YTTG T + AA  L++AGA  V  LT  R+
Sbjct: 187 PPLTGKRIVLIDDIYTTGITVRHAARVLREAGATEVGSLTLVRA 230


>gi|138896708|ref|YP_001127161.1| competence protein F [Geobacillus thermodenitrificans NG80-2]
 gi|134268221|gb|ABO68416.1| Competence protein F [Geobacillus thermodenitrificans NG80-2]
          Length = 230

 Score = 64.1 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 21/44 (47%), Positives = 29/44 (65%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
             + G +I+LIDD+YTTG T + AA  L++AGA  V  LT  R+
Sbjct: 187 PPLTGKRIVLIDDIYTTGITVRHAARVLREAGATEVGSLTLVRA 230


>gi|326406996|gb|ADZ64067.1| amidophosphoribosyltransferase [Lactococcus lactis subsp. lactis
           CV56]
          Length = 499

 Score = 64.1 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 25/49 (51%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            V   V G +++++DD    G T++     LK AGA  V +   S +LK
Sbjct: 370 AVRGVVEGKRVIMVDDSIVRGTTSRRIVKLLKDAGAAEVHVAIASPALK 418


>gi|300070585|gb|ADJ59985.1| amidophosphoribosyltransferase [Lactococcus lactis subsp. cremoris
           NZ9000]
          Length = 502

 Score = 64.1 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 25/49 (51%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            V   V G +++++DD    G T++     LK AGA  V +   S +LK
Sbjct: 373 AVRGVVEGKRVIMVDDSIVRGTTSRRIVKLLKDAGAAEVHVAIASPALK 421


>gi|329925528|ref|ZP_08280402.1| hypoxanthine phosphoribosyltransferase [Paenibacillus sp. HGF5]
 gi|328939811|gb|EGG36151.1| hypoxanthine phosphoribosyltransferase [Paenibacillus sp. HGF5]
          Length = 179

 Score = 64.1 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V G  +L+++D+  +G T       LK   A +V ++T 
Sbjct: 77  GVVKIIKDLDASVEGRDVLIVEDIIDSGLTLSHLIELLKSRKANSVRVVTL 127


>gi|239629121|ref|ZP_04672152.1| hypoxanthine phosphoribosyltransferase [Clostridiales bacterium
           1_7_47_FAA]
 gi|239519267|gb|EEQ59133.1| hypoxanthine phosphoribosyltransferase [Clostridiales bacterium
           1_7_47FAA]
          Length = 185

 Score = 64.1 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 10/51 (19%), Positives = 25/51 (49%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + + + +AG  +L+++D+  +G T       LK+ G  ++ + T 
Sbjct: 84  GVVRILKDLDEPLAGKDVLIVEDIIDSGRTLAYLIEVLKQRGPKSIRLCTL 134


>gi|116512322|ref|YP_809538.1| amidophosphoribosyltransferase [Lactococcus lactis subsp. cremoris
           SK11]
 gi|116107976|gb|ABJ73116.1| amidophosphoribosyltransferase [Lactococcus lactis subsp. cremoris
           SK11]
          Length = 506

 Score = 64.1 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 25/49 (51%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            V   V G +++++DD    G T++     LK AGA  V +   S +LK
Sbjct: 377 AVRGVVEGKRVIMVDDSIVRGTTSRRIVKLLKDAGAAEVHVAIASPALK 425


>gi|281492092|ref|YP_003354072.1| amidophosphoribosyltransferase [Lactococcus lactis subsp. lactis
           KF147]
 gi|281375775|gb|ADA65272.1| Amidophosphoribosyltransferase [Lactococcus lactis subsp. lactis
           KF147]
          Length = 499

 Score = 64.1 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 25/49 (51%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            V   V G +++++DD    G T++     LK AGA  V +   S +LK
Sbjct: 370 AVRGVVEGKRVIMVDDSIVRGTTSRRIVKLLKDAGAAEVHVAIASPALK 418


>gi|315651636|ref|ZP_07904647.1| competence protein F [Eubacterium saburreum DSM 3986]
 gi|315486090|gb|EFU76461.1| competence protein F [Eubacterium saburreum DSM 3986]
          Length = 247

 Score = 64.1 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 31/54 (57%), Gaps = 3/54 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           + NAF V +  SK V    +L++DDVYTTG T +  A  LK AGA  V  LT  
Sbjct: 192 LDNAF-VVKGFSKEV--KNVLIVDDVYTTGTTIEKCAKILKDAGANEVYFLTIC 242


>gi|282850014|ref|ZP_06259396.1| hypoxanthine phosphoribosyltransferase [Veillonella parvula ATCC
           17745]
 gi|282580203|gb|EFB85604.1| hypoxanthine phosphoribosyltransferase [Veillonella parvula ATCC
           17745]
          Length = 181

 Score = 64.1 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + + + V G  +L+++D+  TG T       L   GA +V +   
Sbjct: 79  GVVRILKDLDRSVEGKHVLVVEDIVDTGTTLHYLLENLHARGAKSVRLAAL 129


>gi|269797566|ref|YP_003311466.1| hypoxanthine phosphoribosyltransferase [Veillonella parvula DSM
           2008]
 gi|269094195|gb|ACZ24186.1| hypoxanthine phosphoribosyltransferase [Veillonella parvula DSM
           2008]
          Length = 181

 Score = 64.1 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + + + V G  +L+++D+  TG T       L   GA +V +   
Sbjct: 79  GVVRILKDLDRSVEGKHVLVVEDIVDTGTTLHYLLENLHARGAKSVRLAAL 129


>gi|296107921|ref|YP_003619622.1| competence protein ComF [Legionella pneumophila 2300/99 Alcoy]
 gi|295649823|gb|ADG25670.1| competence protein ComF [Legionella pneumophila 2300/99 Alcoy]
          Length = 234

 Score = 64.1 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 5/57 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R+AF V       V    ++++DD+ TTG+TA   A  LK AG   V I   +R++
Sbjct: 180 LRHAFYVSP-----VTYEHVMIVDDLLTTGSTANEMAHTLKNAGVKRVDICCCARAV 231


>gi|15673510|ref|NP_267684.1| amidophosphoribosyltransferase [Lactococcus lactis subsp. lactis
           Il1403]
 gi|12724528|gb|AAK05626.1|AE006384_1 phosphoribosylpyrophosphate amidotransferase [Lactococcus lactis
           subsp. lactis Il1403]
          Length = 499

 Score = 64.1 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 25/49 (51%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            V   V G +++++DD    G T++     LK AGA  V +   S +LK
Sbjct: 370 AVRGVVEGKRVIMVDDSIVRGTTSRRIVKLLKDAGAAEVHVAIASPALK 418


>gi|315650240|ref|ZP_07903313.1| hypoxanthine phosphoribosyltransferase [Eubacterium saburreum DSM
           3986]
 gi|315487485|gb|EFU77794.1| hypoxanthine phosphoribosyltransferase [Eubacterium saburreum DSM
           3986]
          Length = 176

 Score = 64.1 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 10/51 (19%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   + G  +L+++D+  +G T       LKK G  ++ + T 
Sbjct: 76  GVVKIIKDLDDSIDGKNVLVVEDIIDSGNTLSYLIDILKKRGPKSIKLCTL 126


>gi|283458611|ref|YP_003363245.1| phosphoribosylpyrophosphate synthetase [Rothia mucilaginosa DY-18]
 gi|283134660|dbj|BAI65425.1| phosphoribosylpyrophosphate synthetase [Rothia mucilaginosa DY-18]
          Length = 326

 Score = 64.1 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 23/54 (42%)

Query: 6   NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            V + V  +V G   +LIDD+  TG T   A   L   GA  V I      L D
Sbjct: 214 AVSKTVVGNVEGRTCVLIDDMIDTGGTIAGAVKVLMDKGAKEVIIAATHPVLSD 267


>gi|148359871|ref|YP_001251078.1| competence protein ComF [Legionella pneumophila str. Corby]
 gi|148281644|gb|ABQ55732.1| competence protein ComF [Legionella pneumophila str. Corby]
          Length = 196

 Score = 64.1 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 5/57 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R+AF V       V    ++++DD+ TTG+TA   A  LK AG   V I   +R++
Sbjct: 142 LRHAFYVSP-----VTYEHVMIVDDLLTTGSTANEMAHTLKNAGVKRVDICCCARAV 193


>gi|319898045|ref|YP_004136242.1| competence protein f [Haemophilus influenzae F3031]
 gi|317433551|emb|CBY81935.1| competence protein F [Haemophilus influenzae F3031]
          Length = 228

 Score = 64.1 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 1/56 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF++           ++ L+DDV TTG+T    +  L+K G   + +   +R+
Sbjct: 174 LKNAFSLAVS-KNEFPYRRVALVDDVITTGSTLNEISKLLRKLGVEEIQVWGLARA 228


>gi|260582301|ref|ZP_05850094.1| recombination protein RecR [Haemophilus influenzae NT127]
 gi|260094669|gb|EEW78564.1| recombination protein RecR [Haemophilus influenzae NT127]
          Length = 228

 Score = 64.1 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 1/56 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF++           ++ L+DDV TTG+T    +  L+K G   + +   +R+
Sbjct: 174 LKNAFSLAVS-KNEFPYRRVALVDDVITTGSTLNEISKLLRKLGVEEIQVWGLARA 228


>gi|238019646|ref|ZP_04600072.1| hypothetical protein VEIDISOL_01520 [Veillonella dispar ATCC 17748]
 gi|237863687|gb|EEP64977.1| hypothetical protein VEIDISOL_01520 [Veillonella dispar ATCC 17748]
          Length = 181

 Score = 64.1 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + + + V G  +L+++D+  TG T       L   GA +V +   
Sbjct: 79  GVVRILKDLDRSVEGKHVLVVEDIVDTGTTLHYLLENLHARGAKSVRLAAL 129


>gi|229844406|ref|ZP_04464546.1| recombination protein RecR [Haemophilus influenzae 6P18H1]
 gi|229812655|gb|EEP48344.1| recombination protein RecR [Haemophilus influenzae 6P18H1]
          Length = 228

 Score = 64.1 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 1/56 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF++           ++ L+DDV TTG+T    +  L+K G   + +   +R+
Sbjct: 174 LKNAFSLAVS-KNEFPYRRVALVDDVITTGSTLNEISKLLRKLGVEEIQVWGLARA 228


>gi|145632679|ref|ZP_01788413.1| competence protein F [Haemophilus influenzae 3655]
 gi|145634569|ref|ZP_01790278.1| recombination protein RecR [Haemophilus influenzae PittAA]
 gi|144986874|gb|EDJ93426.1| competence protein F [Haemophilus influenzae 3655]
 gi|145268114|gb|EDK08109.1| recombination protein RecR [Haemophilus influenzae PittAA]
          Length = 228

 Score = 64.1 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 1/56 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF++           ++ L+DDV TTG+T    +  L+K G   + +   +R+
Sbjct: 174 LKNAFSLAVS-KNEFPYRRVALVDDVITTGSTLNEISKLLRKLGVEEIQVWGLARA 228


>gi|16272382|ref|NP_438595.1| competence protein F [Haemophilus influenzae Rd KW20]
 gi|260580503|ref|ZP_05848331.1| competence protein F [Haemophilus influenzae RdAW]
 gi|401671|sp|P31773|COMF_HAEIN RecName: Full=Competence protein F; AltName: Full=DNA
           transformation protein ComF; AltName: Full=Protein
           COM101A
 gi|148876|gb|AAA24949.1| probable com101A gene [Haemophilus influenzae]
 gi|148999|gb|AAA25014.1| A Haemophilus strain carrying an insertion in ORF F is deficient in
           transformation, but is still able to bind and take up
           DNA. The predicted molecular weight and pI of ORF F are
           26.8 Kd and 10.6; ORF F; putative [Haemophilus
           influenzae]
 gi|1573409|gb|AAC22093.1| competence protein F (comF) [Haemophilus influenzae Rd KW20]
 gi|260092845|gb|EEW76780.1| competence protein F [Haemophilus influenzae RdAW]
          Length = 229

 Score = 64.1 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 1/56 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF++           ++ L+DDV TTG+T    +  L+K G   + +   +R+
Sbjct: 175 LKNAFSLAVS-KNEFPYRRVALVDDVITTGSTLNEISKLLRKLGVEEIQVWGLARA 229


>gi|145628804|ref|ZP_01784604.1| competence protein F [Haemophilus influenzae 22.1-21]
 gi|145638656|ref|ZP_01794265.1| hypothetical protein CGSHiII_08076 [Haemophilus influenzae PittII]
 gi|144979274|gb|EDJ88960.1| competence protein F [Haemophilus influenzae 22.1-21]
 gi|145272251|gb|EDK12159.1| hypothetical protein CGSHiII_08076 [Haemophilus influenzae PittII]
 gi|309750150|gb|ADO80134.1| Competence protein F [Haemophilus influenzae R2866]
          Length = 228

 Score = 64.1 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 1/56 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF++           ++ L+DDV TTG+T    +  L+K G   + +   +R+
Sbjct: 174 LKNAFSLAVS-KNEFPYRRVALVDDVITTGSTLNEISKLLRKLGVEEIQVWGLARA 228


>gi|315644386|ref|ZP_07897526.1| hypoxanthine phosphoribosyltransferase [Paenibacillus vortex V453]
 gi|315280263|gb|EFU43555.1| hypoxanthine phosphoribosyltransferase [Paenibacillus vortex V453]
          Length = 179

 Score = 64.1 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V G  +L+++D+  +G T       LK   A +V ++T 
Sbjct: 77  GVVKIIKDLDASVEGRDVLIVEDIIDSGLTLSHLIELLKSRKANSVCVVTL 127


>gi|114327260|ref|YP_744417.1| amidophosphoribosyltransferase family protein [Granulibacter
           bethesdensis CGDNIH1]
 gi|114315434|gb|ABI61494.1| amidophosphoribosyltransferase family protein [Granulibacter
           bethesdensis CGDNIH1]
          Length = 282

 Score = 64.1 bits (156), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 30/56 (53%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           MR A        + +   +I+++DDV T+GAT      AL  AGA +V +LT +R 
Sbjct: 211 MRGAIQTRAARRQKLRAARIVVVDDVMTSGATISACVRALYAAGAASVDVLTAARV 266


>gi|329666895|gb|AEB92843.1| hypoxanthine-guanine phosphoribosyltransferase [Lactobacillus
           johnsonii DPC 6026]
          Length = 178

 Score = 63.7 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 10/51 (19%), Positives = 25/51 (49%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + Q +   V    ++ ++D+  TG T +  +  +K+ GA +V +++ 
Sbjct: 76  GKVKITQDIKSDVKNRPVIFMEDIIDTGRTLQALSEIMKERGAKSVEVVSM 126


>gi|256419923|ref|YP_003120576.1| phosphoribosyltransferase [Chitinophaga pinensis DSM 2588]
 gi|256034831|gb|ACU58375.1| phosphoribosyltransferase [Chitinophaga pinensis DSM 2588]
          Length = 232

 Score = 63.7 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAM-TVSILTFSR 55
           + ++F++   ++  + G  +LLIDDV TTGAT +  +  L  AGA  ++  L F+R
Sbjct: 178 VSDSFSLQ--LNTDLKGKHLLLIDDVITTGATLEACSRLLISAGAAVSICALAFAR 231


>gi|296111496|ref|YP_003621878.1| late competence protein [Leuconostoc kimchii IMSNU 11154]
 gi|295833028|gb|ADG40909.1| late competence protein [Leuconostoc kimchii IMSNU 11154]
          Length = 223

 Score = 63.7 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 31/51 (60%), Gaps = 2/51 (3%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           F V ++V   + G +ILLIDDVYTTG T   AA  L + GA  V  L+ +R
Sbjct: 175 FTVKEHV--SLHGKQILLIDDVYTTGNTLFHAADLLYELGAKNVKSLSLAR 223


>gi|294667204|ref|ZP_06732425.1| competence protein [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
 gi|292602985|gb|EFF46415.1| competence protein [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
          Length = 241

 Score = 63.7 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 29/56 (51%), Gaps = 5/56 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R+AF V   +        + L+DDV TTGAT   AA AL+KAG   V     +R 
Sbjct: 190 LRDAFEVRGALPA-----HVALVDDVMTTGATLHAAAKALRKAGVQRVDAWVCARV 240


>gi|268612018|ref|ZP_06145745.1| competence protein [Ruminococcus flavefaciens FD-1]
          Length = 219

 Score = 63.7 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF V +    +V G  +LLIDDV TTG+T      AL K GA +V+     +++
Sbjct: 161 LKGAFTVTE----NVRGRNLLLIDDVCTTGSTFAEITAALLKNGAASVTCAACCKTV 213


>gi|294627596|ref|ZP_06706179.1| competence protein [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 11122]
 gi|292598227|gb|EFF42381.1| competence protein [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 11122]
          Length = 241

 Score = 63.7 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 29/56 (51%), Gaps = 5/56 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R+AF V   +        + L+DDV TTGAT   AA AL+KAG   V     +R 
Sbjct: 190 LRDAFEVRGALPA-----HVALVDDVMTTGATLHAAAKALRKAGVQRVDAWVCARV 240


>gi|284009155|emb|CBA76190.1| hypoxanthine phosphoribosyltransferase [Arsenophonus nasoniae]
          Length = 178

 Score = 63.7 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 12/49 (24%), Positives = 25/49 (51%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
             + + + + + G  +L+++D+  +G T K     LK  G  +V+I T 
Sbjct: 80  VKIIKDLDEDIRGKHVLIVEDIIDSGNTLKKVRKILKLRGPKSVAICTL 128


>gi|257066252|ref|YP_003152508.1| hypothetical protein Apre_0759 [Anaerococcus prevotii DSM 20548]
 gi|256798132|gb|ACV28787.1| conserved hypothetical protein [Anaerococcus prevotii DSM 20548]
          Length = 208

 Score = 63.7 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 22/54 (40%), Positives = 27/54 (50%), Gaps = 4/54 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +R AF + +     + G KILLIDD+ TTG TA      LK  GA  V  L   
Sbjct: 153 LRGAFRLDK----EIKGSKILLIDDLITTGNTALETIKELKNRGASEVVTLAIC 202


>gi|68249034|ref|YP_248146.1| competence protein F [Haemophilus influenzae 86-028NP]
 gi|148825286|ref|YP_001290039.1| competence protein F [Haemophilus influenzae PittEE]
 gi|319775639|ref|YP_004138127.1| competence protein F [Haemophilus influenzae F3047]
 gi|59939228|gb|AAX12386.1| ComF [Haemophilus influenzae]
 gi|68057233|gb|AAX87486.1| competence protein F [Haemophilus influenzae 86-028NP]
 gi|148715446|gb|ABQ97656.1| recombination protein RecR [Haemophilus influenzae PittEE]
 gi|317450230|emb|CBY86446.1| competence protein F [Haemophilus influenzae F3047]
          Length = 228

 Score = 63.7 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 1/56 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF++           ++ L+DDV TTG+T    +  L+K G   + +   +R+
Sbjct: 174 LKNAFSLVVS-KNEFPYRRVALVDDVITTGSTLNEISKLLRKLGVEEIQVWGLARA 228


>gi|254518516|ref|ZP_05130572.1| hypoxanthine-guanine phosphoribosyltransferase [Clostridium sp.
           7_2_43FAA]
 gi|226912265|gb|EEH97466.1| hypoxanthine-guanine phosphoribosyltransferase [Clostridium sp.
           7_2_43FAA]
          Length = 175

 Score = 63.7 bits (155), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               V   +  ++ G  +L++DD+  TG T +     +KK GA +V   T 
Sbjct: 77  GEVKVVNDIPDNIEGWDVLIVDDIIDTGYTMEFVVDYVKKRGANSVKTCTL 127


>gi|158321545|ref|YP_001514052.1| competence protein F, putative [Alkaliphilus oremlandii OhILAs]
 gi|158141744|gb|ABW20056.1| competence protein F, putative [Alkaliphilus oremlandii OhILAs]
          Length = 228

 Score = 63.7 bits (155), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           + +AF V       +    ILL+DD+ TTG+T    +  L   GA TV++LTF+R
Sbjct: 175 VTDAFKVLNN--GVIINKNILLVDDILTTGSTVNECSKILLNFGAKTVTVLTFAR 227


>gi|308066892|ref|YP_003868497.1| Hypoxanthine-guanine phosphoribosyltransferase (HGPRT)
           [Paenibacillus polymyxa E681]
 gi|305856171|gb|ADM67959.1| Hypoxanthine-guanine phosphoribosyltransferase (HGPRT)
           [Paenibacillus polymyxa E681]
          Length = 179

 Score = 63.7 bits (155), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V G  +L+++D+  +G T       LK   A +V ++T 
Sbjct: 77  GIIKIIKDLDASVEGRDVLIVEDIIDSGLTLTHLIELLKNRNANSVCVVTL 127


>gi|71418979|ref|XP_811028.1| phosphoribosylpyrophosphate synthetase [Trypanosoma cruzi strain CL
           Brener]
 gi|70875646|gb|EAN89177.1| phosphoribosylpyrophosphate synthetase, putative [Trypanosoma
           cruzi]
          Length = 390

 Score = 63.7 bits (155), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 22/49 (44%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +   V G   +++DD+  TG T   AA  L++ GA  V        L D
Sbjct: 228 LVGEVDGCDCIIVDDMIDTGGTLCKAAEVLRENGAKEVHAWATHGILTD 276


>gi|220933320|ref|YP_002512219.1| competence protein F [Thioalkalivibrio sp. HL-EbGR7]
 gi|219994630|gb|ACL71232.1| competence protein F [Thioalkalivibrio sp. HL-EbGR7]
          Length = 237

 Score = 63.7 bits (155), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF +            + +IDDV TTG+T    A  LK+AGA  V +   +R+
Sbjct: 186 VRAAFEIAAGTVPA----HVAIIDDVMTTGSTVGEIARQLKRAGAERVEVWVLARA 237


>gi|256544713|ref|ZP_05472085.1| hypoxanthine phosphoribosyltransferase [Anaerococcus vaginalis ATCC
           51170]
 gi|256399602|gb|EEU13207.1| hypoxanthine phosphoribosyltransferase [Anaerococcus vaginalis ATCC
           51170]
          Length = 183

 Score = 63.7 bits (155), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 26/51 (50%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   + G ++LL++D+  TG T      +L K GA +V I+T 
Sbjct: 82  GNVKIIKDLDTDITGKEVLLVEDIIDTGRTLDALKDSLIKRGANSVKIITL 132


>gi|325576566|ref|ZP_08147284.1| competence protein F [Haemophilus parainfluenzae ATCC 33392]
 gi|325161129|gb|EGC73244.1| competence protein F [Haemophilus parainfluenzae ATCC 33392]
          Length = 180

 Score = 63.7 bits (155), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF V           ++ L+DDV TTG+T    A  L+K G   + +   +R+
Sbjct: 127 LKNAFAVNTKKPFPYE--RVALVDDVITTGSTLAEIAKQLRKLGVKEIQVWGLARA 180


>gi|3868865|dbj|BAA34253.1| hypoxanthine-guanine phosphoribosyl-transferase [Clostridium
           histolyticum]
          Length = 175

 Score = 63.7 bits (155), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               V   V  ++ G  +L++DD+  TG T +     LK+ GA +V+    
Sbjct: 77  GTVKVVNDVPDNIEGFDVLIVDDIMDTGITMEFVVKHLKELGANSVNTCVL 127


>gi|322820786|gb|EFZ27302.1| phosphoribosylpyrophosphate synthetase, putative [Trypanosoma
           cruzi]
          Length = 390

 Score = 63.7 bits (155), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 22/49 (44%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +   V G   +++DD+  TG T   AA  L++ GA  V        L D
Sbjct: 228 LVGEVDGCDCIIVDDMIDTGGTLCKAAEVLRENGAKEVHAWATHGILTD 276


>gi|254453222|ref|ZP_05066659.1| competence protein F [Octadecabacter antarcticus 238]
 gi|198267628|gb|EDY91898.1| competence protein F [Octadecabacter antarcticus 238]
          Length = 239

 Score = 63.7 bits (155), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 29/59 (49%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  A          + G K+LLIDDV T+GAT   A  A   AG   V +L  +R +KD
Sbjct: 180 LSGAIVPNPKRMALLNGRKVLLIDDVMTSGATFAAATEACYSAGVDDVCVLALARVVKD 238


>gi|42518611|ref|NP_964541.1| hypoxanthine-guanine phosphoribosyltransferase [Lactobacillus
           johnsonii NCC 533]
 gi|41582896|gb|AAS08507.1| hypoxanthine-guanine phosphoribosyltransferase [Lactobacillus
           johnsonii NCC 533]
          Length = 178

 Score = 63.7 bits (155), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 10/51 (19%), Positives = 25/51 (49%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + Q +   V    ++ ++D+  TG T +  +  +K+ GA +V +++ 
Sbjct: 76  GKVKITQDIKSDVKNRPVIFMEDIIDTGRTLQALSEIMKERGAKSVEVVSM 126


>gi|257091917|ref|YP_003165558.1| phosphoribosyltransferase [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257044441|gb|ACV33629.1| phosphoribosyltransferase [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 235

 Score = 63.7 bits (155), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 36/58 (62%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF    + +  + G +++L+DDV TTGA+    A  +K  GA+ V++LT +R+L 
Sbjct: 181 VRGAF----HCATDLTGKRLVLVDDVMTTGASLNELARTVKLHGAVEVTLLTLARALP 234


>gi|227513679|ref|ZP_03943728.1| late competence protein [Lactobacillus buchneri ATCC 11577]
 gi|227083090|gb|EEI18402.1| late competence protein [Lactobacillus buchneri ATCC 11577]
          Length = 229

 Score = 63.7 bits (155), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 30/51 (58%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           F +  + S+ +    I+++DDVYTTG T + AA  L +AGA  V   T +R
Sbjct: 179 FELIDHESELIRQKTIVVVDDVYTTGTTIRHAAALLYRAGARCVKGFTLAR 229


>gi|113474722|ref|YP_720783.1| hypothetical protein Tery_0911 [Trichodesmium erythraeum IMS101]
 gi|110165770|gb|ABG50310.1| conserved hypothetical protein [Trichodesmium erythraeum IMS101]
          Length = 255

 Score = 63.7 bits (155), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 31/56 (55%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +++ F + +      +   +LL+DD+YTTGAT   A   L+KAG   V +L  + +
Sbjct: 166 VKDIFAIGKDFRNRSSYAPVLLVDDIYTTGATVNSAIEVLRKAGIKVVGVLAIATT 221


>gi|187251728|ref|YP_001876210.1| hypoxanthine phosphoribosyltransferase [Elusimicrobium minutum
           Pei191]
 gi|186971888|gb|ACC98873.1| Hypoxanthine phosphoribosyltransferase [Elusimicrobium minutum
           Pei191]
          Length = 176

 Score = 63.7 bits (155), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 21/51 (41%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               +   V   +    ++LI+D+  TG T       L+  GA +V I T 
Sbjct: 78  GEVRILLDVRGTIKDRHVILIEDIVDTGLTLDYVLKNLRNRGAASVEICTL 128


>gi|328956710|ref|YP_004374096.1| putative component of the DNA transport apparatus [Carnobacterium
           sp. 17-4]
 gi|328673034|gb|AEB29080.1| putative component of the DNA transport apparatus [Carnobacterium
           sp. 17-4]
          Length = 228

 Score = 63.7 bits (155), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 30/51 (58%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           F V + +   + G  ++L+DD+YTTG T   AA  L ++GA ++   + SR
Sbjct: 178 FVVDKSLQISIKGKHLILVDDIYTTGRTFFHAADCLMRSGAQSIETFSVSR 228


>gi|212696524|ref|ZP_03304652.1| hypothetical protein ANHYDRO_01062 [Anaerococcus hydrogenalis DSM
           7454]
 gi|212676460|gb|EEB36067.1| hypothetical protein ANHYDRO_01062 [Anaerococcus hydrogenalis DSM
           7454]
          Length = 197

 Score = 63.4 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 27/51 (52%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   ++G ++L+++D+  TG T      +L K GA +V I+T 
Sbjct: 96  GNVKIIKDLDTDISGKEVLIVEDIIDTGRTLDALRHSLIKRGANSVKIITL 146


>gi|154505540|ref|ZP_02042278.1| hypothetical protein RUMGNA_03077 [Ruminococcus gnavus ATCC 29149]
 gi|153794198|gb|EDN76618.1| hypothetical protein RUMGNA_03077 [Ruminococcus gnavus ATCC 29149]
          Length = 175

 Score = 63.4 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 9/51 (17%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + + + + G  +L+++D+  +G T       LKK    ++ + T 
Sbjct: 76  GVVRIAKDLDESIEGKDVLIVEDIIDSGRTLYYLIDVLKKRNPKSIQLCTL 126


>gi|197333961|ref|YP_002154886.1| competence protein F [Vibrio fischeri MJ11]
 gi|197315451|gb|ACH64898.1| competence protein F [Vibrio fischeri MJ11]
          Length = 247

 Score = 63.4 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 4/56 (7%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            AF + Q     +    + L+DDV TTGAT     + L+KAG   + + T  R+ +
Sbjct: 187 GAFKITQP----IKEKHVALVDDVVTTGATINLLCVELRKAGVERIDVYTVCRTGR 238


>gi|119471388|ref|ZP_01613860.1| hypothetical protein ATW7_17117 [Alteromonadales bacterium TW-7]
 gi|119445664|gb|EAW26948.1| hypothetical protein ATW7_17117 [Alteromonadales bacterium TW-7]
          Length = 224

 Score = 63.4 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + NAF   +     ++G  + ++DD+ TTGAT   A  ALKKAGA  V   T   +
Sbjct: 171 LTNAFICTE----DMSGKTVAIVDDIMTTGATLNAATQALKKAGAKQVWAFTTCLT 222


>gi|59710724|ref|YP_203500.1| gluconate periplasmic binding protein [Vibrio fischeri ES114]
 gi|59478825|gb|AAW84612.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system [Vibrio
           fischeri ES114]
          Length = 239

 Score = 63.4 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 4/56 (7%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            AF + Q     +    + L+DDV TTGAT     + L+KAG   + + T  R+ +
Sbjct: 187 GAFKITQP----IKEKHVALVDDVVTTGATINLLCVELRKAGVERIDVYTVCRTGR 238


>gi|325849655|ref|ZP_08170858.1| hypoxanthine phosphoribosyltransferase [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
 gi|325479996|gb|EGC83074.1| hypoxanthine phosphoribosyltransferase [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
          Length = 183

 Score = 63.4 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 27/51 (52%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   ++G ++L+++D+  TG T      +L K GA +V I+T 
Sbjct: 82  GNVKIIKDLDTDISGKEVLIVEDIIDTGRTLDALRHSLIKRGANSVKIITL 132


>gi|54295172|ref|YP_127587.1| hypothetical protein lpl2252 [Legionella pneumophila str. Lens]
 gi|53755004|emb|CAH16492.1| hypothetical protein lpl2252 [Legionella pneumophila str. Lens]
          Length = 234

 Score = 63.4 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 5/57 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R+AF VP     HV    ++++DD+ TTG+TA   A  LK AG   V I   +R++
Sbjct: 180 LRHAFYVP-----HVTYEHVMIVDDLLTTGSTANEMAHTLKNAGVKRVDICCCARAV 231


>gi|288870054|ref|ZP_06112758.2| hypoxanthine phosphoribosyltransferase [Clostridium hathewayi DSM
           13479]
 gi|288868611|gb|EFD00910.1| hypoxanthine phosphoribosyltransferase [Clostridium hathewayi DSM
           13479]
          Length = 176

 Score = 63.4 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 8/51 (15%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + + + + G  +L+++D+  +G T       LK+    ++ + T 
Sbjct: 77  GIVKIVKDLDEPIEGKDVLIVEDIIDSGNTLSYLIEVLKQRNPKSIELCTL 127


>gi|229826214|ref|ZP_04452283.1| hypothetical protein GCWU000182_01586 [Abiotrophia defectiva ATCC
           49176]
 gi|229789084|gb|EEP25198.1| hypothetical protein GCWU000182_01586 [Abiotrophia defectiva ATCC
           49176]
          Length = 177

 Score = 63.4 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 1   MRNAFNVPQYVS-KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF +        +    ILLIDD+YTTG+TA   +  LK+AG   V +L  +  
Sbjct: 118 LREAFRINHNSKFYEIQLKNILLIDDIYTTGSTADACSAVLKEAGTEKVYVLCVASV 174


>gi|46138651|ref|XP_391016.1| hypothetical protein FG10840.1 [Gibberella zeae PH-1]
          Length = 456

 Score = 63.4 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 21/48 (43%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +   V+    +L+DD+  TG T   AA  LKK GA  V  L       
Sbjct: 347 LVGDVSNRICILVDDIIDTGNTITRAAKLLKKEGATKVYALVTHGVFS 394


>gi|285017173|ref|YP_003374884.1| amidophosphoribosyltransferase [Xanthomonas albilineans GPE PC73]
 gi|283472391|emb|CBA14896.1| putative competence protein (amidophosphoribosyltransferases)
           [Xanthomonas albilineans]
          Length = 243

 Score = 63.4 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 29/56 (51%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF VP      V    + LIDDV TTGAT   AA AL++AG   V     +R 
Sbjct: 190 LRGAFAVP---DPAVLPAHVALIDDVMTTGATLHAAAQALRRAGVTRVDAWVVARV 242


>gi|145636297|ref|ZP_01791966.1| recombination protein RecR [Haemophilus influenzae PittHH]
 gi|145270462|gb|EDK10396.1| recombination protein RecR [Haemophilus influenzae PittHH]
          Length = 228

 Score = 63.4 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 1/56 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF++           +I L+DDV TTG+T    +  L+K G   + +   +R+
Sbjct: 174 LKNAFSLAVS-KNEFPYRRIALVDDVITTGSTLNEISKLLRKLGVEEIQVWGLARA 228


>gi|303228837|ref|ZP_07315650.1| hypoxanthine phosphoribosyltransferase [Veillonella atypica
           ACS-134-V-Col7a]
 gi|302516457|gb|EFL58386.1| hypoxanthine phosphoribosyltransferase [Veillonella atypica
           ACS-134-V-Col7a]
          Length = 180

 Score = 63.4 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + + + V G  +L+++D+  TG T       LK  GA +V +   
Sbjct: 79  GVVRILKDLDRSVEGKNVLVVEDIVDTGTTLHYLLDNLKARGAKSVRLAAL 129


>gi|293375860|ref|ZP_06622126.1| hypoxanthine phosphoribosyltransferase [Turicibacter sanguinis
           PC909]
 gi|325841816|ref|ZP_08167476.1| hypoxanthine phosphoribosyltransferase [Turicibacter sp. HGF1]
 gi|292645505|gb|EFF63549.1| hypoxanthine phosphoribosyltransferase [Turicibacter sanguinis
           PC909]
 gi|325489846|gb|EGC92198.1| hypoxanthine phosphoribosyltransferase [Turicibacter sp. HGF1]
          Length = 179

 Score = 63.4 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V G  I++++D+  TG T       LK  GA +V ++T 
Sbjct: 77  GQVKILKDIDISVEGRHIIIVEDIVDTGFTLDKVIALLKHRGAASVEVVTM 127


>gi|157693946|ref|YP_001488408.1| competence protein FC [Bacillus pumilus SAFR-032]
 gi|157682704|gb|ABV63848.1| competence protein FC [Bacillus pumilus SAFR-032]
          Length = 228

 Score = 63.4 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  F + Q     +    I+LIDD+YTTGAT   AA  LK+AGA +VS  T  RS
Sbjct: 176 KGMFQIKQT--DAIIQRDIILIDDIYTTGATIYDAARILKEAGAKSVSSFTLIRS 228


>gi|288940276|ref|YP_003442516.1| phosphoribosyltransferase [Allochromatium vinosum DSM 180]
 gi|288895648|gb|ADC61484.1| phosphoribosyltransferase [Allochromatium vinosum DSM 180]
          Length = 238

 Score = 63.4 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF   +     + G  + ++DDV TTG T    +  L  AGA+ V +   +R+L
Sbjct: 186 IRGAFKAVEA----LTGRHLAIVDDVMTTGGTVSELSQVLIDAGAVRVDVWAVARTL 238


>gi|145300947|ref|YP_001143788.1| competence protein F [Aeromonas salmonicida subsp. salmonicida
           A449]
 gi|142853719|gb|ABO92040.1| competence protein F [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 242

 Score = 63.4 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 5/58 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF+V  +         + L+DDV TTGATA      L ++G   V +    R+LK
Sbjct: 187 LRGAFHVRSHHY-----RHVALLDDVVTTGATAGQLTRLLHESGIEKVEVWAICRTLK 239


>gi|315128006|ref|YP_004070009.1| hypothetical protein PSM_A2945 [Pseudoalteromonas sp. SM9913]
 gi|315016520|gb|ADT69858.1| conserved hypothetical protein [Pseudoalteromonas sp. SM9913]
          Length = 225

 Score = 63.4 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF+       ++ G  +++IDD+ TTGAT   A ++LK+AGA  V   T   +
Sbjct: 172 LQQAFSCT----ANLEGKTVVIIDDIMTTGATLNAATLSLKEAGAKQVWAFTTCLT 223


>gi|124009197|ref|ZP_01693878.1| competence protein [Microscilla marina ATCC 23134]
 gi|123985182|gb|EAY25116.1| competence protein [Microscilla marina ATCC 23134]
          Length = 241

 Score = 63.4 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           + N F V +   + V G  +LL+DDV TTGAT +  A +L K G   VS+ T + +L
Sbjct: 187 VDNIFEVLR--PELVKGQHVLLVDDVVTTGATLEACANSLLKVGTAKVSVATIAVAL 241


>gi|163737955|ref|ZP_02145371.1| competence protein F, putative [Phaeobacter gallaeciensis BS107]
 gi|161388571|gb|EDQ12924.1| competence protein F, putative [Phaeobacter gallaeciensis BS107]
          Length = 242

 Score = 63.4 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 27/57 (47%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +  +       ++ + G  +LL+DDV T+GAT    + A   AGA  V +   +R  
Sbjct: 184 LAQSIAAHPKHAERINGRIVLLVDDVMTSGATLSACSEACLDAGATGVRVAVLARVT 240


>gi|227355055|ref|ZP_03839466.1| competence protein F [Proteus mirabilis ATCC 29906]
 gi|227164842|gb|EEI49689.1| competence protein F [Proteus mirabilis ATCC 29906]
          Length = 166

 Score = 63.4 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           + NAF V + V   VAG  + LIDDV TT AT       L +AGA +V +    R+L
Sbjct: 112 LDNAFIVNRTV--SVAGKDLALIDDVITTSATLNAIVPLLFRAGARSVEVWAICRTL 166


>gi|88801936|ref|ZP_01117464.1| ribose-phosphate pyrophosphokinase [Polaribacter irgensii 23-P]
 gi|88782594|gb|EAR13771.1| ribose-phosphate pyrophosphokinase [Polaribacter irgensii 23-P]
          Length = 313

 Score = 63.4 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 24/49 (48%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            +   V G  ++L+DD+  TG T   AA  + + GA++V  +     L 
Sbjct: 207 ELIGDVEGKNVILVDDMIDTGGTLAHAANLMMERGALSVRAICTHPILS 255


>gi|295426487|ref|ZP_06819137.1| PTS family maltose/glucose porter, IIABC component [Lactobacillus
           amylolyticus DSM 11664]
 gi|295063855|gb|EFG54813.1| PTS family maltose/glucose porter, IIABC component [Lactobacillus
           amylolyticus DSM 11664]
          Length = 178

 Score = 63.4 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               V Q +   V G  +L ++D+  TG T K  +  +KK GA +V     
Sbjct: 76  GKVTVTQDIKSDVKGRPVLFMEDIIDTGRTLKYLSDLMKKRGAKSVETCCM 126


>gi|168218231|ref|ZP_02643856.1| hypoxanthine phosphoribosyltransferase [Clostridium perfringens
           NCTC 8239]
 gi|182379754|gb|EDT77233.1| hypoxanthine phosphoribosyltransferase [Clostridium perfringens
           NCTC 8239]
          Length = 183

 Score = 63.4 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 9/51 (17%), Positives = 21/51 (41%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   +    +L+++D+  TG T       LK   A ++ I+  
Sbjct: 81  GVVRILKDLDSDIENKHVLIVEDIVDTGTTLSYLLEYLKARKAASIEIVAL 131


>gi|161830567|ref|YP_001596394.1| ComF family protein [Coxiella burnetii RSA 331]
 gi|161762434|gb|ABX78076.1| ComF family protein [Coxiella burnetii RSA 331]
          Length = 204

 Score = 63.4 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 14/58 (24%), Positives = 27/58 (46%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++NAF + +     ++   + ++DDV TTG T    A  L   G   + I   +++  
Sbjct: 151 VKNAFALTK----SISAKHVAILDDVITTGHTINELARTLSDNGVEKIEIWCCAKTSS 204


>gi|25029099|ref|NP_739153.1| hypoxanthine-guanine phosphoribosyltransferase [Corynebacterium
           efficiens YS-314]
 gi|23494386|dbj|BAC19353.1| putative hypoxanthine-guanine phosphoribosyltransferase
           [Corynebacterium efficiens YS-314]
          Length = 212

 Score = 63.4 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 10/53 (18%), Positives = 25/53 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + + K + G  +L+++D+  +G T       LK     +++++T  R
Sbjct: 110 GVVRILKDLDKDIEGRDVLIVEDIIDSGLTLSWLMRNLKNRHPKSLNVITLLR 162


>gi|219871628|ref|YP_002476003.1| competence protein F [Haemophilus parasuis SH0165]
 gi|219691832|gb|ACL33055.1| competence protein F [Haemophilus parasuis SH0165]
          Length = 225

 Score = 63.4 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 25/56 (44%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF             ++ ++DDV TTG+T       L K G   + + T +R+
Sbjct: 174 LRGAFIYQPKQPY----QRVAIVDDVVTTGSTLNAICAELLKQGVKEIQVWTLARA 225


>gi|42518733|ref|NP_964663.1| hypoxanthine-guanine phosphoribosyltransferase [Lactobacillus
           johnsonii NCC 533]
 gi|227890341|ref|ZP_04008146.1| hypoxanthine phosphoribosyltransferase [Lactobacillus johnsonii
           ATCC 33200]
 gi|268319149|ref|YP_003292805.1| hypothetical protein FI9785_662 [Lactobacillus johnsonii FI9785]
 gi|41583019|gb|AAS08629.1| hypoxanthine-guanine phosphoribosyltransferase [Lactobacillus
           johnsonii NCC 533]
 gi|227849155|gb|EEJ59241.1| hypoxanthine phosphoribosyltransferase [Lactobacillus johnsonii
           ATCC 33200]
 gi|262397524|emb|CAX66538.1| hpt [Lactobacillus johnsonii FI9785]
 gi|329667001|gb|AEB92949.1| hypoxanthine-guanine phosphoribosyltransferase [Lactobacillus
           johnsonii DPC 6026]
          Length = 189

 Score = 63.4 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 21/51 (41%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               +   V   V G  +LL++D+  TG T K     L + GA +V     
Sbjct: 83  GKVRLDIDVQADVKGRDVLLVEDIVDTGHTLKFMKDLLIERGAKSVKCCAL 133


>gi|220930905|ref|YP_002507813.1| hypoxanthine phosphoribosyltransferase [Halothermothrix orenii H
           168]
 gi|219992215|gb|ACL68818.1| hypoxanthine phosphoribosyltransferase [Halothermothrix orenii H
           168]
          Length = 186

 Score = 63.4 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 10/51 (19%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + + +++    +L+++D+  TG T K     LK     ++ I+T 
Sbjct: 84  GVVRIIKDLEENIENKHVLIVEDIIDTGLTLKHVVDMLKTREPASIKIVTL 134


>gi|304310059|ref|YP_003809657.1| competence protein ComF [gamma proteobacterium HdN1]
 gi|301795792|emb|CBL43991.1| competence protein ComF [gamma proteobacterium HdN1]
          Length = 256

 Score = 63.4 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 3   NAFNVPQYVSK--HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +AF V    +    ++   ++LIDDV TTGAT+   A  L KAGA +VS+   +++
Sbjct: 198 DAFEVTPKGNTYLQISSANVILIDDVVTTGATSAELAHCLLKAGANSVSLWALAKT 253


>gi|167748296|ref|ZP_02420423.1| hypothetical protein ANACAC_03040 [Anaerostipes caccae DSM 14662]
 gi|167652288|gb|EDR96417.1| hypothetical protein ANACAC_03040 [Anaerostipes caccae DSM 14662]
          Length = 158

 Score = 63.4 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 21/44 (47%), Positives = 28/44 (63%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
            S  V G ++LL+DD+YTTGATA+    ALK AGA  V +   +
Sbjct: 110 ASDEVKGKRVLLVDDIYTTGATAESCTRALKAAGAEDVWVFCVA 153


>gi|300088792|ref|YP_003759314.1| phosphoribosyltransferase [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
 gi|299528525|gb|ADJ26993.1| phosphoribosyltransferase [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
          Length = 230

 Score = 63.4 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 3/55 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           + +AF         + G  ++LIDDV T+GAT    A AL   GA  V  LT +R
Sbjct: 177 VADAFRCYN---SSLTGRSVILIDDVATSGATLNACARALTAGGAAEVRALTLAR 228


>gi|84514889|ref|ZP_01002252.1| competence protein F, putative [Loktanella vestfoldensis SKA53]
 gi|84511048|gb|EAQ07502.1| competence protein F, putative [Loktanella vestfoldensis SKA53]
          Length = 241

 Score = 63.4 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 29/59 (49%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +             + G  +LL+DDV T+GAT      AL   GA+ VS +T +R +KD
Sbjct: 182 LTGQITPNLRQQAQITGKPVLLVDDVMTSGATLAACTQALLDGGAVRVSTITLARVVKD 240


>gi|323494585|ref|ZP_08099689.1| ComF family protein [Vibrio brasiliensis LMG 20546]
 gi|323311188|gb|EGA64348.1| ComF family protein [Vibrio brasiliensis LMG 20546]
          Length = 180

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF++ +     V    + ++DDV TTG+T       L  AG  TV I    R+
Sbjct: 123 LRGAFSI-KSRPLAVE--HVAIVDDVLTTGSTVYHLCKLLLDAGVKTVDIYCICRT 175


>gi|121308556|dbj|BAF43658.1| hypoxanthine ribosyl transferase [Photobacterium phosphoreum]
          Length = 177

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 12/49 (24%), Positives = 22/49 (44%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
             + + +   + G  +LL++D+  TG T       L   G  ++SI T 
Sbjct: 79  VRILKDLDDDIKGKDVLLVEDIIDTGNTLSKVCEILSLRGPKSISICTL 127


>gi|147678887|ref|YP_001213102.1| hypoxanthine-guanine phosphoribosyltransferase [Pelotomaculum
           thermopropionicum SI]
 gi|146274984|dbj|BAF60733.1| hypoxanthine-guanine phosphoribosyltransferase [Pelotomaculum
           thermopropionicum SI]
          Length = 181

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 10/51 (19%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
            A  + + + + + G  +L+++D+  TG T       L   G  ++ + T 
Sbjct: 77  GAVRILKDLDRGIEGRHVLIVEDIVDTGLTLNYLVDNLTARGPASLKVCTL 127


>gi|19553891|ref|NP_601893.1| hypoxanthine-guanine phosphoribosyltransferase [Corynebacterium
           glutamicum ATCC 13032]
 gi|62391534|ref|YP_226936.1| hypoxanthine-guanine phosphoribosyltransferase [Corynebacterium
           glutamicum ATCC 13032]
 gi|41326876|emb|CAF20720.1| HYPOXANTHINE PHOSPHORIBOSYLTRANSFERASE [Corynebacterium glutamicum
           ATCC 13032]
          Length = 200

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 10/53 (18%), Positives = 25/53 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + + K + G  +L+++D+  +G T       LK     +++++T  R
Sbjct: 98  GVVRILKDLDKEIEGRDVLIVEDIIDSGLTLSWLMRNLKNRNPKSLNVITLLR 150


>gi|259505903|ref|ZP_05748805.1| hypoxanthine/guanine phosphoribosyltransferase [Corynebacterium
           efficiens YS-314]
 gi|259166507|gb|EEW51061.1| hypoxanthine/guanine phosphoribosyltransferase [Corynebacterium
           efficiens YS-314]
          Length = 200

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 10/53 (18%), Positives = 25/53 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + + K + G  +L+++D+  +G T       LK     +++++T  R
Sbjct: 98  GVVRILKDLDKDIEGRDVLIVEDIIDSGLTLSWLMRNLKNRHPKSLNVITLLR 150


>gi|239621578|ref|ZP_04664609.1| hypoxanthine-guanine phosphoribosyltransferase [Bifidobacterium
           longum subsp. infantis CCUG 52486]
 gi|239515453|gb|EEQ55320.1| hypoxanthine-guanine phosphoribosyltransferase [Bifidobacterium
           longum subsp. infantis CCUG 52486]
          Length = 230

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               V Q +S  V G  IL+++D+  +G T       LK+ GA +V +   
Sbjct: 125 GEVTVRQDLSADVRGRHILIVEDIVDSGRTLAWLVAELKRRGAASVEVFAL 175


>gi|323703018|ref|ZP_08114674.1| phosphoribosyltransferase [Desulfotomaculum nigrificans DSM 574]
 gi|323532031|gb|EGB21914.1| phosphoribosyltransferase [Desulfotomaculum nigrificans DSM 574]
          Length = 253

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           ++ +F V       +   KILL+DDV+TTG+T    A  L++ GA  + ++T 
Sbjct: 184 LQGSFKVT--APGELKDKKILLLDDVFTTGSTVSVIADLLRQQGAGEIFVITL 234


>gi|160933738|ref|ZP_02081126.1| hypothetical protein CLOLEP_02599 [Clostridium leptum DSM 753]
 gi|156867615|gb|EDO60987.1| hypothetical protein CLOLEP_02599 [Clostridium leptum DSM 753]
          Length = 182

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 9/51 (17%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +S  +    +L+++D+  +G T       LK+ G  ++ + T 
Sbjct: 80  GQIKIVKDLSVPIQDCHVLIVEDIIDSGNTLCYVKNLLKERGCKSIKLCTL 130


>gi|169824692|ref|YP_001692303.1| hypoxanthine-guanine phosphoribosyltransferase [Finegoldia magna
           ATCC 29328]
 gi|303235032|ref|ZP_07321656.1| hypoxanthine phosphoribosyltransferase [Finegoldia magna BVS033A4]
 gi|167831497|dbj|BAG08413.1| hypoxanthine-guanine phosphoribosyltransferase [Finegoldia magna
           ATCC 29328]
 gi|302493887|gb|EFL53669.1| hypoxanthine phosphoribosyltransferase [Finegoldia magna BVS033A4]
          Length = 186

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + + + +AG  IL+++D+  +G T       L    A +V I T 
Sbjct: 82  GTVRIIKDLEEDIAGKNILIVEDIVDSGRTLNYLVRNLLDRKAKSVKIATL 132


>gi|291460210|ref|ZP_06599600.1| hypoxanthine phosphoribosyltransferase [Oribacterium sp. oral taxon
           078 str. F0262]
 gi|291417157|gb|EFE90876.1| hypoxanthine phosphoribosyltransferase [Oribacterium sp. oral taxon
           078 str. F0262]
          Length = 180

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 10/51 (19%), Positives = 25/51 (49%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + + + + G ++L+++D+  TG+T       L + G  ++ I T 
Sbjct: 77  GIVRIVKDLDEPLMGREVLIVEDIIDTGSTLNHLRKLLLERGPRSLEICTL 127


>gi|83953111|ref|ZP_00961833.1| Competence protein F [Sulfitobacter sp. NAS-14.1]
 gi|83842079|gb|EAP81247.1| Competence protein F [Sulfitobacter sp. NAS-14.1]
          Length = 219

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 30/59 (50%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  A       +  +    +LL+DDV T+GAT + +A A   A A  + ++T +R  KD
Sbjct: 160 LDGAITAHPRRADLLRDRPVLLVDDVMTSGATLQASARACLDARAGPICVVTLARVAKD 218


>gi|301300315|ref|ZP_07206522.1| hypoxanthine phosphoribosyltransferase [Lactobacillus salivarius
           ACS-116-V-Col5a]
 gi|300852088|gb|EFK79765.1| hypoxanthine phosphoribosyltransferase [Lactobacillus salivarius
           ACS-116-V-Col5a]
          Length = 179

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V G  +L+++D+  TG T +      K   A +V I T 
Sbjct: 77  GEVKIIKDLDTSVTGRDVLIVEDIIDTGRTLQRLVELFKHRNAKSVKICTL 127


>gi|57238824|ref|YP_179960.1| putative competence protein F (DNA transformation protein comF)
           [Ehrlichia ruminantium str. Welgevonden]
 gi|58578754|ref|YP_196966.1| putative competence protein F (DNA transformation protein comF)
           [Ehrlichia ruminantium str. Welgevonden]
 gi|57160903|emb|CAH57808.1| putative competence protein F [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58417380|emb|CAI26584.1| Similar to competence protein F (DNA transformation protein comF)
           [Ehrlichia ruminantium str. Welgevonden]
          Length = 230

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 26/46 (56%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
              +    ILL+DDV TTG T +  +  L ++GA  + ++T  R+L
Sbjct: 185 QHRIYNKTILLVDDVVTTGITVRTCSQKLIESGAKEIRVITLGRTL 230


>gi|313903615|ref|ZP_07837005.1| phosphoribosyltransferase [Thermaerobacter subterraneus DSM 13965]
 gi|313466168|gb|EFR61692.1| phosphoribosyltransferase [Thermaerobacter subterraneus DSM 13965]
          Length = 288

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 1/56 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +   F         +AG  +LL+DDV TTG T   A  AL+  GA  V  L  + +
Sbjct: 215 VAGVFAPSPRAR-RLAGRPVLLVDDVLTTGRTLAAACEALQALGAGAVYGLVAAAT 269


>gi|302381420|ref|YP_003817243.1| phosphoribosyltransferase [Brevundimonas subvibrioides ATCC 15264]
 gi|302192048|gb|ADK99619.1| phosphoribosyltransferase [Brevundimonas subvibrioides ATCC 15264]
          Length = 249

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 36/56 (64%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +++AF++ +  ++ V G +ILL+DDV TTGATA+  A AL   GA  V +   +R 
Sbjct: 186 VKSAFDLTETGARRVRGRRILLVDDVLTTGATAEACATALLDGGARAVDLAVIARV 241


>gi|309390162|gb|ADO78042.1| phosphoribosyltransferase [Halanaerobium praevalens DSM 2228]
          Length = 248

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHV-AGLKILLIDDVYTTGATAKCAAI-ALKKAGAMTVSILTFSRS 56
           +  AF +   V   +     +L+IDD+ TTG T+   +   LK+ GA  V +LT +  
Sbjct: 186 LEGAFALKDGVDPSIFKDKNLLIIDDIMTTGTTSAEISHFVLKEMGAANVYVLTTASV 243


>gi|239828349|ref|YP_002950973.1| late competence protein [Geobacillus sp. WCH70]
 gi|239808642|gb|ACS25707.1| late competence protein [Geobacillus sp. WCH70]
          Length = 235

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
            N F     +   +    I+LIDD+YTTG T + AA  L++AGA+ VS  T  RS
Sbjct: 183 ENVFQFSGKMP--LQDKHIVLIDDIYTTGTTLRHAAKVLRQAGAIDVSSFTLVRS 235


>gi|332533245|ref|ZP_08409112.1| competence protein F [Pseudoalteromonas haloplanktis ANT/505]
 gi|332037324|gb|EGI73779.1| competence protein F [Pseudoalteromonas haloplanktis ANT/505]
          Length = 225

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF   Q +     G  + ++DDV TTGAT   A  ALK+AGA  V   T   +
Sbjct: 172 LKNAFICTQDMG----GKTVAIVDDVMTTGATLNAATSALKQAGAKQVWAFTTCLT 223


>gi|302874974|ref|YP_003843607.1| hypoxanthine phosphoribosyltransferase [Clostridium cellulovorans
           743B]
 gi|307690409|ref|ZP_07632855.1| hypoxanthine phosphoribosyltransferase [Clostridium cellulovorans
           743B]
 gi|302577831|gb|ADL51843.1| hypoxanthine phosphoribosyltransferase [Clostridium cellulovorans
           743B]
          Length = 175

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
            +  V   +  ++ G  +L++DD+  TG T       +K  GA++V     
Sbjct: 77  GSVKVVNDIPDNIEGCDVLIVDDIIDTGYTMDFVTKYVKDKGALSVKTCVL 127


>gi|34499837|ref|NP_904052.1| competence protein F [Chromobacterium violaceum ATCC 12472]
 gi|34105687|gb|AAQ62041.1| competence protein F [Chromobacterium violaceum ATCC 12472]
          Length = 222

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R+AF V +       GL I ++DDV T+GAT    +  +KK GA  V     +R+  
Sbjct: 166 VRHAFGVKRRCD----GLSIAIVDDVATSGATLSALSKMMKKQGAKRVDAWVLARAFS 219


>gi|268319029|ref|YP_003292685.1| hypoxanthine-guanine phosphoribosyltransferase homologue
           [Lactobacillus johnsonii FI9785]
 gi|262397404|emb|CAX66418.1| hypoxanthine-guanine phosphoribosyltransferase homologue
           [Lactobacillus johnsonii FI9785]
          Length = 178

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 10/51 (19%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + Q +   V    ++ ++D+  TG T +  +  +K+ GA +V ++  
Sbjct: 76  GKVKITQDIKSDVTNRPVIFMEDIIDTGRTLQALSEIMKERGAKSVEVVAM 126


>gi|312797394|ref|YP_004030316.1| Amidophosphoribosyltransferase family protein [Burkholderia
           rhizoxinica HKI 454]
 gi|312169169|emb|CBW76172.1| Amidophosphoribosyltransferase family protein [Burkholderia
           rhizoxinica HKI 454]
          Length = 317

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +  AF + +     V G  + ++DDV T+G T    A  LK AGA  V+     R+ +
Sbjct: 263 LAGAFALRKT----VRGQHVGIVDDVMTSGTTLDTLARMLKDAGARRVTNFVALRTPR 316


>gi|116491314|ref|YP_810858.1| amidophosphoribosyltransferase [Oenococcus oeni PSU-1]
 gi|116092039|gb|ABJ57193.1| Predicted amidophosphoribosyltransferase [Oenococcus oeni PSU-1]
          Length = 226

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 18/43 (41%), Positives = 25/43 (58%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
             +    +LL+DDVYTTG T    A  L +AGA  V+ +T +R
Sbjct: 184 SSIENKSVLLLDDVYTTGTTLHQTAAVLYEAGAKKVNSITLAR 226


>gi|311113083|ref|YP_003984305.1| phosphoribosyl pyrophosphate synthetase [Rothia dentocariosa ATCC
           17931]
 gi|310944577|gb|ADP40871.1| phosphoribosyl pyrophosphate synthetase [Rothia dentocariosa ATCC
           17931]
          Length = 328

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 21/53 (39%)

Query: 6   NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            V + V   V G   +LIDD+  TG T   A   LK  GA  V I        
Sbjct: 214 AVSKTVVGDVEGRSCVLIDDMIDTGGTIAGAVKVLKDKGAKEVIIAATHPVFS 266


>gi|238751154|ref|ZP_04612649.1| Gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system [Yersinia
           rohdei ATCC 43380]
 gi|238710632|gb|EEQ02855.1| Gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system [Yersinia
           rohdei ATCC 43380]
          Length = 227

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 26/57 (45%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           MR  F   +     V G  I L+DDV TTG+T    A  L   G  ++ +    R+L
Sbjct: 175 MRGIFRCLEP----VHGQHIALLDDVVTTGSTLNEIAKLLWAKGIASLQVWCICRTL 227


>gi|225420298|ref|ZP_03762601.1| hypothetical protein CLOSTASPAR_06641 [Clostridium asparagiforme
           DSM 15981]
 gi|225041115|gb|EEG51361.1| hypothetical protein CLOSTASPAR_06641 [Clostridium asparagiforme
           DSM 15981]
          Length = 182

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 9/51 (17%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + + + + G  +L+++D+  +G T       LK+    +V + T 
Sbjct: 83  GVVKIIKDLDEPLEGKDVLIVEDIIDSGRTLSYLIEVLKQRKPNSVHLCTL 133


>gi|251794098|ref|YP_003008829.1| hypoxanthine phosphoribosyltransferase [Paenibacillus sp. JDR-2]
 gi|247541724|gb|ACS98742.1| hypoxanthine phosphoribosyltransferase [Paenibacillus sp. JDR-2]
          Length = 179

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 10/51 (19%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V G  +L+++D+  +G T       L++  A +V++ T 
Sbjct: 77  GVVKIIKDLDASVEGRDVLIVEDIIDSGLTLSYLIDVLERRNAKSVTVATL 127


>gi|327183565|gb|AEA32012.1| hypoxanthine-guanine phosphoribosyltransferase [Lactobacillus
           amylovorus GRL 1118]
          Length = 177

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 25/51 (49%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + Q V   V    ++ ++D+  TG T K  +  +K+ GA +V +++ 
Sbjct: 76  GKVKITQDVKSDVKNRPVIFMEDIIDTGRTLKALSDLMKERGAKSVEVISM 126


>gi|18311453|ref|NP_563387.1| hypoxanthine phosphoribosyltransferase [Clostridium perfringens
           str. 13]
 gi|168206866|ref|ZP_02632871.1| hypoxanthine phosphoribosyltransferase [Clostridium perfringens E
           str. JGS1987]
 gi|168211207|ref|ZP_02636832.1| hypoxanthine phosphoribosyltransferase [Clostridium perfringens B
           str. ATCC 3626]
 gi|168215141|ref|ZP_02640766.1| hypoxanthine phosphoribosyltransferase [Clostridium perfringens CPE
           str. F4969]
 gi|18146137|dbj|BAB82177.1| hypoxanthine-guanine phosphoribosyltransferase [Clostridium
           perfringens str. 13]
 gi|170661744|gb|EDT14427.1| hypoxanthine phosphoribosyltransferase [Clostridium perfringens E
           str. JGS1987]
 gi|170710769|gb|EDT22951.1| hypoxanthine phosphoribosyltransferase [Clostridium perfringens B
           str. ATCC 3626]
 gi|170713447|gb|EDT25629.1| hypoxanthine phosphoribosyltransferase [Clostridium perfringens CPE
           str. F4969]
          Length = 183

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 9/51 (17%), Positives = 21/51 (41%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   +    +L+++D+  TG T       LK   A ++ I+  
Sbjct: 81  GVVRILKDLDSDIENKHVLIVEDIVDTGTTLSYLLEYLKARKAASIEIVAL 131


>gi|331086209|ref|ZP_08335291.1| hypothetical protein HMPREF0987_01594 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330406368|gb|EGG85882.1| hypothetical protein HMPREF0987_01594 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 258

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 3/53 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           +  AF V           K+LL+DD+YTTG+T    A  LK+ G   V  LT 
Sbjct: 203 LSGAFAVEDDWKPK---KKVLLVDDIYTTGSTVDELARILKENGVQKVYFLTI 252


>gi|325662408|ref|ZP_08151017.1| hypothetical protein HMPREF0490_01756 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|325471410|gb|EGC74633.1| hypothetical protein HMPREF0490_01756 [Lachnospiraceae bacterium
           4_1_37FAA]
          Length = 258

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 3/53 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           +  AF V           K+LL+DD+YTTG+T    A  LK+ G   V  LT 
Sbjct: 203 LSGAFAVEDDWKPK---KKVLLVDDIYTTGSTVDELARILKENGVQKVYFLTI 252


>gi|237804119|ref|ZP_04591704.1| competence protein ComF [Pseudomonas syringae pv. oryzae str.
          1_6]
 gi|331026100|gb|EGI06156.1| competence protein ComF [Pseudomonas syringae pv. oryzae str.
          1_6]
          Length = 89

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 2/58 (3%)

Query: 1  MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
          +  AF +       V    + L+DDV TTG+TA+  A  L  AGA  V +   +R+ K
Sbjct: 30 LHGAFTLIDA--DWVRDKHLALVDDVLTTGSTAEVIARLLNDAGARRVDVYCLARTPK 85


>gi|169351495|ref|ZP_02868433.1| hypothetical protein CLOSPI_02275 [Clostridium spiroforme DSM 1552]
 gi|169291717|gb|EDS73850.1| hypothetical protein CLOSPI_02275 [Clostridium spiroforme DSM 1552]
          Length = 318

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 12/46 (26%), Positives = 19/46 (41%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
             V G   +++DD+  TG T       LK+ GA +V +        
Sbjct: 208 GDVEGKNCIMVDDMIDTGGTIVAGIEMLKEKGAKSVHVACTHPVFS 253


>gi|227890466|ref|ZP_04008271.1| hypoxanthine phosphoribosyltransferase [Lactobacillus johnsonii
           ATCC 33200]
 gi|227849035|gb|EEJ59121.1| hypoxanthine phosphoribosyltransferase [Lactobacillus johnsonii
           ATCC 33200]
          Length = 178

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 10/51 (19%), Positives = 25/51 (49%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + Q +   V    ++ ++D+  TG T +  +  +K+ GA +V +++ 
Sbjct: 76  GKVKITQDIKSDVTNRPVIFMEDIIDTGRTLQALSEIMKERGAKSVEVVSM 126


>gi|207727801|ref|YP_002256195.1| competence protein f-related protein [Ralstonia solanacearum MolK2]
 gi|206591042|emb|CAQ56654.1| competence protein f-related protein [Ralstonia solanacearum MolK2]
          Length = 240

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF+VP      VAG  + ++DDV TTGAT    A  LK+AGA  V+     R+
Sbjct: 186 LQGAFDVPDPAC--VAGRHVGVVDDVMTTGATLSEVATQLKRAGAARVTNCVALRT 239


>gi|78044328|ref|YP_359025.1| putative competence protein [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|77996443|gb|ABB15342.1| putative competence protein [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 229

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 3/58 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++  F V +  +       ILL+DDV+TTGATA+     L  AGA  V ++T + ++K
Sbjct: 174 LKGNFAVKERFTGREK---ILLVDDVFTTGATAQECTRTLLLAGADKVYVITMATAVK 228


>gi|116333184|ref|YP_794711.1| hypoxanthine-guanine phosphoribosyltransferase [Lactobacillus
           brevis ATCC 367]
 gi|116098531|gb|ABJ63680.1| hypoxanthine phosphoribosyltransferase [Lactobacillus brevis ATCC
           367]
          Length = 180

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   VAG  ++L++D+  TG T K     LK   A ++ + T 
Sbjct: 77  GTIRLLKDLDTDVAGRDVVLVEDIIDTGRTLKYLEDLLKDRQAKSIKVCTL 127


>gi|52842542|ref|YP_096341.1| competence protein ComF [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
 gi|52629653|gb|AAU28394.1| competence protein ComF [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
          Length = 199

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 5/57 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R+AF V       V    ++++DD+ TTG+TA   A  LK AG   V I   +R++
Sbjct: 145 LRHAFYV-----SAVTYEHVMIVDDLLTTGSTANEMAHTLKNAGVKRVDICCCARAV 196


>gi|294791525|ref|ZP_06756682.1| ribose-phosphate pyrophosphokinase [Scardovia inopinata F0304]
 gi|294457996|gb|EFG26350.1| ribose-phosphate pyrophosphokinase [Scardovia inopinata F0304]
          Length = 357

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 26/54 (48%)

Query: 6   NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            V   V   V+G   +L+DD+  TG T   A   + +AGA +V ++     L D
Sbjct: 226 TVANRVVGDVSGKDCVLVDDLIDTGGTIAEATKIILEAGAKSVIVVATHGVLSD 279


>gi|256545182|ref|ZP_05472548.1| ribose-phosphate pyrophosphokinase [Anaerococcus vaginalis ATCC
           51170]
 gi|256399223|gb|EEU12834.1| ribose-phosphate pyrophosphokinase [Anaerococcus vaginalis ATCC
           51170]
          Length = 328

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 20/46 (43%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
               G   +L+DD+  T  T   AA  LK+ GA  VSI      L 
Sbjct: 221 GDFEGKHCILVDDIIDTAGTICNAANYLKEHGAKEVSIAATHGVLS 266


>gi|148976498|ref|ZP_01813194.1| ComF-related protein [Vibrionales bacterium SWAT-3]
 gi|145964074|gb|EDK29331.1| ComF-related protein [Vibrionales bacterium SWAT-3]
          Length = 185

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 14/56 (25%), Positives = 24/56 (42%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF +       +    + +IDDV TTG+T       L + G   + I    R+
Sbjct: 125 LKGAFAMKNNSFSAIDYSHVAIIDDVVTTGSTVYQLCQLLLEVGVKRIDIYCICRT 180


>gi|300857287|ref|YP_003782271.1| hypoxanthine-guanine phosphoribosyltransferase [Clostridium
           ljungdahlii DSM 13528]
 gi|300437402|gb|ADK17169.1| hypoxanthine-guanine phosphoribosyltransferase [Clostridium
           ljungdahlii DSM 13528]
          Length = 181

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 10/51 (19%), Positives = 20/51 (39%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   +    IL+++D+  +G T       LK   A +V I   
Sbjct: 80  GVVRILKDLDFEIENKHILIVEDIIDSGITLAYLVDYLKGRKAKSVEIACL 130


>gi|300743839|ref|ZP_07072859.1| ribose-phosphate pyrophosphokinase [Rothia dentocariosa M567]
 gi|300380200|gb|EFJ76763.1| ribose-phosphate pyrophosphokinase [Rothia dentocariosa M567]
          Length = 328

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 21/53 (39%)

Query: 6   NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            V + V   V G   +LIDD+  TG T   A   LK  GA  V I        
Sbjct: 214 AVSKTVVGDVEGRSCVLIDDMIDTGGTIAGAVKVLKDKGAKEVIIAATHPVFS 266


>gi|302380175|ref|ZP_07268647.1| hypoxanthine phosphoribosyltransferase [Finegoldia magna
           ACS-171-V-Col3]
 gi|302311958|gb|EFK93967.1| hypoxanthine phosphoribosyltransferase [Finegoldia magna
           ACS-171-V-Col3]
          Length = 186

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + + + +AG  IL+++D+  +G T       L    A +V I T 
Sbjct: 82  GTVRIIKDLEEDIAGKNILIVEDIVDSGRTLNYLVRNLLDRKAKSVKIATL 132


>gi|119961271|ref|YP_947124.1| ribose-phosphate pyrophosphokinase [Arthrobacter aurescens TC1]
 gi|119948130|gb|ABM07041.1| ribose-phosphate pyrophosphokinase [Arthrobacter aurescens TC1]
          Length = 326

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 23/54 (42%)

Query: 6   NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            V + V   V G   +LIDD+  TG T   A   LK AGA  V I        D
Sbjct: 212 AVSKTVVGQVEGRTCVLIDDMIDTGGTISGAVQVLKNAGAKDVIIACTHAVFSD 265


>gi|120555668|ref|YP_960019.1| putative phosphoribosyl transferase [Marinobacter aquaeolei VT8]
 gi|120325517|gb|ABM19832.1| putative phosphoribosyl transferase [Marinobacter aquaeolei VT8]
          Length = 242

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 5/56 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++  F V   V  ++A     ++DDV TTG T +  A  L +AGA  + +   +R+
Sbjct: 190 LQGLFEVTGPVPANIA-----IVDDVVTTGTTVRELASVLTRAGAKEIQVWALART 240


>gi|300705286|ref|YP_003746889.1| amidophosphoribosyltransferase, comf/gntx family [Ralstonia
           solanacearum CFBP2957]
 gi|299072950|emb|CBJ44306.1| putative amidophosphoribosyltransferase, comF/gntX family
           [Ralstonia solanacearum CFBP2957]
          Length = 240

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF+VP      VAG  + ++DDV TTGAT    A  LK+AGA  V+     R+
Sbjct: 186 LQGAFDVPDPAC--VAGRHVGVVDDVMTTGATLSEIATQLKRAGAARVTNCVALRT 239


>gi|21325469|dbj|BAC00091.1| Hypoxanthine-guanine phosphoribosyltransferase [Corynebacterium
           glutamicum ATCC 13032]
          Length = 194

 Score = 63.0 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 10/53 (18%), Positives = 25/53 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + + K + G  +L+++D+  +G T       LK     +++++T  R
Sbjct: 92  GVVRILKDLDKEIEGRDVLIVEDIIDSGLTLSWLMRNLKNRNPKSLNVITLLR 144


>gi|90962326|ref|YP_536242.1| hypoxanthine-guanine phosphoribosyltransferase [Lactobacillus
           salivarius UCC118]
 gi|90821520|gb|ABE00159.1| Hypoxanthine-guanine phosphoribosyltransferase [Lactobacillus
           salivarius UCC118]
 gi|300214977|gb|ADJ79393.1| Hypoxanthine-guanine phosphoribosyltransferase [Lactobacillus
           salivarius CECT 5713]
          Length = 179

 Score = 63.0 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V G  +L+++D+  TG T +      K   A +V I T 
Sbjct: 77  GEVKIIKDLDTSVTGRDVLIVEDIIDTGRTLQRLVELFKHRNAKSVKICTL 127


>gi|297626908|ref|YP_003688671.1| ribose-phosphate pyrophosphokinase [Propionibacterium
           freudenreichii subsp. shermanii CIRM-BIA1]
 gi|296922673|emb|CBL57250.1| Ribose-phosphate pyrophosphokinase [Propionibacterium
           freudenreichii subsp. shermanii CIRM-BIA1]
          Length = 331

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 1/56 (1%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           N   V + V   V G   LL+DD+  TG T   AA AL   GA  V        L 
Sbjct: 209 NQVKVHE-VVGDVEGRTCLLVDDMIDTGGTICQAANALLDRGAAKVIACATHPILS 263


>gi|255037442|ref|YP_003088063.1| amidophosphoribosyl-transferase [Dyadobacter fermentans DSM 18053]
 gi|254950198|gb|ACT94898.1| amidophosphoribosyl-transferase [Dyadobacter fermentans DSM 18053]
          Length = 230

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 4/54 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++  F+V    S       ++LIDDV TTGAT +  A  L  AG     ILT +
Sbjct: 177 VQGVFSVKPGFSP----QSVILIDDVLTTGATLEECARTLLAAGCKQFHILTIA 226


>gi|110801235|ref|YP_697159.1| hypoxanthine phosphoribosyltransferase [Clostridium perfringens
           ATCC 13124]
 gi|169343176|ref|ZP_02864197.1| hypoxanthine phosphoribosyltransferase [Clostridium perfringens C
           str. JGS1495]
 gi|182626032|ref|ZP_02953795.1| hypoxanthine phosphoribosyltransferase [Clostridium perfringens D
           str. JGS1721]
 gi|110675882|gb|ABG84869.1| hypoxanthine phosphoribosyltransferase [Clostridium perfringens
           ATCC 13124]
 gi|169298728|gb|EDS80804.1| hypoxanthine phosphoribosyltransferase [Clostridium perfringens C
           str. JGS1495]
 gi|177908739|gb|EDT71250.1| hypoxanthine phosphoribosyltransferase [Clostridium perfringens D
           str. JGS1721]
          Length = 183

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 9/51 (17%), Positives = 21/51 (41%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   +    +L+++D+  TG T       LK   A ++ I+  
Sbjct: 81  GVVRILKDLDSDIENKHVLIVEDIVDTGTTLSYLLEYLKARKAASIEIVAL 131


>gi|108804459|ref|YP_644396.1| phosphoribosyltransferase [Rubrobacter xylanophilus DSM 9941]
 gi|108765702|gb|ABG04584.1| phosphoribosyltransferase [Rubrobacter xylanophilus DSM 9941]
          Length = 227

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 5/56 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF         V G  +LL+DDV TTGAT    A  L +AGA  V  +   R+
Sbjct: 176 VRGAFE----ARGRVRGR-VLLVDDVLTTGATMSECARVLLEAGASGVYAVGLCRA 226


>gi|227891604|ref|ZP_04009409.1| hypoxanthine-guanine phosphoribosyltransferase [Lactobacillus
           salivarius ATCC 11741]
 gi|227866751|gb|EEJ74172.1| hypoxanthine-guanine phosphoribosyltransferase [Lactobacillus
           salivarius ATCC 11741]
          Length = 179

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V G  +L+++D+  TG T +      K   A +V I T 
Sbjct: 77  GEVKIIKDLDTSVTGRDVLIVEDIIDTGRTLQRLVELFKHRNAKSVKICTL 127


>gi|307243841|ref|ZP_07525970.1| ComF family protein [Peptostreptococcus stomatis DSM 17678]
 gi|306492779|gb|EFM64803.1| ComF family protein [Peptostreptococcus stomatis DSM 17678]
          Length = 256

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/53 (41%), Positives = 32/53 (60%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           ++N+F + + +   +    ILL+DDV+TTG+T    A  LK AGA  V  LTF
Sbjct: 193 LKNSFLIKEEMKDLIVNKNILLVDDVFTTGSTVDEMAKVLKLAGAQEVVSLTF 245


>gi|182420100|ref|ZP_02951334.1| hypoxanthine phosphoribosyltransferase [Clostridium butyricum 5521]
 gi|237669581|ref|ZP_04529561.1| hypoxanthine phosphoribosyltransferase [Clostridium butyricum E4
           str. BoNT E BL5262]
 gi|182376137|gb|EDT73724.1| hypoxanthine phosphoribosyltransferase [Clostridium butyricum 5521]
 gi|237655025|gb|EEP52585.1| hypoxanthine phosphoribosyltransferase [Clostridium butyricum E4
           str. BoNT E BL5262]
          Length = 179

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   + G  IL+++D+  TG T       LK   A ++ I+  
Sbjct: 77  GVVRILKDLDNSIEGKHILIVEDIVDTGTTLSYLLKYLKARKAASIEIVAL 127


>gi|325264768|ref|ZP_08131497.1| putative competence protein [Clostridium sp. D5]
 gi|324030060|gb|EGB91346.1| putative competence protein [Clostridium sp. D5]
          Length = 191

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 3/53 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           ++ AF V +     +    +LL+DD+YTTG T +  A  L+ AGA  V  LT 
Sbjct: 136 LKGAFAVAKNQK--LKEK-VLLVDDIYTTGNTIRRTAKMLRLAGAQKVYFLTI 185


>gi|213965495|ref|ZP_03393690.1| ribose-Phosphate pyrophosphokinase [Corynebacterium amycolatum
           SK46]
 gi|213951879|gb|EEB63266.1| ribose-Phosphate pyrophosphokinase [Corynebacterium amycolatum
           SK46]
          Length = 325

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 25/53 (47%)

Query: 7   VPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           V   V   V+G   LLIDD+  TG T   A   L++AGA  V I T      D
Sbjct: 213 VANRVVGEVSGKTCLLIDDMIDTGGTIAGAVKVLREAGAEDVIIATTHGVFSD 265


>gi|145296693|ref|YP_001139514.1| hypoxanthine-guanine phosphoribosyltransferase [Corynebacterium
           glutamicum R]
 gi|140846613|dbj|BAF55612.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 194

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 10/53 (18%), Positives = 25/53 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + + K + G  +L+++D+  +G T       LK     +++++T  R
Sbjct: 92  GVVRILKDLDKEIEGRDVLIVEDIIDSGLTLSWLMRNLKNRNPKSLNVITLLR 144


>gi|58616813|ref|YP_196012.1| putative competence protein F (DNA transformation protein comF)
           [Ehrlichia ruminantium str. Gardel]
 gi|58416425|emb|CAI27538.1| Similar to competence protein F (DNA transformation protein comF)
           [Ehrlichia ruminantium str. Gardel]
          Length = 230

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 26/46 (56%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
              +    ILL+DDV TTG T +  +  L ++GA  + ++T  R+L
Sbjct: 185 QHKIYNKTILLVDDVVTTGITVRTCSQKLIESGAKEIRVITLGRTL 230


>gi|110803961|ref|YP_699727.1| hypoxanthine phosphoribosyltransferase [Clostridium perfringens
           SM101]
 gi|110684462|gb|ABG87832.1| hypoxanthine phosphoribosyltransferase [Clostridium perfringens
           SM101]
          Length = 183

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 9/51 (17%), Positives = 21/51 (41%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   +    +L+++D+  TG T       LK   A ++ I+  
Sbjct: 81  GVVRILKDLDSDIENKHVLIVEDIVDTGTTLSYLLEYLKARKAASIEIVAL 131


>gi|68535342|ref|YP_250047.1| hypoxanthine phosphoribosyltransferase [Corynebacterium jeikeium
           K411]
 gi|260578434|ref|ZP_05846348.1| hypoxanthine/guanine phosphoribosyltransferase [Corynebacterium
           jeikeium ATCC 43734]
 gi|68262941|emb|CAI36429.1| hypoxanthine phosphoribosyltransferase [Corynebacterium jeikeium
           K411]
 gi|258603456|gb|EEW16719.1| hypoxanthine/guanine phosphoribosyltransferase [Corynebacterium
           jeikeium ATCC 43734]
          Length = 193

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 8/53 (15%), Positives = 25/53 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + + + + G  +++++D+  +G T       L+     ++S++T  R
Sbjct: 92  GVVRILKDLDRDIEGRNVVIVEDIIDSGLTLSWLLKNLRNRNPKSLSVVTLLR 144


>gi|255527900|ref|ZP_05394744.1| conserved hypothetical protein [Clostridium carboxidivorans P7]
 gi|255508400|gb|EET84796.1| conserved hypothetical protein [Clostridium carboxidivorans P7]
          Length = 226

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  +F   +     +    IL++DDV TTGATA   A+ LKK GA  +++LT ++S
Sbjct: 171 IEGSFQFLK--KYCIESKNILIVDDVITTGATAISCALELKKHGAEEITVLTAAKS 224


>gi|238758686|ref|ZP_04619860.1| Predicted amidophosphoribosyltransferase [Yersinia aldovae ATCC
           35236]
 gi|238702983|gb|EEP95526.1| Predicted amidophosphoribosyltransferase [Yersinia aldovae ATCC
           35236]
          Length = 141

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R  F   + +     G  I L+DDV TTG+T    A  L   G  ++ +    R+L
Sbjct: 89  LRGIFRCTESLR----GQHIALLDDVMTTGSTLNEIAKLLWAQGIASLQVWCICRTL 141


>gi|89052786|ref|YP_508237.1| competence protein F, putative [Jannaschia sp. CCS1]
 gi|88862335|gb|ABD53212.1| competence protein F putative [Jannaschia sp. CCS1]
          Length = 242

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 30/59 (50%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  A          + G  ++LIDDV T+GAT   A  A ++AGA  VS+L  +R   D
Sbjct: 183 VDEAIIPHPRKGSAIKGRNVVLIDDVMTSGATLAIATDACRRAGAENVSVLALARVGDD 241


>gi|322830956|ref|YP_004210983.1| phosphoribosyltransferase [Rahnella sp. Y9602]
 gi|321166157|gb|ADW71856.1| phosphoribosyltransferase [Rahnella sp. Y9602]
          Length = 229

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF         +    ++L+DDV TTG+T +  +  L+  G  ++ I    R+L
Sbjct: 175 LRKAFT----CHASLRDKHVMLLDDVVTTGSTVREISKILRNQGVASLQIACICRTL 227


>gi|315038376|ref|YP_004031944.1| hypoxanthine-guanine phosphoribosyltransferase [Lactobacillus
           amylovorus GRL 1112]
 gi|312276509|gb|ADQ59149.1| hypoxanthine-guanine phosphoribosyltransferase [Lactobacillus
           amylovorus GRL 1112]
          Length = 177

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 25/51 (49%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + Q V   V    ++ ++D+  TG T K  +  +K+ GA +V +++ 
Sbjct: 76  GKVKITQDVKSDVKNRPVIFMEDIIDTGRTLKALSDLMKERGAKSVEVISM 126


>gi|121535562|ref|ZP_01667370.1| competence protein F, putative [Thermosinus carboxydivorans Nor1]
 gi|121305890|gb|EAX46824.1| competence protein F, putative [Thermosinus carboxydivorans Nor1]
          Length = 219

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/54 (40%), Positives = 33/54 (61%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF V +   + VAG  +LL+DD++TTG T +  A  LK AGA  V+ L  +
Sbjct: 164 IKGAFYVTR--PELVAGKTLLLVDDIFTTGVTMEECARVLKAAGAKRVAGLAVA 215


>gi|270284409|ref|ZP_06193978.1| hypoxanthine phosphoribosyltransferase [Bifidobacterium gallicum
           DSM 20093]
 gi|270276808|gb|EFA22662.1| hypoxanthine phosphoribosyltransferase [Bifidobacterium gallicum
           DSM 20093]
          Length = 200

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + Q +S  V G  +L+++D+  +G T       LK  GA +V I   
Sbjct: 94  GTITIRQDLSADVKGRDVLIVEDIVDSGYTLNWLVQELKDRGAASVEIFAL 144


>gi|167854889|ref|ZP_02477665.1| competence protein F [Haemophilus parasuis 29755]
 gi|167853956|gb|EDS25194.1| competence protein F [Haemophilus parasuis 29755]
          Length = 162

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 25/56 (44%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF             ++ ++DDV TTG+T       L K G   + + T +R+
Sbjct: 111 LRGAFIYQPKQPY----QRVAIVDDVVTTGSTLNAICTELLKQGVKEIQVWTLARA 162


>gi|256826249|ref|YP_003150209.1| hypoxanthine phosphoribosyltransferase [Kytococcus sedentarius DSM
           20547]
 gi|256689642|gb|ACV07444.1| hypoxanthine phosphoribosyltransferase [Kytococcus sedentarius DSM
           20547]
          Length = 183

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 11/53 (20%), Positives = 22/53 (41%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + +   +    +L+++DV  +G T       L   GA +V + T  R
Sbjct: 82  GVVRILKDLDADITDRHVLVVEDVIDSGLTLSWILENLASRGAASVEVATLLR 134


>gi|77165567|ref|YP_344092.1| competence protein F [Nitrosococcus oceani ATCC 19707]
 gi|254433456|ref|ZP_05046964.1| hypothetical protein NOC27_387 [Nitrosococcus oceani AFC27]
 gi|76883881|gb|ABA58562.1| competence protein F [Nitrosococcus oceani ATCC 19707]
 gi|207089789|gb|EDZ67060.1| hypothetical protein NOC27_387 [Nitrosococcus oceani AFC27]
          Length = 246

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/58 (25%), Positives = 25/58 (43%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +  AF +       +    + ++DDV TTG T    A  L++ G   V + T +R   
Sbjct: 183 LHGAFAL----QGSLTARHVAIMDDVLTTGHTVAELARTLRRGGVQVVEVWTCARVPP 236


>gi|254973792|ref|ZP_05270264.1| putative phosphoribosyl transferase (putative competence protein)
           [Clostridium difficile QCD-66c26]
 gi|255091181|ref|ZP_05320659.1| putative phosphoribosyl transferase (putative competence protein)
           [Clostridium difficile CIP 107932]
 gi|255099293|ref|ZP_05328270.1| putative phosphoribosyl transferase (putative competence protein)
           [Clostridium difficile QCD-63q42]
 gi|255305079|ref|ZP_05349251.1| putative phosphoribosyl transferase (putative competence protein)
           [Clostridium difficile ATCC 43255]
 gi|255312836|ref|ZP_05354419.1| putative phosphoribosyl transferase (putative competence protein)
           [Clostridium difficile QCD-76w55]
 gi|255515595|ref|ZP_05383271.1| putative phosphoribosyl transferase (putative competence protein)
           [Clostridium difficile QCD-97b34]
 gi|255648689|ref|ZP_05395591.1| putative phosphoribosyl transferase (putative competence protein)
           [Clostridium difficile QCD-37x79]
 gi|260681911|ref|YP_003213196.1| putative phosphoribosyl transferase [Clostridium difficile CD196]
 gi|260685509|ref|YP_003216642.1| putative phosphoribosyl transferase [Clostridium difficile R20291]
 gi|306518810|ref|ZP_07405157.1| putative phosphoribosyl transferase (putative competence protein)
           [Clostridium difficile QCD-32g58]
 gi|260208074|emb|CBA60305.1| putative phosphoribosyl transferase (putative competence protein)
           [Clostridium difficile CD196]
 gi|260211525|emb|CBE01691.1| putative phosphoribosyl transferase (putative competence protein)
           [Clostridium difficile R20291]
          Length = 260

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           ++N F V + V   +    ILLIDD++TTG T    +  LK +GA  V +LT 
Sbjct: 198 LKNVFVVKENVKL-INNKNILLIDDIFTTGLTTNEISKLLKLSGANKVFVLTL 249


>gi|126697705|ref|YP_001086602.1| putative phosphoribosyl transferase (putative competence protein)
           [Clostridium difficile 630]
 gi|115249142|emb|CAJ66953.1| putative phosphoribosyl transferase [Clostridium difficile]
          Length = 260

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           ++N F V + V   +    ILLIDD++TTG T    +  LK +GA  V +LT 
Sbjct: 198 LKNVFVVKENVKL-INNKNILLIDDIFTTGLTTNEISKLLKLSGANKVFVLTL 249


>gi|219670750|ref|YP_002461185.1| phosphoribosyltransferase [Desulfitobacterium hafniense DCB-2]
 gi|219541010|gb|ACL22749.1| phosphoribosyltransferase [Desulfitobacterium hafniense DCB-2]
          Length = 276

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSK--HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           + + F +         + G ++ LIDDV TTGAT +  A  LK+ GA  V  L  +
Sbjct: 190 LESVFQIVSSSRGLKQIQGARVWLIDDVTTTGATLEHCAKVLKRGGAAQVYGLVLA 245


>gi|89897623|ref|YP_521110.1| hypothetical protein DSY4877 [Desulfitobacterium hafniense Y51]
 gi|89337071|dbj|BAE86666.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 276

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSK--HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           + + F +         + G ++ LIDDV TTGAT +  A  LK+ GA  V  L  +
Sbjct: 190 LESVFQIVSSSRGLKQIQGARVWLIDDVTTTGATLEHCAKVLKRGGAAQVYGLVLA 245


>gi|117621438|ref|YP_857653.1| ribose-phosphate pyrophosphokinase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117562845|gb|ABK39793.1| ribose-phosphate pyrophosphokinase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 338

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +++DD+  TG T   AA ALK+ GA  V          
Sbjct: 229 HLIGDVAGRDCIIVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPVFS 277


>gi|187934143|ref|YP_001884724.1| competence protein F [Clostridium botulinum B str. Eklund 17B]
 gi|187722296|gb|ACD23517.1| competence protein F [Clostridium botulinum B str. Eklund 17B]
          Length = 217

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  +F+V +     +   KI+LIDDV TTG T +     LKK GA  + +LT ++S
Sbjct: 162 ISGSFDVIK--KIDLTDKKIILIDDVTTTGFTIREGHKILKKYGAKEIKLLTLAKS 215


>gi|313140978|ref|ZP_07803171.1| hypoxanthine phosphoribosyltransferase [Bifidobacterium bifidum
           NCIMB 41171]
 gi|313133488|gb|EFR51105.1| hypoxanthine phosphoribosyltransferase [Bifidobacterium bifidum
           NCIMB 41171]
          Length = 210

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + Q +S  V G  IL+++D+  +G T       LK+ GA +V I   
Sbjct: 107 GTIAIRQDLSCDVRGRHILIVEDIVDSGRTLAWLVEELKRRGAASVEIFAL 157


>gi|299068083|emb|CBJ39297.1| putative amidophosphoribosyltransferase, comF/gntX family
           [Ralstonia solanacearum CMR15]
          Length = 200

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 25/56 (44%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AFNVP     H+AG  I ++DDV TTGAT    A  LK+AGA  V+     R+
Sbjct: 146 LQGAFNVPD--PAHIAGRHIGVVDDVMTTGATLSEIATQLKRAGAARVTNCVALRT 199


>gi|148827631|ref|YP_001292384.1| competence protein F [Haemophilus influenzae PittGG]
 gi|148718873|gb|ABR00001.1| competence protein F [Haemophilus influenzae PittGG]
          Length = 228

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 1/56 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF++           ++ L+DDV TTG+T    +  L+K G   + +   +R+
Sbjct: 174 LKNAFSLAVS-KNEFPYCRVALVDDVITTGSTLNEISKLLRKLGVEEIQVWGLARA 228


>gi|325264333|ref|ZP_08131064.1| hypoxanthine phosphoribosyltransferase [Clostridium sp. D5]
 gi|324030404|gb|EGB91688.1| hypoxanthine phosphoribosyltransferase [Clostridium sp. D5]
          Length = 176

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 7/51 (13%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + + + + G  +L+++D+  +G T       L++    ++ + T 
Sbjct: 77  GVVRIAKDLDESIEGKDVLIVEDIIDSGRTLYYLMDTLRQRHPKSLHLCTL 127


>gi|312898396|ref|ZP_07757786.1| amidophosphoribosyltransferase [Megasphaera micronuciformis F0359]
 gi|310620315|gb|EFQ03885.1| amidophosphoribosyltransferase [Megasphaera micronuciformis F0359]
          Length = 475

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 24/48 (50%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           V   V G +I+++DD    G T+      L++AGA  V +   +  +K
Sbjct: 346 VKSVVKGKRIVMVDDSIVRGTTSGIICRLLREAGAKEVYMCVSAPPVK 393


>gi|325956772|ref|YP_004292184.1| hypoxanthine-guanine phosphoribosyltransferase [Lactobacillus
           acidophilus 30SC]
 gi|325333337|gb|ADZ07245.1| hypoxanthine-guanine phosphoribosyltransferase [Lactobacillus
           acidophilus 30SC]
          Length = 177

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 25/51 (49%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + Q V   V    ++ ++D+  TG T K  +  +K+ GA +V +++ 
Sbjct: 76  GKVKITQDVKSDVKNRPVIFMEDIIDTGRTLKALSDLMKERGAKSVEVISM 126


>gi|297588662|ref|ZP_06947305.1| hypoxanthine phosphoribosyltransferase [Finegoldia magna ATCC
           53516]
 gi|297574035|gb|EFH92756.1| hypoxanthine phosphoribosyltransferase [Finegoldia magna ATCC
           53516]
          Length = 186

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + + + +AG  IL+++D+  +G T       L    A +V I T 
Sbjct: 82  GTVRIIKDLEEDIAGKNILIVEDIVDSGRTLNYLVRNLMDRKAKSVKIATL 132


>gi|78188183|ref|YP_378521.1| competence protein [Chlorobium chlorochromatii CaD3]
 gi|78170382|gb|ABB27478.1| competence protein [Chlorobium chlorochromatii CaD3]
          Length = 269

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 30/58 (51%), Gaps = 4/58 (6%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
             AF     +        +LL+DDV TTGAT   AA AL  AG   VSI+T + + K+
Sbjct: 215 EGAFCAKAPLRIG----HVLLVDDVLTTGATMVAAAQALHDAGVAKVSIVTVAVAAKE 268


>gi|194015240|ref|ZP_03053856.1| ComF operon protein 3 [Bacillus pumilus ATCC 7061]
 gi|194012644|gb|EDW22210.1| ComF operon protein 3 [Bacillus pumilus ATCC 7061]
          Length = 228

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  F + Q     +   +++LIDD+YTTGAT   AA  LK+AGA +VS  T  RS
Sbjct: 176 KGMFQITQT--DAIVQREVILIDDIYTTGATIYDAARILKEAGAKSVSSFTLIRS 228


>gi|323340113|ref|ZP_08080378.1| hypoxanthine phosphoribosyltransferase [Lactobacillus ruminis ATCC
           25644]
 gi|323092490|gb|EFZ35097.1| hypoxanthine phosphoribosyltransferase [Lactobacillus ruminis ATCC
           25644]
          Length = 180

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V G  +L+++D+  TG T       LK   A +V I T 
Sbjct: 77  GEVKIIKDLDVSVKGRNVLIVEDIIDTGRTLASLVELLKSRDAASVKICTL 127


>gi|213410367|ref|XP_002175953.1| ribose-phosphate pyrophosphokinase [Schizosaccharomyces japonicus
           yFS275]
 gi|212004000|gb|EEB09660.1| ribose-phosphate pyrophosphokinase [Schizosaccharomyces japonicus
           yFS275]
          Length = 344

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 25/56 (44%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           AF     +   V     +LIDD+  TG T   AA  LK+ GA T+  L     L D
Sbjct: 226 AFGTSLMLVGDVRNKVAILIDDLVDTGTTLVRAAELLKEHGASTIYALVTHAVLSD 281


>gi|158320387|ref|YP_001512894.1| hypoxanthine phosphoribosyltransferase [Alkaliphilus oremlandii
           OhILAs]
 gi|158140586|gb|ABW18898.1| hypoxanthine phosphoribosyltransferase [Alkaliphilus oremlandii
           OhILAs]
          Length = 180

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   + G  +L+I+D+  TG T K     LK     +V I T 
Sbjct: 78  GIVRILKDLDLEIEGKHVLIIEDIIDTGLTLKYLTDNLKSRNTKSVKICTL 128


>gi|297531385|ref|YP_003672660.1| phosphoribosyltransferase [Geobacillus sp. C56-T3]
 gi|297254637|gb|ADI28083.1| phosphoribosyltransferase [Geobacillus sp. C56-T3]
          Length = 230

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/45 (46%), Positives = 29/45 (64%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
              + G +I+LIDD+YTTG T + AA+ L +AGA  V  LT  R+
Sbjct: 186 HPPIDGKRIVLIDDIYTTGITVRHAALVLLEAGAAEVGALTLIRA 230


>gi|225022111|ref|ZP_03711303.1| hypothetical protein CORMATOL_02144 [Corynebacterium matruchotii
           ATCC 33806]
 gi|224945044|gb|EEG26253.1| hypothetical protein CORMATOL_02144 [Corynebacterium matruchotii
           ATCC 33806]
          Length = 198

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 10/53 (18%), Positives = 26/53 (49%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + + +++AG  +L+++D+  +G T       LK     ++ ++T  R
Sbjct: 95  GVVRILKDLDRNIAGRDVLIVEDIIDSGLTLSWLVRNLKNRKPKSLEVVTLLR 147


>gi|167628195|ref|YP_001678694.1| hypoxanthine phosphoribosyltransferase [Heliobacterium
           modesticaldum Ice1]
 gi|167590935|gb|ABZ82683.1| hypoxanthine phosphoribosyltransferase [Heliobacterium
           modesticaldum Ice1]
          Length = 179

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 13/50 (26%), Positives = 24/50 (48%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
            A  + + + + +    IL+++D+  TG T       LK  GA +V + T
Sbjct: 77  GAVRILKDLDRAIENRHILIVEDIVDTGLTLNYLMDNLKSRGAASVKVCT 126


>gi|255654224|ref|ZP_05399633.1| putative phosphoribosyl transferase (putative competence protein)
           [Clostridium difficile QCD-23m63]
 gi|296452508|ref|ZP_06894205.1| ComF family protein [Clostridium difficile NAP08]
 gi|296881080|ref|ZP_06905023.1| ComF family protein [Clostridium difficile NAP07]
 gi|296258613|gb|EFH05511.1| ComF family protein [Clostridium difficile NAP08]
 gi|296427946|gb|EFH13850.1| ComF family protein [Clostridium difficile NAP07]
          Length = 260

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           ++N F V + +   +    ILLIDD++TTG T    +  LK +GA  V +LT 
Sbjct: 198 LKNVFVVKENIKL-INNKNILLIDDIFTTGLTTNEISKLLKLSGANKVFVLTL 249


>gi|190571652|ref|YP_001976010.1| competence protein f [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213019054|ref|ZP_03334861.1| competence protein f [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357924|emb|CAQ55385.1| competence protein f [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995163|gb|EEB55804.1| competence protein f [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 234

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++N F V    S+ +    ++L+DDV T GATA+  +  +  +GA  V +L+ +R++
Sbjct: 180 LKNTFKVSN--SEIIKNKIVILVDDVVTIGATARSCSQEILNSGAREVRVLSLARTV 234


>gi|163742650|ref|ZP_02150036.1| competence protein F, putative [Phaeobacter gallaeciensis 2.10]
 gi|161384235|gb|EDQ08618.1| competence protein F, putative [Phaeobacter gallaeciensis 2.10]
          Length = 174

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 27/57 (47%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +  +       ++ + G  +LL+DDV T+GAT    + A   AGA  V +   +R  
Sbjct: 116 LAQSIAAHPKHAERINGRIVLLVDDVMTSGATLSACSEACLDAGATGVRVAVLARVT 172


>gi|148979552|ref|ZP_01815583.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrionales
           bacterium SWAT-3]
 gi|145961736|gb|EDK27032.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrionales
           bacterium SWAT-3]
          Length = 176

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 11/49 (22%), Positives = 21/49 (42%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
             + + +   + G  +LL++D+  TG T       L   G  ++ I T 
Sbjct: 79  VRILKDLDDDIQGKDVLLVEDIIDTGNTLTKVKEILSLRGPKSIEICTL 127


>gi|223040317|ref|ZP_03610593.1| ribose-Phosphate pyrophosphokinase (rppk)
           (phosphoribosylpyrophosphate synthetase) (p-rib-pp
           synthetase) (prpp synthetase) [Campylobacter rectus
           RM3267]
 gi|222878386|gb|EEF13491.1| ribose-Phosphate pyrophosphokinase (rppk)
           (phosphoribosylpyrophosphate synthetase) (p-rib-pp
           synthetase) (prpp synthetase) [Campylobacter rectus
           RM3267]
          Length = 309

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 23/46 (50%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
             VAG  ++L+DD+  TG T   AA   K+ GA +V+       L 
Sbjct: 207 GDVAGKDVILVDDMIDTGGTIVKAARVFKERGATSVTACCTHAVLS 252


>gi|226365197|ref|YP_002782980.1| ribose-phosphate pyrophosphokinase [Rhodococcus opacus B4]
 gi|226243687|dbj|BAH54035.1| phosphoribosylpyrophosphate synthase [Rhodococcus opacus B4]
          Length = 326

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 23/52 (44%)

Query: 8   PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
              V   V G   +LIDD+  TG T   A   LK+AGA  V I      L D
Sbjct: 214 SNRVVGDVEGRTCILIDDMIDTGGTIAGAVKILKEAGAGDVIIAATHGVLSD 265


>gi|45658877|ref|YP_002963.1| ComFC-like protein [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
 gi|45602122|gb|AAS71600.1| ComFC-like protein [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
          Length = 251

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           AF + +     + G   LLIDDV+TTGA+A   A  L + GA +V ILT  R+
Sbjct: 186 AFKIKKEYKGKLKG-NYLLIDDVFTTGASANELARILIQNGADSVRILTLIRT 237


>gi|227510664|ref|ZP_03940713.1| late competence protein [Lactobacillus brevis subsp. gravesensis
           ATCC 27305]
 gi|227190316|gb|EEI70383.1| late competence protein [Lactobacillus brevis subsp. gravesensis
           ATCC 27305]
          Length = 229

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 30/51 (58%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           F +  + S+ +    I+++DDVYTTG T + AA  L +AGA  V   T +R
Sbjct: 179 FELIDHESELIREKTIVVVDDVYTTGTTIRHAAGLLYRAGARCVKGFTLAR 229


>gi|86148295|ref|ZP_01066590.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio sp. MED222]
 gi|218710499|ref|YP_002418120.1| hypoxanthine phosphoribosyltransferase [Vibrio splendidus LGP32]
 gi|85833920|gb|EAQ52083.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio sp. MED222]
 gi|218323518|emb|CAV19697.1| Hypoxanthine phosphoribosyltransferase [Vibrio splendidus LGP32]
          Length = 176

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 11/49 (22%), Positives = 21/49 (42%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
             + + +   + G  +LL++D+  TG T       L   G  ++ I T 
Sbjct: 79  VRILKDLDDDIQGKDVLLVEDIIDTGNTLTKVKEILSLRGPKSIEICTL 127


>gi|212716400|ref|ZP_03324528.1| hypothetical protein BIFCAT_01323 [Bifidobacterium catenulatum DSM
           16992]
 gi|225350935|ref|ZP_03741958.1| hypothetical protein BIFPSEUDO_02510 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|212660653|gb|EEB21228.1| hypothetical protein BIFCAT_01323 [Bifidobacterium catenulatum DSM
           16992]
 gi|225158391|gb|EEG71633.1| hypothetical protein BIFPSEUDO_02510 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 190

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               V Q +S  V G  +L+++D+  +G T       LK  GA +V I   
Sbjct: 85  GKITVRQDLSTDVRGRHVLIVEDIIDSGVTLAWLVDELKSRGAASVEIFAL 135


>gi|256823349|ref|YP_003147312.1| competence protein F [Kangiella koreensis DSM 16069]
 gi|256796888|gb|ACV27544.1| competence protein F [Kangiella koreensis DSM 16069]
          Length = 235

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 5/56 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF V Q +        I L+DDV TTG+T + A+    K G   + +   +++
Sbjct: 185 LKRAFAVKQSMP-----RHIALVDDVVTTGSTIQEASKQCLKHGVERIDVWCLAKT 235


>gi|15603421|ref|NP_246495.1| ComF [Pasteurella multocida subsp. multocida str. Pm70]
 gi|12721947|gb|AAK03640.1| ComF [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 228

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R+AF +      H     + LIDDV TTGAT    A+ LKKAG   + +   +++
Sbjct: 174 LRHAFRLHPKSQTH-RYQSVALIDDVITTGATLNELALLLKKAGVEHIQVWGLAKT 228


>gi|312897985|ref|ZP_07757394.1| ComF family protein [Megasphaera micronuciformis F0359]
 gi|310620910|gb|EFQ04461.1| ComF family protein [Megasphaera micronuciformis F0359]
          Length = 217

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 34/54 (62%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF V     K V   ++LL+DDVYTTGAT +  A ALK+ GA+ V+ L  +
Sbjct: 162 LKAAFTVVAG--KTVKDCRLLLVDDVYTTGATLQACAAALKRNGAVEVTGLVIA 213


>gi|326202852|ref|ZP_08192719.1| phosphoribosyltransferase [Clostridium papyrosolvens DSM 2782]
 gi|325986929|gb|EGD47758.1| phosphoribosyltransferase [Clostridium papyrosolvens DSM 2782]
          Length = 223

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + +AF         +A   ILLIDD+ TTG+T      ALK+AGA  V     + +
Sbjct: 167 LEDAFMAVND--GLIADKNILLIDDIVTTGSTVNQCCKALKQAGAEKVIAGVIATT 220


>gi|24213204|ref|NP_710685.1| ComFC-like protein [Leptospira interrogans serovar Lai str. 56601]
 gi|24193923|gb|AAN47703.1| ComFC-like protein [Leptospira interrogans serovar Lai str. 56601]
          Length = 251

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           AF + +   + + G   LLIDDV+TTGA+A   A  L + GA +V ILT  R+
Sbjct: 186 AFKIKKEYKEKLKG-NYLLIDDVFTTGASANELARILIQNGADSVRILTLIRT 237


>gi|253681226|ref|ZP_04862024.1| hypoxanthine phosphoribosyltransferase [Clostridium botulinum D
           str. 1873]
 gi|253562464|gb|EES91915.1| hypoxanthine phosphoribosyltransferase [Clostridium botulinum D
           str. 1873]
          Length = 179

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V G  IL+I+D+  TG T +     LK     +VS+   
Sbjct: 77  GVVRILKDLEFEVEGRDILIIEDIVDTGTTLEYLRTYLKSKNPNSVSVACL 127


>gi|293402455|ref|ZP_06646591.1| putative competence protein [Erysipelotrichaceae bacterium
           5_2_54FAA]
 gi|291304118|gb|EFE45371.1| putative competence protein [Erysipelotrichaceae bacterium
           5_2_54FAA]
          Length = 410

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 4/54 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++ AF V +    ++AG  ILL+DDVY++G+T    A  L  AGA  VS +  +
Sbjct: 282 VKGAFEVTE----NIAGKSILLMDDVYSSGSTFLEVAKTLYAAGAKNVSGVLLA 331


>gi|229917402|ref|YP_002886048.1| hypoxanthine phosphoribosyltransferase [Exiguobacterium sp. AT1b]
 gi|229468831|gb|ACQ70603.1| hypoxanthine phosphoribosyltransferase [Exiguobacterium sp. AT1b]
          Length = 181

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + ++  V G  IL+++D+  +G T       LK   A +V I+T 
Sbjct: 79  GEVKIEKDLNTSVEGRDILIVEDIIDSGLTLGYLVDLLKYRKAKSVKIVTL 129


>gi|126662577|ref|ZP_01733576.1| ribose-phosphate diphosphokinase (phosphoribosylpyrophosphate
           synthetase) [Flavobacteria bacterium BAL38]
 gi|126625956|gb|EAZ96645.1| ribose-phosphate diphosphokinase (phosphoribosylpyrophosphate
           synthetase) [Flavobacteria bacterium BAL38]
          Length = 313

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 24/49 (48%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            +   V G  ++L+DD+  TG T   AA  + + GA++V  +     L 
Sbjct: 207 ELIGDVKGRNVILVDDMIDTGGTLAKAADVMMEKGALSVRAICTHPILS 255


>gi|88854793|ref|ZP_01129459.1| hypoxanthine phosphoribosyltransferase [marine actinobacterium
           PHSC20C1]
 gi|88815954|gb|EAR25810.1| hypoxanthine phosphoribosyltransferase [marine actinobacterium
           PHSC20C1]
          Length = 183

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 13/53 (24%), Positives = 25/53 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + +   + G K+L+++D+  +G T       L+  GA +V I T  R
Sbjct: 82  GVVRILKDLDTDLEGRKVLIVEDIIDSGLTLSWLLGNLRSRGAESVEICTLLR 134


>gi|331268351|ref|YP_004394843.1| hypoxanthine phosphoribosyltransferase [Clostridium botulinum
           BKT015925]
 gi|329124901|gb|AEB74846.1| hypoxanthine phosphoribosyltransferase [Clostridium botulinum
           BKT015925]
          Length = 179

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V G  IL+++D+  TG T +     LK     +VS+   
Sbjct: 77  GVVRILKDLEFEVEGRDILIVEDIVDTGTTLEYLRTYLKSKNPNSVSVACL 127


>gi|305680405|ref|ZP_07403213.1| hypoxanthine phosphoribosyltransferase [Corynebacterium matruchotii
           ATCC 14266]
 gi|305659936|gb|EFM49435.1| hypoxanthine phosphoribosyltransferase [Corynebacterium matruchotii
           ATCC 14266]
          Length = 198

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 10/53 (18%), Positives = 26/53 (49%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + + +++AG  +L+++D+  +G T       LK     ++ ++T  R
Sbjct: 95  GVVRILKDLDRNIAGRDVLIVEDIIDSGLTLSWLVRNLKNRKPKSLEVVTLLR 147


>gi|325963931|ref|YP_004241837.1| amidophosphoribosyltransferase [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323470018|gb|ADX73703.1| putative amidophosphoribosyltransferase [Arthrobacter
           phenanthrenivorans Sphe3]
          Length = 299

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 31/58 (53%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R +  V +   K VAG + ++IDDV TTGAT   AA AL  AGA     +  + +  
Sbjct: 213 VRGSMQVRKRGRKRVAGRRCIIIDDVLTTGATLAEAARALHGAGAQVAGAVVLAATRP 270


>gi|283455477|ref|YP_003360041.1| hprT Hypoxanthine-guanine phosphoribosyltransferase
           [Bifidobacterium dentium Bd1]
 gi|283102111|gb|ADB09217.1| hprT Hypoxanthine-guanine phosphoribosyltransferase
           [Bifidobacterium dentium Bd1]
          Length = 189

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               V Q +S  V G  +L+++D+  +G T       LK+ GA +V I   
Sbjct: 84  GTITVRQDLSTDVRGRHVLIVEDIIDSGITLSWLVDELKRRGAASVEIFAL 134


>gi|148272022|ref|YP_001221583.1| hypothetical protein CMM_0843 [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|147829952|emb|CAN00877.1| hptA [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
          Length = 183

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 10/53 (18%), Positives = 24/53 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + +   + G ++L+++D+  +G T       L+  GA +V +    R
Sbjct: 82  GVVRILKDLDADLTGRRVLIVEDIIDSGLTLSWLLANLRSRGAASVEVCALLR 134


>gi|153955305|ref|YP_001396070.1| amidophosphoribosyltransferase [Clostridium kluyveri DSM 555]
 gi|146348163|gb|EDK34699.1| PurF [Clostridium kluyveri DSM 555]
          Length = 483

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           A  +   +  +V G +++++DD    G T+K     L++AGA  V +   S  +K
Sbjct: 351 AVKLNP-LKVNVEGKRVIIVDDSIVRGTTSKKLVEILRRAGATEVHLRVSSPVVK 404


>gi|92114417|ref|YP_574345.1| hypothetical protein Csal_2296 [Chromohalobacter salexigens DSM
           3043]
 gi|91797507|gb|ABE59646.1| conserved hypothetical protein [Chromohalobacter salexigens DSM
           3043]
          Length = 241

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 5/58 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF V   +   VA     L+DDV TTG+T    A + + +GA  V     +R+ +
Sbjct: 187 VRGAFRVAPGLPARVA-----LVDDVMTTGSTLSALAESCRGSGAQQVEAWAMARTPR 239


>gi|331003928|ref|ZP_08327417.1| hypoxanthine phosphoribosyltransferase [Lachnospiraceae oral taxon
           107 str. F0167]
 gi|330411948|gb|EGG91348.1| hypoxanthine phosphoribosyltransferase [Lachnospiraceae oral taxon
           107 str. F0167]
          Length = 175

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 9/51 (17%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   + G  +L+++D+  +G T       L+K G  ++ + T 
Sbjct: 76  GVVKIIKDLDNSIEGRDVLIVEDIIDSGNTLAYLLDILEKRGPKSIKLCTL 126


>gi|258406303|ref|YP_003199045.1| competence protein F [Desulfohalobium retbaense DSM 5692]
 gi|257798530|gb|ACV69467.1| competence protein F [Desulfohalobium retbaense DSM 5692]
          Length = 256

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           MR+AF V   +        +LL+DDV+TTGAT    A  L +AG   + +LT +R+
Sbjct: 202 MRDAFAVFGEI--SWHERNVLLVDDVFTTGATLSACARRLCEAGVARLGVLTMARA 255


>gi|166033185|ref|ZP_02236014.1| hypothetical protein DORFOR_02907 [Dorea formicigenerans ATCC
          27755]
 gi|166027542|gb|EDR46299.1| hypothetical protein DORFOR_02907 [Dorea formicigenerans ATCC
          27755]
          Length = 129

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 10/51 (19%), Positives = 24/51 (47%)

Query: 3  NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
              + + + + + G  +L+++D+  +G T       LKK G  ++ + T 
Sbjct: 30 GVVKIAKDLDETLEGKDVLIVEDIIDSGRTLSYLIEILKKRGPKSLRLCTL 80


>gi|237735418|ref|ZP_04565899.1| conserved hypothetical protein [Mollicutes bacterium D7]
 gi|229381163|gb|EEO31254.1| conserved hypothetical protein [Coprobacillus sp. D7]
          Length = 590

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 25/47 (53%)

Query: 7   VPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           V Q + + V+G  +L+++D+  TG T       L K  A +V I+T 
Sbjct: 493 VKQDLKEDVSGKNVLIVEDILDTGKTLFNVKEMLLKRKANSVKIVTM 539


>gi|167754850|ref|ZP_02426977.1| hypothetical protein CLORAM_00354 [Clostridium ramosum DSM 1402]
 gi|167704900|gb|EDS19479.1| hypothetical protein CLORAM_00354 [Clostridium ramosum DSM 1402]
          Length = 599

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 25/47 (53%)

Query: 7   VPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           V Q + + V+G  +L+++D+  TG T       L K  A +V I+T 
Sbjct: 502 VKQDLKEDVSGKNVLIVEDILDTGKTLFNVKEMLLKRKANSVKIVTM 548


>gi|149190639|ref|ZP_01868907.1| ComF-related protein [Vibrio shilonii AK1]
 gi|148835522|gb|EDL52491.1| ComF-related protein [Vibrio shilonii AK1]
          Length = 192

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF++ Q          + +IDDV TTGAT +  +  L   G   + I    R+ K
Sbjct: 139 VRRAFSLHQRPKAS----HVAIIDDVVTTGATVRHLSELLLDVGVEKIDIYCLCRTPK 192


>gi|291549967|emb|CBL26229.1| Predicted amidophosphoribosyltransferases [Ruminococcus torques
           L2-14]
          Length = 224

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 3/53 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           ++ AF V +  +       ILLIDD+YTTG+T + AA  LKKAG   V  LT 
Sbjct: 169 LKGAFAVSKSWNPR---QNILLIDDIYTTGSTIERAAGILKKAGVENVYFLTL 218


>gi|309802568|ref|ZP_07696672.1| hypoxanthine phosphoribosyltransferase [Bifidobacterium dentium
           JCVIHMP022]
 gi|308220632|gb|EFO76940.1| hypoxanthine phosphoribosyltransferase [Bifidobacterium dentium
           JCVIHMP022]
          Length = 187

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               V Q +S  V G  +L+++D+  +G T       LK+ GA +V I   
Sbjct: 82  GTITVRQDLSTDVRGRHVLIVEDIIDSGITLSWLVDELKRRGAASVEIFAL 132


>gi|256379590|ref|YP_003103250.1| phosphoribosyltransferase [Actinosynnema mirum DSM 43827]
 gi|255923893|gb|ACU39404.1| phosphoribosyltransferase [Actinosynnema mirum DSM 43827]
          Length = 247

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 18/45 (40%), Positives = 26/45 (57%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
              V G  + ++DDV+TTG T    A  L++AGA  V  LT +R+
Sbjct: 200 PAAVHGATVAVVDDVFTTGNTLNAVARRLREAGARAVRGLTLARA 244


>gi|189347657|ref|YP_001944186.1| phosphoribosyltransferase [Chlorobium limicola DSM 245]
 gi|189341804|gb|ACD91207.1| phosphoribosyltransferase [Chlorobium limicola DSM 245]
          Length = 230

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 4/59 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF  P      + G  ILL+DDV TTG+T   AA AL+  GA ++S+   + + K+
Sbjct: 176 LEGAFRTP---LSDIPGR-ILLVDDVVTTGSTVVAAASALRNGGAGSISVAALALTGKE 230


>gi|227497059|ref|ZP_03927309.1| hypoxanthine phosphoribosyltransferase [Actinomyces urogenitalis
           DSM 15434]
 gi|226833456|gb|EEH65839.1| hypoxanthine phosphoribosyltransferase [Actinomyces urogenitalis
           DSM 15434]
          Length = 179

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 12/53 (22%), Positives = 23/53 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + +   + G  +L+++D+  +G T       L   GA +V I T  R
Sbjct: 77  GVVRILKDLDADLTGRHVLIVEDIIDSGLTLSWLVGNLSSRGAASVEIATLLR 129


>gi|219855726|ref|YP_002472848.1| hypothetical protein CKR_2383 [Clostridium kluyveri NBRC 12016]
 gi|219569450|dbj|BAH07434.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 500

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           A  +   +  +V G +++++DD    G T+K     L++AGA  V +   S  +K
Sbjct: 368 AVKLNP-LKVNVEGKRVIIVDDSIVRGTTSKKLVEILRRAGATEVHLRVSSPVVK 421


>gi|46445939|ref|YP_007304.1| putative competence-related protein comF [Candidatus Protochlamydia
           amoebophila UWE25]
 gi|46399580|emb|CAF23029.1| putative competence-related protein comF [Candidatus Protochlamydia
           amoebophila UWE25]
          Length = 241

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++  F + +     +   ++LLIDDV TTG T    A AL +    ++  LTF R+ 
Sbjct: 184 LKQVFKLKKTFQ--IQDKRVLLIDDVMTTGTTLHKCAEALSEGFPGSLYALTFCRTT 238


>gi|171741154|ref|ZP_02916961.1| hypothetical protein BIFDEN_00221 [Bifidobacterium dentium ATCC
           27678]
 gi|306823452|ref|ZP_07456827.1| hypoxanthine phosphoribosyltransferase [Bifidobacterium dentium
           ATCC 27679]
 gi|171276768|gb|EDT44429.1| hypothetical protein BIFDEN_00221 [Bifidobacterium dentium ATCC
           27678]
 gi|304553159|gb|EFM41071.1| hypoxanthine phosphoribosyltransferase [Bifidobacterium dentium
           ATCC 27679]
          Length = 190

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               V Q +S  V G  +L+++D+  +G T       LK+ GA +V I   
Sbjct: 85  GTITVRQDLSTDVRGRHVLIVEDIIDSGITLSWLVDELKRRGAASVEIFAL 135


>gi|116622521|ref|YP_824677.1| phosphoribosyltransferase [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116225683|gb|ABJ84392.1| phosphoribosyltransferase [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 224

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 29/56 (51%), Positives = 39/56 (69%), Gaps = 5/56 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + +AF      S+ VAG +ILLIDDV TTG+TA   A+ALK+AGA  V++LT +R 
Sbjct: 154 VASAFR-----SRGVAGRRILLIDDVMTTGSTATSCALALKRAGAKRVALLTVARV 204


>gi|188589495|ref|YP_001919911.1| competence protein F [Clostridium botulinum E3 str. Alaska E43]
 gi|188499776|gb|ACD52912.1| competence protein F [Clostridium botulinum E3 str. Alaska E43]
          Length = 217

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  +F+V +     +   KI+LIDDV TTG T       LKK GA  + +LT ++S
Sbjct: 162 ISGSFDVIK--KIDLIDKKIILIDDVATTGFTITEGYKILKKYGAKEIKLLTLAKS 215


>gi|293393404|ref|ZP_06637715.1| competence protein F [Serratia odorifera DSM 4582]
 gi|291424005|gb|EFE97223.1| competence protein F [Serratia odorifera DSM 4582]
          Length = 213

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R AF   +     +AG  + L+DDV TTG+T    A  L+  G  ++ I    R+L
Sbjct: 161 LRAAFCCHE----DLAGRHVALLDDVLTTGSTVTAIATMLQAQGVASLQIWCICRTL 213


>gi|148258762|ref|YP_001243347.1| putative competence protein F (COMF) [Bradyrhizobium sp. BTAi1]
 gi|146410935|gb|ABQ39441.1| putative competence protein F (COMF) [Bradyrhizobium sp. BTAi1]
          Length = 267

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 34/57 (59%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF V       V G +I+++DDV TTGAT    A AL +A A  VS+L F+R +
Sbjct: 204 VQGAFQVSPDRLHEVQGRRIVIVDDVLTTGATVDACARALLRAKAAEVSVLVFARVV 260


>gi|309810911|ref|ZP_07704712.1| hypoxanthine phosphoribosyltransferase [Dermacoccus sp. Ellin185]
 gi|308435217|gb|EFP59048.1| hypoxanthine phosphoribosyltransferase [Dermacoccus sp. Ellin185]
          Length = 207

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 10/53 (18%), Positives = 23/53 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + +   ++G  +L+++D+  +G T       L+     +V I T  R
Sbjct: 106 GVVRILKDLDADISGRHVLIVEDIIDSGLTLSWIRSNLESRNPASVEICTLLR 158


>gi|313111882|ref|ZP_07797672.1| putative phosphoribosyltransferase [Pseudomonas aeruginosa 39016]
 gi|310884174|gb|EFQ42768.1| putative phosphoribosyltransferase [Pseudomonas aeruginosa 39016]
          Length = 76

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 1  MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
          +R+AF +       V GL + L+DDV TTGATA+C +  L++AGA  V +   +R+ K
Sbjct: 19 LRHAFALAPA--SDVRGLHLALVDDVLTTGATAECLSRLLRRAGAARVDVYCLARTPK 74


>gi|49474081|ref|YP_032123.1| amidophosphoribosyltransferase [Bartonella quintana str. Toulouse]
 gi|49239585|emb|CAF25942.1| Amidophosphoribosyltransferase precursor [Bartonella quintana str.
           Toulouse]
          Length = 510

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 22/50 (44%), Gaps = 3/50 (6%)

Query: 4   AFNV---PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
           AF V          + G +++L+DD    G T+      L+ AGA  V +
Sbjct: 362 AFGVKLKHSANRPVIEGKRVILVDDSIVRGTTSVKIVRMLRDAGAKEVHM 411


>gi|257867997|ref|ZP_05647650.1| amidophosphoribosyl transferase [Enterococcus casseliflavus EC30]
 gi|257874327|ref|ZP_05653980.1| amidophosphoribosyl transferase [Enterococcus casseliflavus EC10]
 gi|257802080|gb|EEV30983.1| amidophosphoribosyl transferase [Enterococcus casseliflavus EC30]
 gi|257808491|gb|EEV37313.1| amidophosphoribosyl transferase [Enterococcus casseliflavus EC10]
          Length = 480

 Score = 62.2 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 14/41 (34%), Positives = 22/41 (53%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
            V   V G +++L+DD    G T++     LK+AGA  V +
Sbjct: 349 AVRGVVEGKRVILVDDSIVRGTTSRRIVQLLKEAGAKEVHV 389


>gi|251780262|ref|ZP_04823182.1| competence protein F [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
 gi|243084577|gb|EES50467.1| competence protein F [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
          Length = 217

 Score = 62.2 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  +F+V +     +   KI+LIDDV TTG T       LKK GA  + +LT ++S
Sbjct: 162 ISGSFDVIK--KIDLIDKKIILIDDVATTGFTITEGYKILKKYGAKEIKLLTLAKS 215


>gi|228469788|ref|ZP_04054746.1| ribose-phosphate pyrophosphokinase [Porphyromonas uenonis 60-3]
 gi|228308627|gb|EEK17378.1| ribose-phosphate pyrophosphokinase [Porphyromonas uenonis 60-3]
          Length = 312

 Score = 62.2 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 14/47 (29%), Positives = 22/47 (46%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
             VAG  ++L+DD+  T  T   AA  + + GA +V        + D
Sbjct: 209 GDVAGKDVILVDDIVDTAGTMTKAADLMLEHGAKSVRAFATHAVMSD 255


>gi|188997021|ref|YP_001931272.1| amidophosphoribosyltransferase [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188932088|gb|ACD66718.1| amidophosphoribosyltransferase [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 466

 Score = 62.2 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 24/42 (57%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51
            V + + G +++++DD    G T+K     L+KAGA  V +L
Sbjct: 345 PVREAIEGKRVIVVDDSIVRGTTSKKIVNMLRKAGAKEVHML 386


>gi|58700140|ref|ZP_00374654.1| putative amidophosphoribosyltransferase [Wolbachia endosymbiont
          of Drosophila ananassae]
 gi|58533342|gb|EAL57827.1| putative amidophosphoribosyltransferase [Wolbachia endosymbiont
          of Drosophila ananassae]
          Length = 85

 Score = 62.2 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 1  MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
          ++ AF       K +    ++L+DDV TTGAT +  +  +  +GA  V +L+ +R++ D
Sbjct: 22 LKKAFK--TSNKKIIENKIVILVDDVVTTGATVRSCSQEILNSGAKEVRVLSLARTVND 78


>gi|319407556|emb|CBI81206.1| competence protein ComF [Bartonella sp. 1-1C]
          Length = 247

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 33/59 (55%), Positives = 40/59 (67%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++NAF VP  V K++ G  ILLIDDV TTG T   A   LK AGA  V++LTFSR LK+
Sbjct: 182 VQNAFKVPNEVKKYLEGRSILLIDDVLTTGVTVTAATKTLKHAGARQVNVLTFSRVLKN 240


>gi|269102022|ref|ZP_06154719.1| ribose-phosphate pyrophosphokinase [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268161920|gb|EEZ40416.1| ribose-phosphate pyrophosphokinase [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 315

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 22/49 (44%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +++DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HLIGDVEGRDCIIVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPVFS 254


>gi|227544680|ref|ZP_03974729.1| hypoxanthine phosphoribosyltransferase [Lactobacillus reuteri
           CF48-3A]
 gi|300909078|ref|ZP_07126541.1| hypoxanthine phosphoribosyltransferase [Lactobacillus reuteri
           SD2112]
 gi|227185326|gb|EEI65397.1| hypoxanthine phosphoribosyltransferase [Lactobacillus reuteri
           CF48-3A]
 gi|300894485|gb|EFK87843.1| hypoxanthine phosphoribosyltransferase [Lactobacillus reuteri
           SD2112]
          Length = 180

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 10/51 (19%), Positives = 21/51 (41%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               +   +   V    +L+++D+  TG T K     L   GA ++ + + 
Sbjct: 77  GKVKLIHDLKTDVKDRHVLIMEDIVDTGHTLKYLMDLLADRGAKSIKVCSL 127


>gi|91217229|ref|ZP_01254190.1| ribose-phosphate pyrophosphokinase [Psychroflexus torquis ATCC
           700755]
 gi|91184572|gb|EAS70954.1| ribose-phosphate pyrophosphokinase [Psychroflexus torquis ATCC
           700755]
          Length = 351

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 13/49 (26%), Positives = 22/49 (44%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            +   V G  ++L+DD+  T  T   AA  + + GA +V  +     L 
Sbjct: 245 ELIGDVTGKNVVLVDDMVDTAGTLTHAANLMIERGAKSVRAVCSHPVLS 293


>gi|227494493|ref|ZP_03924809.1| hypoxanthine phosphoribosyltransferase [Actinomyces coleocanis DSM
           15436]
 gi|226832227|gb|EEH64610.1| hypoxanthine phosphoribosyltransferase [Actinomyces coleocanis DSM
           15436]
          Length = 183

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 12/53 (22%), Positives = 24/53 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + +   ++G  +L+++D+  +G T       L   G  +V I TF R
Sbjct: 82  GVVRILKDLDTDISGRHVLIVEDIIDSGLTLSWLKENLSSRGPASVEIATFLR 134


>gi|325299192|ref|YP_004259109.1| phosphoribosyltransferase [Bacteroides salanitronis DSM 18170]
 gi|324318745|gb|ADY36636.1| phosphoribosyltransferase [Bacteroides salanitronis DSM 18170]
          Length = 229

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 1/56 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +   F      +  + G  ILL+DDV TTGAT    A AL   G + +S+ T + +
Sbjct: 174 VEGLFR-TAPQAALLEGKHILLVDDVLTTGATLTACADALSSVGGIRISVATLAWA 228


>gi|294012632|ref|YP_003546092.1| putative amidophosphoribosyltransferase [Sphingobium japonicum
           UT26S]
 gi|292675962|dbj|BAI97480.1| putative amidophosphoribosyltransferase [Sphingobium japonicum
           UT26S]
          Length = 251

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF +       + G  +LLIDDV+T+GATA   A ALK+ GA +V +L ++R L D
Sbjct: 192 VRGAFALSPG--HELKGRAVLLIDDVHTSGATAAACARALKRGGAASVHLLCWARVLPD 248


>gi|255527079|ref|ZP_05393968.1| amidophosphoribosyltransferase [Clostridium carboxidivorans P7]
 gi|296188143|ref|ZP_06856535.1| amidophosphoribosyltransferase [Clostridium carboxidivorans P7]
 gi|255509231|gb|EET85582.1| amidophosphoribosyltransferase [Clostridium carboxidivorans P7]
 gi|296047269|gb|EFG86711.1| amidophosphoribosyltransferase [Clostridium carboxidivorans P7]
          Length = 479

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 1/56 (1%)

Query: 4   AFNVP-QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           A +V    +  +V G +++++DD    G T++    AL+KAGA  V     S  +K
Sbjct: 349 AVSVKLNPLKVNVEGKRVVIVDDSIVRGTTSRKLVEALRKAGAKEVHFRVSSPVVK 404


>gi|90416989|ref|ZP_01224918.1| probable phosphoribosyl transferase [marine gamma proteobacterium
           HTCC2207]
 gi|90331336|gb|EAS46580.1| probable phosphoribosyl transferase [marine gamma proteobacterium
           HTCC2207]
          Length = 167

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 25/56 (44%), Positives = 36/56 (64%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF      +K + GL + ++DDV TTGATA  AA AL +AGA  V I + +R+
Sbjct: 108 IKNAFI---AEAKDLKGLSVAIVDDVVTTGATANSAAKALLRAGAAQVDIWSIART 160


>gi|319408299|emb|CBI81952.1| amidophosphoribosyltransferase [Bartonella schoenbuchensis R1]
          Length = 496

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 22/50 (44%), Gaps = 3/50 (6%)

Query: 4   AFNV---PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
           AF V          + G +++L+DD    G T+      L+ AGA  V +
Sbjct: 348 AFGVKLKHSANRPIIEGKRVILVDDSIVRGTTSTKIVRMLRDAGAKEVHM 397


>gi|153952818|ref|YP_001393583.1| hypothetical protein CKL_0171 [Clostridium kluyveri DSM 555]
 gi|146345699|gb|EDK32235.1| Hpt [Clostridium kluyveri DSM 555]
          Length = 181

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 9/51 (17%), Positives = 20/51 (39%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   +    IL+++D+  +G T       LK   A ++ I   
Sbjct: 80  GVVRILKDLDFEIEDKYILIVEDIIDSGTTLSYLIEYLKGRKAKSIEIACL 130


>gi|330828698|ref|YP_004391650.1| ribose-phosphate pyrophosphokinase [Aeromonas veronii B565]
 gi|328803834|gb|AEB49033.1| Ribose-phosphate pyrophosphokinase [Aeromonas veronii B565]
          Length = 315

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +++DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HLIGDVAGRDCIIVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPVFS 254


>gi|89073087|ref|ZP_01159626.1| ribose-phosphate pyrophosphokinase [Photobacterium sp. SKA34]
 gi|90581723|ref|ZP_01237510.1| ribose-phosphate pyrophosphokinase [Vibrio angustum S14]
 gi|330445226|ref|ZP_08308878.1| ribose-phosphate diphosphokinase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|89051040|gb|EAR56497.1| ribose-phosphate pyrophosphokinase [Photobacterium sp. SKA34]
 gi|90437077|gb|EAS62281.1| ribose-phosphate pyrophosphokinase [Vibrio angustum S14]
 gi|328489417|dbj|GAA03375.1| ribose-phosphate diphosphokinase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 315

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 22/49 (44%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +++DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HLIGDVEGRDCIIVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPVFS 254


>gi|312144292|ref|YP_003995738.1| hypoxanthine phosphoribosyltransferase [Halanaerobium sp.
           'sapolanicus']
 gi|311904943|gb|ADQ15384.1| hypoxanthine phosphoribosyltransferase [Halanaerobium sp.
           'sapolanicus']
          Length = 186

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 10/51 (19%), Positives = 25/51 (49%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + + +++ G  +L+++D+  TG T K     LK     ++ ++T 
Sbjct: 84  GVVRIIKDMEENIEGRHLLIVEDIIDTGRTLKHVVEILKTRDPKSIKVVTL 134


>gi|295697531|ref|YP_003590769.1| amidophosphoribosyltransferase-like protein [Bacillus tusciae DSM
           2912]
 gi|295413133|gb|ADG07625.1| amidophosphoribosyltransferase-like protein [Bacillus tusciae DSM
           2912]
          Length = 265

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 1/55 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           +   F +       +    ++L+DDV TTGATA+     L+  GA  V  L  +R
Sbjct: 212 LEGRFALSPEA-AEIRERAVVLVDDVLTTGATAQACTRVLRAGGAREVYGLVIAR 265


>gi|325570621|ref|ZP_08146347.1| amidophosphoribosyltransferase [Enterococcus casseliflavus ATCC
           12755]
 gi|325156467|gb|EGC68647.1| amidophosphoribosyltransferase [Enterococcus casseliflavus ATCC
           12755]
          Length = 474

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 14/41 (34%), Positives = 22/41 (53%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
            V   V G +++L+DD    G T++     LK+AGA  V +
Sbjct: 343 AVRGVVEGKRVILVDDSIVRGTTSRRIVQLLKEAGAKEVHV 383


>gi|257068457|ref|YP_003154712.1| hypoxanthine phosphoribosyltransferase [Brachybacterium faecium DSM
           4810]
 gi|256559275|gb|ACU85122.1| hypoxanthine phosphoribosyltransferase [Brachybacterium faecium DSM
           4810]
          Length = 184

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 10/53 (18%), Positives = 23/53 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + +S  +    +L+++D+  +G T K     L+  G  +V +    R
Sbjct: 82  GVVRILKDLSGDITDRNVLIVEDIIDSGLTLKWLLSNLRSRGPKSVEVAALLR 134


>gi|152997461|ref|YP_001342296.1| K+-dependent Na+/Ca+ exchanger related-protein [Marinomonas sp.
           MWYL1]
 gi|150838385|gb|ABR72361.1| K+-dependent Na+/Ca+ exchanger related-protein [Marinomonas sp.
           MWYL1]
          Length = 250

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 16/39 (41%), Positives = 21/39 (53%)

Query: 18  LKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
             + L DDV TTG+T +     L KAGA  V I   +R+
Sbjct: 205 KHVALFDDVMTTGSTIENCTKLLLKAGAERVDIWVIART 243


>gi|299821877|ref|ZP_07053765.1| competence protein F [Listeria grayi DSM 20601]
 gi|299817542|gb|EFI84778.1| competence protein F [Listeria grayi DSM 20601]
          Length = 222

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           M   F++       + G  ILL+DDVYTTGAT  CAA  L + GA  +  +T  R
Sbjct: 170 MEQIFSLTAD--ATIDGKTILLVDDVYTTGATLHCAAELLHEHGAKQIEAITIFR 222


>gi|282848837|ref|ZP_06258230.1| ComF family protein [Veillonella parvula ATCC 17745]
 gi|294791747|ref|ZP_06756895.1| putative ComF family protein [Veillonella sp. 6_1_27]
 gi|294793608|ref|ZP_06758745.1| putative ComF family protein [Veillonella sp. 3_1_44]
 gi|282581491|gb|EFB86881.1| ComF family protein [Veillonella parvula ATCC 17745]
 gi|294455178|gb|EFG23550.1| putative ComF family protein [Veillonella sp. 3_1_44]
 gi|294456977|gb|EFG25339.1| putative ComF family protein [Veillonella sp. 6_1_27]
          Length = 231

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 1   MRNAFNVPQYVSK-HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           + +AF +             IL++DD+YTTGAT +  A  L+K  A+ +  LT +
Sbjct: 173 IDDAFVICADYKDIDFTNKNILIVDDIYTTGATIEAVAKVLQKHKALRIDALTLA 227


>gi|284040351|ref|YP_003390281.1| phosphoribosyltransferase [Spirosoma linguale DSM 74]
 gi|283819644|gb|ADB41482.1| phosphoribosyltransferase [Spirosoma linguale DSM 74]
          Length = 239

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++  F+V       V G  I+L+DDV TTGAT +  A+ L K+G  +V  +T + +
Sbjct: 184 VKTVFSVQDA--SEVNGKHIVLVDDVLTTGATLEACAVELLKSGCKSVGFITLAAA 237


>gi|219853483|ref|YP_002470605.1| hypothetical protein CKR_0140 [Clostridium kluyveri NBRC 12016]
 gi|219567207|dbj|BAH05191.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 178

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 9/51 (17%), Positives = 20/51 (39%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   +    IL+++D+  +G T       LK   A ++ I   
Sbjct: 77  GVVRILKDLDFEIEDKYILIVEDIIDSGTTLSYLIEYLKGRKAKSIEIACL 127


>gi|302390613|ref|YP_003826434.1| hypoxanthine phosphoribosyltransferase [Thermosediminibacter oceani
           DSM 16646]
 gi|302201241|gb|ADL08811.1| hypoxanthine phosphoribosyltransferase [Thermosediminibacter oceani
           DSM 16646]
          Length = 185

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + + + V G  IL+++D+  +G T       LK     ++ I T 
Sbjct: 78  GVVRILKDLDEEVEGKHILIVEDIIDSGLTLSYLYSMLKSRKPASIKICTL 128


>gi|308234118|ref|ZP_07664855.1| phosphoribosyltransferase [Atopobium vaginae DSM 15829]
 gi|328943658|ref|ZP_08241123.1| hypothetical protein HMPREF0091_10348 [Atopobium vaginae DSM 15829]
 gi|327491627|gb|EGF23401.1| hypothetical protein HMPREF0091_10348 [Atopobium vaginae DSM 15829]
          Length = 314

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 31/44 (70%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + ++  ++L++DDV TTGA+ + AA ALK+A A  VS L F+R 
Sbjct: 270 QDMSNKRVLVLDDVITTGASMREAARALKQANAADVSALAFARV 313


>gi|168334112|ref|ZP_02692325.1| hypoxanthine phosphoribosyltransferase [Epulopiscium sp. 'N.t.
           morphotype B']
          Length = 177

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 8/51 (15%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + + + +    I++++D+  +G T       L+  G  ++ I T 
Sbjct: 77  GVIKILKDLDEPINDKHIIIVEDIIDSGCTLSYLRNILEARGPKSIKICTL 127


>gi|54309998|ref|YP_131018.1| ribose-phosphate pyrophosphokinase [Photobacterium profundum SS9]
 gi|46914437|emb|CAG21216.1| putative phosphoribosylpyrophosphate synthetase [Photobacterium
           profundum SS9]
          Length = 315

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 22/49 (44%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +++DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HLIGDVEGRDCIIVDDMIDTGGTLCKAAKALKERGAKRVFAYATHPVFS 254


>gi|170780554|ref|YP_001708886.1| putative hypoxanthine phosphoribosyltransferase [Clavibacter
           michiganensis subsp. sepedonicus]
 gi|169155122|emb|CAQ00222.1| putative hypoxanthine phosphoribosyltransferase [Clavibacter
           michiganensis subsp. sepedonicus]
          Length = 183

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 10/53 (18%), Positives = 24/53 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + +   + G ++L+++D+  +G T       L+  GA +V +    R
Sbjct: 82  GVVRILKDLDADLTGRRVLIVEDIIDSGLTLSWLLANLRSRGAASVEVCALLR 134


>gi|149377512|ref|ZP_01895253.1| competence protein F [Marinobacter algicola DG893]
 gi|149358204|gb|EDM46685.1| competence protein F [Marinobacter algicola DG893]
          Length = 151

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 5/56 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R  + V +     +A     ++DDV TTGATA+    AL +AGA  V I   +R+
Sbjct: 99  LRGIYQVTRSPPASIA-----IVDDVITTGATARSLTEALLEAGAREVQIWALART 149


>gi|17545078|ref|NP_518480.1| competence protein F-related protein [Ralstonia solanacearum
           GMI1000]
 gi|17427368|emb|CAD13887.1| putative competence protein f-related protein [Ralstonia
           solanacearum GMI1000]
          Length = 240

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF+VP      + G  I ++DDV TTGAT    A  LK+AGA  V+     R+
Sbjct: 186 LQGAFDVPDPAC--ITGRHIGVVDDVMTTGATLSEIATQLKRAGAARVTNCVALRT 239


>gi|162448220|ref|YP_001621352.1| hypoxanthine-guanine phosphoribosyltransferase [Acholeplasma
           laidlawii PG-8A]
 gi|161986327|gb|ABX81976.1| hypoxanthine-guanine phosphoribosyltransferase [Acholeplasma
           laidlawii PG-8A]
          Length = 179

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 25/51 (49%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               +   ++  V    +++++D+  TGAT K     LK  GA +V ++T 
Sbjct: 77  GDVKIKYDLNSPVQDRDVVIVEDIVDTGATLKTVTELLKYRGAKSVKVVTL 127


>gi|71748222|ref|XP_823166.1| phosphoribosylpyrophosphate synthetase [Trypanosoma brucei TREU927]
 gi|70832834|gb|EAN78338.1| phosphoribosylpyrophosphate synthetase, putative [Trypanosoma
           brucei]
          Length = 377

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 21/49 (42%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +   V G   +++DD+  T  T   AA  LK+ GA  V        L D
Sbjct: 229 LVGEVKGCTCIIVDDMIDTAGTLCKAAQVLKEHGAKEVHAWATHGILTD 277


>gi|293391254|ref|ZP_06635588.1| protein GntX [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|290951788|gb|EFE01907.1| protein GntX [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 228

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 28/56 (50%), Gaps = 1/56 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +            + L+DDV TTG+T    A  L++A  + + +   +R+
Sbjct: 174 LKNAFRISTNDRH-FPYRSVALVDDVITTGSTLNEIAKRLRQANVVHIQVWGLART 228


>gi|283768239|ref|ZP_06341152.1| hypoxanthine phosphoribosyltransferase [Bulleidia extructa W1219]
 gi|283105116|gb|EFC06487.1| hypoxanthine phosphoribosyltransferase [Bulleidia extructa W1219]
          Length = 182

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   + G  I+L++D+  TG T K     L   GA +V ++T 
Sbjct: 78  GDIRIIKDLDSSIKGKSIILVEDIVDTGRTIKTVVETLMNKGATSVQVVTL 128


>gi|323524636|ref|YP_004226789.1| phosphoribosyltransferase [Burkholderia sp. CCGE1001]
 gi|323381638|gb|ADX53729.1| phosphoribosyltransferase [Burkholderia sp. CCGE1001]
          Length = 261

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           AF V +     V G  I ++DDV TTGAT +  A  LK AGA  V+     R+ K+
Sbjct: 210 AFEVARR----VEGQHIGIVDDVMTTGATLEALARTLKAAGARRVTNFVALRTPKN 261


>gi|227552305|ref|ZP_03982354.1| ribose-phosphate diphosphokinase [Enterococcus faecium TX1330]
 gi|257886529|ref|ZP_05666182.1| ribose-phosphate pyrophosphokinase [Enterococcus faecium 1,141,733]
 gi|257892734|ref|ZP_05672387.1| ribose-phosphate pyrophosphokinase [Enterococcus faecium 1,231,408]
 gi|257895119|ref|ZP_05674772.1| ribose-phosphate pyrophosphokinase [Enterococcus faecium Com12]
 gi|293377894|ref|ZP_06624075.1| ribose-phosphate diphosphokinase [Enterococcus faecium PC4.1]
 gi|227178576|gb|EEI59548.1| ribose-phosphate diphosphokinase [Enterococcus faecium TX1330]
 gi|257822583|gb|EEV49515.1| ribose-phosphate pyrophosphokinase [Enterococcus faecium 1,141,733]
 gi|257829113|gb|EEV55720.1| ribose-phosphate pyrophosphokinase [Enterococcus faecium 1,231,408]
 gi|257831684|gb|EEV58105.1| ribose-phosphate pyrophosphokinase [Enterococcus faecium Com12]
 gi|292643441|gb|EFF61570.1| ribose-phosphate diphosphokinase [Enterococcus faecium PC4.1]
          Length = 324

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 22/47 (46%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
             V G   +++DD+  TGAT   AA  LK+ GA  V        L D
Sbjct: 213 GDVQGKTCIMVDDILNTGATLARAANVLKENGAKEVYACASHGLLSD 259


>gi|84393992|ref|ZP_00992731.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio splendidus
           12B01]
 gi|84375386|gb|EAP92294.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio splendidus
           12B01]
          Length = 176

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 11/49 (22%), Positives = 21/49 (42%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
             + + +   + G  +LL++D+  TG T       L   G  ++ I T 
Sbjct: 79  VRILKDLDDDIQGKDVLLVEDIIDTGNTLTKVKEILSLRGPKSIEICTL 127


>gi|322515352|ref|ZP_08068348.1| competence protein F [Actinobacillus ureae ATCC 25976]
 gi|322118639|gb|EFX90861.1| competence protein F [Actinobacillus ureae ATCC 25976]
          Length = 225

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF      + H    ++ +IDDV TTG+T       L K G   + + T +R+
Sbjct: 174 LKGAFRYTPNRAYH----RVAIIDDVVTTGSTLNAICAELLKQGVQHIQVWTLARA 225


>gi|226307798|ref|YP_002767758.1| phosphoribosylpyrophosphate synthase [Rhodococcus erythropolis PR4]
 gi|226186915|dbj|BAH35019.1| phosphoribosylpyrophosphate synthase [Rhodococcus erythropolis PR4]
          Length = 326

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 23/52 (44%)

Query: 8   PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
              V   V G   +LIDD+  TG T   A   LK+AGA  V I      L D
Sbjct: 214 SNRVVGDVEGRTCILIDDMIDTGGTIAGAVKVLKEAGAGDVVIAATHGVLSD 265


>gi|152997606|ref|YP_001342441.1| ribose-phosphate pyrophosphokinase [Marinomonas sp. MWYL1]
 gi|189028796|sp|A6W1C7|KPRS_MARMS RecName: Full=Ribose-phosphate pyrophosphokinase; Short=RPPK;
           AltName: Full=Phosphoribosyl pyrophosphate synthase;
           Short=P-Rib-PP synthase; Short=PRPP synthase
 gi|150838530|gb|ABR72506.1| ribose-phosphate pyrophosphokinase [Marinomonas sp. MWYL1]
          Length = 315

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +L+DD+  TG T   AA ALK+ GA  V        L 
Sbjct: 206 HLIGDVEGKTCVLVDDMCDTGGTLCAAAKALKEHGAAKVLAYCTHPVLS 254


>gi|69244802|ref|ZP_00603026.1| Ribose-phosphate pyrophosphokinase [Enterococcus faecium DO]
 gi|257879146|ref|ZP_05658799.1| ribose-phosphate pyrophosphokinase [Enterococcus faecium 1,230,933]
 gi|257882047|ref|ZP_05661700.1| ribose-phosphate pyrophosphokinase [Enterococcus faecium 1,231,502]
 gi|257883770|ref|ZP_05663423.1| ribose-phosphate pyrophosphokinase [Enterococcus faecium 1,231,501]
 gi|257889976|ref|ZP_05669629.1| ribose-phosphate pyrophosphokinase [Enterococcus faecium 1,231,410]
 gi|257897728|ref|ZP_05677381.1| ribose-phosphate pyrophosphokinase [Enterococcus faecium Com15]
 gi|258615532|ref|ZP_05713302.1| ribose-phosphate pyrophosphokinase [Enterococcus faecium DO]
 gi|260560207|ref|ZP_05832384.1| ribose-phosphate pyrophosphokinase [Enterococcus faecium C68]
 gi|261208078|ref|ZP_05922753.1| ribose-phosphate pyrophosphokinase [Enterococcus faecium TC 6]
 gi|293553760|ref|ZP_06674377.1| ribose-phosphate pyrophosphokinase [Enterococcus faecium E1039]
 gi|293563502|ref|ZP_06677950.1| ribose-Phosphate pyrophosphokinase [Enterococcus faecium E1162]
 gi|293569052|ref|ZP_06680364.1| ribose-Phosphate pyrophosphokinase [Enterococcus faecium E1071]
 gi|293571274|ref|ZP_06682308.1| ribose-Phosphate pyrophosphokinase [Enterococcus faecium E980]
 gi|294615059|ref|ZP_06694946.1| ribose-Phosphate pyrophosphokinase [Enterococcus faecium E1636]
 gi|294619488|ref|ZP_06698929.1| ribose-Phosphate pyrophosphokinase [Enterococcus faecium E1679]
 gi|294622804|ref|ZP_06701758.1| ribose-Phosphate pyrophosphokinase [Enterococcus faecium U0317]
 gi|314938370|ref|ZP_07845661.1| ribose-phosphate diphosphokinase [Enterococcus faecium TX0133a04]
 gi|314942293|ref|ZP_07849141.1| ribose-phosphate diphosphokinase [Enterococcus faecium TX0133C]
 gi|314947772|ref|ZP_07851179.1| ribose-phosphate diphosphokinase [Enterococcus faecium TX0082]
 gi|314951429|ref|ZP_07854479.1| ribose-phosphate diphosphokinase [Enterococcus faecium TX0133A]
 gi|314993159|ref|ZP_07858544.1| ribose-phosphate diphosphokinase [Enterococcus faecium TX0133B]
 gi|314996043|ref|ZP_07861121.1| ribose-phosphate diphosphokinase [Enterococcus faecium TX0133a01]
 gi|68196156|gb|EAN10586.1| Ribose-phosphate pyrophosphokinase [Enterococcus faecium DO]
 gi|257813374|gb|EEV42132.1| ribose-phosphate pyrophosphokinase [Enterococcus faecium 1,230,933]
 gi|257817705|gb|EEV45033.1| ribose-phosphate pyrophosphokinase [Enterococcus faecium 1,231,502]
 gi|257819608|gb|EEV46756.1| ribose-phosphate pyrophosphokinase [Enterococcus faecium 1,231,501]
 gi|257826336|gb|EEV52962.1| ribose-phosphate pyrophosphokinase [Enterococcus faecium 1,231,410]
 gi|257835640|gb|EEV60714.1| ribose-phosphate pyrophosphokinase [Enterococcus faecium Com15]
 gi|260073774|gb|EEW62099.1| ribose-phosphate pyrophosphokinase [Enterococcus faecium C68]
 gi|260077662|gb|EEW65378.1| ribose-phosphate pyrophosphokinase [Enterococcus faecium TC 6]
 gi|291588233|gb|EFF20069.1| ribose-Phosphate pyrophosphokinase [Enterococcus faecium E1071]
 gi|291592094|gb|EFF23716.1| ribose-Phosphate pyrophosphokinase [Enterococcus faecium E1636]
 gi|291594250|gb|EFF25683.1| ribose-Phosphate pyrophosphokinase [Enterococcus faecium E1679]
 gi|291597762|gb|EFF28900.1| ribose-Phosphate pyrophosphokinase [Enterococcus faecium U0317]
 gi|291602053|gb|EFF32288.1| ribose-phosphate pyrophosphokinase [Enterococcus faecium E1039]
 gi|291604504|gb|EFF33990.1| ribose-Phosphate pyrophosphokinase [Enterococcus faecium E1162]
 gi|291608681|gb|EFF37969.1| ribose-Phosphate pyrophosphokinase [Enterococcus faecium E980]
 gi|313589797|gb|EFR68642.1| ribose-phosphate diphosphokinase [Enterococcus faecium TX0133a01]
 gi|313592336|gb|EFR71181.1| ribose-phosphate diphosphokinase [Enterococcus faecium TX0133B]
 gi|313596386|gb|EFR75231.1| ribose-phosphate diphosphokinase [Enterococcus faecium TX0133A]
 gi|313598910|gb|EFR77755.1| ribose-phosphate diphosphokinase [Enterococcus faecium TX0133C]
 gi|313642268|gb|EFS06848.1| ribose-phosphate diphosphokinase [Enterococcus faecium TX0133a04]
 gi|313645752|gb|EFS10332.1| ribose-phosphate diphosphokinase [Enterococcus faecium TX0082]
          Length = 324

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 22/47 (46%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
             V G   +++DD+  TGAT   AA  LK+ GA  V        L D
Sbjct: 213 GDVQGKTCIMVDDILNTGATLARAANVLKENGAKEVYACASHGLLSD 259


>gi|160947240|ref|ZP_02094407.1| hypothetical protein PEPMIC_01173 [Parvimonas micra ATCC 33270]
 gi|158446374|gb|EDP23369.1| hypothetical protein PEPMIC_01173 [Parvimonas micra ATCC 33270]
          Length = 186

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 23/48 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
               + + +   V G  IL+++D+  TG T K      ++ GA TV +
Sbjct: 85  GVVKIVKDLEADVTGKNILIVEDIIDTGKTLKYLLNYFRERGAKTVKV 132


>gi|329118732|ref|ZP_08247432.1| competence protein F [Neisseria bacilliformis ATCC BAA-1200]
 gi|327465167|gb|EGF11452.1| competence protein F [Neisseria bacilliformis ATCC BAA-1200]
          Length = 205

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 4/55 (7%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           R  F V       V    +LLIDDV TT AT    A +LK+AGA  V   T +++
Sbjct: 150 RGLFEV----RGGVKKRNLLLIDDVATTNATLAELARSLKRAGAARVCCWTLAQA 200


>gi|261856677|ref|YP_003263960.1| phosphoribosyltransferase [Halothiobacillus neapolitanus c2]
 gi|261837146|gb|ACX96913.1| phosphoribosyltransferase [Halothiobacillus neapolitanus c2]
          Length = 247

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 34/56 (60%), Gaps = 5/56 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF V +++        + ++DDV TTG++A   A ALK+AG   V++   +R+
Sbjct: 189 LKNAFEVREHLP-----QHVAIVDDVMTTGSSADALAYALKRAGVGRVTVWVLART 239


>gi|219682099|ref|YP_002468483.1| ribose-phosphate pyrophosphokinase [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|219621832|gb|ACL29988.1| ribose-phosphate pyrophosphokinase [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|311085912|gb|ADP65994.1| ribose-phosphate pyrophosphokinase [Buchnera aphidicola str. LL01
           (Acyrthosiphon pisum)]
 gi|311086484|gb|ADP66565.1| ribose-phosphate pyrophosphokinase [Buchnera aphidicola str. TLW03
           (Acyrthosiphon pisum)]
 gi|311087066|gb|ADP67146.1| ribose-phosphate pyrophosphokinase [Buchnera aphidicola str. JF99
           (Acyrthosiphon pisum)]
 gi|311087619|gb|ADP67698.1| ribose-phosphate pyrophosphokinase [Buchnera aphidicola str. JF98
           (Acyrthosiphon pisum)]
          Length = 315

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 20/46 (43%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
             VA    +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 209 GDVANRDCILVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPVFS 254


>gi|183602056|ref|ZP_02963425.1| hypoxanthine-guanine phosphoribosyltransferase [Bifidobacterium
           animalis subsp. lactis HN019]
 gi|219682965|ref|YP_002469348.1| hypoxanthine phosphoribosyltransferase [Bifidobacterium animalis
           subsp. lactis AD011]
 gi|241190542|ref|YP_002967936.1| hypoxanthine-guanine phosphoribosyltransferase [Bifidobacterium
           animalis subsp. lactis Bl-04]
 gi|241195948|ref|YP_002969503.1| hypoxanthine-guanine phosphoribosyltransferase [Bifidobacterium
           animalis subsp. lactis DSM 10140]
 gi|183218941|gb|EDT89583.1| hypoxanthine-guanine phosphoribosyltransferase [Bifidobacterium
           animalis subsp. lactis HN019]
 gi|219620615|gb|ACL28772.1| hypoxanthine phosphoribosyltransferase [Bifidobacterium animalis
           subsp. lactis AD011]
 gi|240248934|gb|ACS45874.1| hypoxanthine-guanine phosphoribosyltransferase [Bifidobacterium
           animalis subsp. lactis Bl-04]
 gi|240250502|gb|ACS47441.1| hypoxanthine-guanine phosphoribosyltransferase [Bifidobacterium
           animalis subsp. lactis DSM 10140]
 gi|289178277|gb|ADC85523.1| Hypoxanthine-guanine phosphoribosyltransferase [Bifidobacterium
           animalis subsp. lactis BB-12]
 gi|295793529|gb|ADG33064.1| hypoxanthine-guanine phosphoribosyltransferase [Bifidobacterium
           animalis subsp. lactis V9]
          Length = 187

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               V Q +S+ V G  +++++D+  +G T       LK  GA +V I   
Sbjct: 82  GTITVRQDLSRDVRGRDVIIVEDIIDSGRTLDWLVNELKSRGAKSVEIFAL 132


>gi|303230968|ref|ZP_07317711.1| hypoxanthine phosphoribosyltransferase [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302514350|gb|EFL56349.1| hypoxanthine phosphoribosyltransferase [Veillonella atypica
           ACS-049-V-Sch6]
          Length = 180

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + + + V    +L+++D+  TG T       LK  GA +V ++  
Sbjct: 79  GVVRILKDLDRSVEDKNVLVVEDIVDTGTTLHYLLDNLKARGAKSVRLVAL 129


>gi|227494885|ref|ZP_03925201.1| ribose-phosphate diphosphokinase [Actinomyces coleocanis DSM 15436]
 gi|226831337|gb|EEH63720.1| ribose-phosphate diphosphokinase [Actinomyces coleocanis DSM 15436]
          Length = 314

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 25/54 (46%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
             V   V   V G   +L+DD+  TG T   A   +K AGA +V+++     L 
Sbjct: 199 VAVANRVVGEVEGRDCILVDDMIDTGGTIAEAVKVVKNAGAKSVTVVATHGILS 252


>gi|28952044|ref|NP_240000.2| ribose-phosphate pyrophosphokinase [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219681543|ref|YP_002467928.1| ribose-phosphate pyrophosphokinase [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|257471226|ref|ZP_05635225.1| ribose-phosphate pyrophosphokinase [Buchnera aphidicola str. LSR1
           (Acyrthosiphon pisum)]
 gi|11132927|sp|P57266|KPRS_BUCAI RecName: Full=Ribose-phosphate pyrophosphokinase; Short=RPPK;
           AltName: Full=Phosphoribosyl pyrophosphate synthase;
           Short=P-Rib-PP synthase; Short=PRPP synthase
 gi|219624386|gb|ACL30541.1| ribose-phosphate pyrophosphokinase [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
          Length = 315

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 20/46 (43%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
             VA    +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 209 GDVANRDCILVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPVFS 254


>gi|294787552|ref|ZP_06752805.1| ribose-phosphate pyrophosphokinase [Parascardovia denticolens
           F0305]
 gi|315226862|ref|ZP_07868650.1| phosphoribosyl pyrophosphate synthetase [Parascardovia denticolens
           DSM 10105]
 gi|294484908|gb|EFG32543.1| ribose-phosphate pyrophosphokinase [Parascardovia denticolens
           F0305]
 gi|315120994|gb|EFT84126.1| phosphoribosyl pyrophosphate synthetase [Parascardovia denticolens
           DSM 10105]
          Length = 345

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 26/54 (48%)

Query: 6   NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            V   V   VAG   +L+DD+  TG T   A   + +AGA +V ++     L +
Sbjct: 214 TVANRVVGDVAGKDCVLVDDLIDTGGTIAEATKIVLEAGAKSVIVVATHGVLSN 267


>gi|188025401|ref|ZP_02958488.2| hypothetical protein PROSTU_00226 [Providencia stuartii ATCC 25827]
 gi|188023650|gb|EDU61690.1| hypothetical protein PROSTU_00226 [Providencia stuartii ATCC 25827]
          Length = 229

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +  AF +       V G  + + DDV TTGAT + AA  L  AG  TV   +  R+L
Sbjct: 177 LNGAFTLT----TPVIGQHVAIFDDVLTTGATMQAAAQLLICAGVETVQAWSLCRTL 229


>gi|255326127|ref|ZP_05367214.1| hypoxanthine phosphoribosyltransferase [Rothia mucilaginosa ATCC
           25296]
 gi|283457232|ref|YP_003361802.1| hypoxanthine-guanine phosphoribosyltransferase [Rothia mucilaginosa
           DY-18]
 gi|255296838|gb|EET76168.1| hypoxanthine phosphoribosyltransferase [Rothia mucilaginosa ATCC
           25296]
 gi|283133217|dbj|BAI63982.1| hypoxanthine-guanine phosphoribosyltransferase [Rothia mucilaginosa
           DY-18]
          Length = 183

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 13/56 (23%), Positives = 24/56 (42%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
               + + +   + G  +L+++D+  +G T       L   GA +V I T  R  K
Sbjct: 82  GVVRILKDLDTDLVGRNVLIVEDIIDSGLTLAWLQQNLISRGAASVEICTLLRKPK 137


>gi|194467679|ref|ZP_03073666.1| hypoxanthine phosphoribosyltransferase [Lactobacillus reuteri
           100-23]
 gi|194454715|gb|EDX43612.1| hypoxanthine phosphoribosyltransferase [Lactobacillus reuteri
           100-23]
          Length = 180

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 10/51 (19%), Positives = 21/51 (41%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               +   +   V    +L+++D+  TG T K     L   GA ++ + + 
Sbjct: 77  GKVKLIHDLKTDVKDRHVLIMEDIVDTGRTLKYLMDLLADRGAKSIKVCSL 127


>gi|50364891|ref|YP_053316.1| phosphoribosylpyrophosphate synthetase [Mesoplasma florum L1]
 gi|50363447|gb|AAT75432.1| phosphoribosylpyrophosphate synthetase [Mesoplasma florum L1]
          Length = 347

 Score = 61.8 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 15/42 (35%), Positives = 19/42 (45%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
             +      +IDD+  TG T   AA ALK+ GA  V I    
Sbjct: 220 GDIKDKHCFIIDDMIDTGGTIINAAKALKEQGAKDVHIFACH 261


>gi|154508552|ref|ZP_02044194.1| hypothetical protein ACTODO_01053 [Actinomyces odontolyticus ATCC
           17982]
 gi|153798186|gb|EDN80606.1| hypothetical protein ACTODO_01053 [Actinomyces odontolyticus ATCC
           17982]
          Length = 179

 Score = 61.4 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 14/53 (26%), Positives = 25/53 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + + + VAG  +L+++D+  +G T       L   GA +V I T  R
Sbjct: 77  GVVRILKDLDQDVAGRHVLIVEDIIDSGLTLSWLQANLLGRGAASVKIATALR 129


>gi|16799328|ref|NP_469596.1| hypothetical protein lin0251 [Listeria innocua Clip11262]
 gi|61216704|sp|Q92F56|TILS_LISIN RecName: Full=Bifunctional protein tilS/hprT; Includes: RecName:
           Full=tRNA(Ile)-lysidine synthase; AltName:
           Full=tRNA(Ile)-2-lysyl-cytidine synthase; AltName:
           Full=tRNA(Ile)-lysidine synthetase; Includes: RecName:
           Full=Hypoxanthine-guanine phosphoribosyltransferase;
           Short=HGPRT; Short=HGPRTase
 gi|16412680|emb|CAC95484.1| fusion protein, N-terminal part similar to B. subtilis YacA
           protein, C-terminal part similar to hypoxanthine-guanine
           phosphoribosyltransferase [Listeria innocua Clip11262]
          Length = 648

 Score = 61.4 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + ++  V G  +L+I+D+  +G T       +K   A +V ++T 
Sbjct: 546 GEVKIIKDLNASVEGRDVLIIEDIIDSGRTLSYLVDLIKYRKAKSVKLVTL 596


>gi|145298189|ref|YP_001141030.1| ribose-phosphate pyrophosphokinase [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142850961|gb|ABO89282.1| phosphoribosylpyrophosphate synthetase [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 312

 Score = 61.4 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +++DD+  TG T   AA ALK+ GA  V          
Sbjct: 203 HLIGDVAGRDCIIVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPVFS 251


>gi|87200124|ref|YP_497381.1| phosphoribosyltransferase [Novosphingobium aromaticivorans DSM
           12444]
 gi|87135805|gb|ABD26547.1| phosphoribosyltransferase [Novosphingobium aromaticivorans DSM
           12444]
          Length = 269

 Score = 61.4 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 32/59 (54%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  + +V    +  +   K+LL+DDV T+GAT      AL++AG   V I  F+R L +
Sbjct: 189 LAGSISVHPGRADCLRQAKVLLVDDVMTSGATTNACITALRRAGVAEVRIACFARVLDE 247


>gi|78045960|ref|YP_362135.1| putative competence protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|78034390|emb|CAJ22035.1| putative competence protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
          Length = 241

 Score = 61.4 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 5/56 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R+AF     +        + L+DDV TTGAT   AA AL+KAG   V     +R 
Sbjct: 190 LRDAFEARGALPA-----HVALVDDVMTTGATLHAAAKALRKAGVQRVDAWVCARV 240


>gi|325846708|ref|ZP_08169623.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
 gi|325481466|gb|EGC84507.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
          Length = 791

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 19/46 (41%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
               G   +L+DD+  T  T   AA  LK  GA  VSI      L 
Sbjct: 684 GDFEGKHCILVDDMIDTAGTICNAANYLKDHGAKDVSIAATHGVLS 729


>gi|239980353|ref|ZP_04702877.1| hypoxanthine phosphoribosyltransferase [Streptomyces albus J1074]
          Length = 179

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 9/53 (16%), Positives = 22/53 (41%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + +   + G  +L+++D+  +G T       L   G  ++ + T  R
Sbjct: 77  GVVRILKDLDTDIQGKHVLIVEDIIDSGLTLSWLISNLGSRGPASLKVCTLLR 129


>gi|146297000|ref|YP_001180771.1| amidophosphoribosyltransferase [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145410576|gb|ABP67580.1| amidophosphoribosyltransferase [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 474

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 1/47 (2%)

Query: 4   AFNVP-QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVS 49
           A  +    +  +VAG +++LIDD    G T++     L+ AGA  V 
Sbjct: 340 AVRLKLNPLKSNVAGKRVVLIDDSIVRGTTSRKIIKMLRDAGAREVH 386


>gi|146337714|ref|YP_001202762.1| putative competence protein F (COMF) [Bradyrhizobium sp. ORS278]
 gi|146190520|emb|CAL74519.1| putative competence protein F (COMF) [Bradyrhizobium sp. ORS278]
          Length = 267

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 34/57 (59%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF V       V G +++++DDV TTGAT    A AL +A A  VS+L F+R +
Sbjct: 204 VQGAFQVSSDRLHDVQGRRVVIVDDVLTTGATVDACARALLRAKAAEVSVLVFARVV 260


>gi|19552168|ref|NP_600170.1| ribose-phosphate pyrophosphokinase [Corynebacterium glutamicum ATCC
           13032]
 gi|62389833|ref|YP_225235.1| ribose-phosphate pyrophosphokinase [Corynebacterium glutamicum ATCC
           13032]
 gi|145295100|ref|YP_001137921.1| ribose-phosphate pyrophosphokinase [Corynebacterium glutamicum R]
 gi|24418498|sp|Q8NRU9|KPRS_CORGL RecName: Full=Ribose-phosphate pyrophosphokinase; Short=RPPK;
           AltName: Full=Phosphoribosyl pyrophosphate synthase;
           Short=P-Rib-PP synthase; Short=PRPP synthase
 gi|21323708|dbj|BAB98335.1| Phosphoribosylpyrophosphate synthetase [Corynebacterium glutamicum
           ATCC 13032]
 gi|41325168|emb|CAF19649.1| PHOSPHORIBOSYL PYROPHOSPHATE SYNTHASE ISOZYME 2 PR [Corynebacterium
           glutamicum ATCC 13032]
 gi|140845020|dbj|BAF54019.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 325

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 24/53 (45%)

Query: 7   VPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           V   V   V G   +L+DD+  TG T   A   LKKAGA +V I        D
Sbjct: 213 VANRVVGDVDGKDCVLLDDMIDTGGTIAGAVGVLKKAGAKSVVIACTHGVFSD 265


>gi|330827872|ref|YP_004390824.1| Competence protein F [Aeromonas veronii B565]
 gi|328803008|gb|AEB48207.1| Competence protein F [Aeromonas veronii B565]
          Length = 242

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 5/58 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +  +         + L+DDV TTGATA   +  L ++G   V +    R+L+
Sbjct: 187 LREAFRIRSH-----QYRHVALLDDVVTTGATAGQLSRLLHESGITKVEVWAICRTLR 239


>gi|218668080|ref|YP_002424749.1| competence protein [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|218520293|gb|ACK80879.1| competence protein [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 263

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 5/57 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +  AF + + V        + ++DDV TTG TA   A  L+ AG   + +   +R+L
Sbjct: 212 LDAAFALRERVPD-----HVAVVDDVLTTGTTAAQIASTLRAAGVQRIDVWVLARAL 263


>gi|56460037|ref|YP_155318.1| ribose-phosphate pyrophosphokinase [Idiomarina loihiensis L2TR]
 gi|56179047|gb|AAV81769.1| Phosphoribosylpyrophosphate synthetase [Idiomarina loihiensis L2TR]
          Length = 312

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 21/49 (42%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +++DD+  TG T   AA ALK  GA  V          
Sbjct: 203 HIIGDVKGRDCIIVDDMIDTGGTLCKAAEALKSHGAKRVFAYATHPVFS 251


>gi|313889141|ref|ZP_07822797.1| hypoxanthine phosphoribosyltransferase [Peptoniphilus harei
           ACS-146-V-Sch2b]
 gi|312844881|gb|EFR32286.1| hypoxanthine phosphoribosyltransferase [Peptoniphilus harei
           ACS-146-V-Sch2b]
          Length = 180

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +S  +    IL+++D+  TG T       LK  GA ++ I+T 
Sbjct: 75  GEVRILKDISTSIVDKDILIVEDIIDTGVTLSYLTKILKSRGARSIEIVTM 125


>gi|300173966|ref|YP_003773132.1| ComF operon protein 3 [Leuconostoc gasicomitatum LMG 18811]
 gi|299888345|emb|CBL92313.1| ComF operon protein 3 [Leuconostoc gasicomitatum LMG 18811]
          Length = 223

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 26/42 (61%)

Query: 14  HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
            + G ++LL+DDVYTTG T   AA  L + GA  V  ++ SR
Sbjct: 182 SLKGKEVLLVDDVYTTGNTLYHAADLLYECGAKNVKSISLSR 223


>gi|295397831|ref|ZP_06807895.1| hypoxanthine phosphoribosyltransferase [Aerococcus viridans ATCC
           11563]
 gi|294973928|gb|EFG49691.1| hypoxanthine phosphoribosyltransferase [Aerococcus viridans ATCC
           11563]
          Length = 189

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 9/51 (17%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V+G  +++++D+  TG T        +   A +V ++T 
Sbjct: 83  GQVKILKDLDADVSGRHVIIVEDIVDTGNTLAKIHDLFQHRNAASVKVVTL 133


>gi|49475319|ref|YP_033360.1| amidophosphoribosyltransferase [Bartonella henselae str. Houston-1]
 gi|49238125|emb|CAF27332.1| Amidophosphoribosyltransferase precursor [Bartonella henselae str.
           Houston-1]
          Length = 508

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 22/50 (44%), Gaps = 3/50 (6%)

Query: 4   AFNV---PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
           AF V          + G +++L+DD    G T+      L+ AGA  V +
Sbjct: 360 AFGVKLKHSANRPVIEGKRVILVDDSIVRGTTSVKIVQMLRDAGAKEVHM 409


>gi|25288319|pir||F84949 ribose-phosphate diphosphokinase (EC 2.7.6.1) [imported] - Buchnera
           sp. (strain APS)
 gi|10038851|dbj|BAB12886.1| ribose-phosphate pyrophosphokinase [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
          Length = 312

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 20/46 (43%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
             VA    +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 GDVANRDCILVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPVFS 251


>gi|25027571|ref|NP_737625.1| ribose-phosphate pyrophosphokinase [Corynebacterium efficiens
           YS-314]
 gi|259507023|ref|ZP_05749923.1| ribose-phosphate pyrophosphokinase [Corynebacterium efficiens
           YS-314]
 gi|32469729|sp|Q8FQV2|KPRS_COREF RecName: Full=Ribose-phosphate pyrophosphokinase; Short=RPPK;
           AltName: Full=Phosphoribosyl pyrophosphate synthase;
           Short=P-Rib-PP synthase; Short=PRPP synthase
 gi|23492853|dbj|BAC17825.1| putative ribose-phosphate pyrophosphokinase [Corynebacterium
           efficiens YS-314]
 gi|259165301|gb|EEW49855.1| ribose-phosphate pyrophosphokinase [Corynebacterium efficiens
           YS-314]
          Length = 325

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 25/53 (47%)

Query: 7   VPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           V   V   VAG   +L+DD+  TG T   A   LK+AGA +V I        D
Sbjct: 213 VANRVVGDVAGKDCVLLDDMIDTGGTIAGAVGVLKEAGARSVVIACTHGVFSD 265


>gi|226946186|ref|YP_002801259.1| ribose-phosphate pyrophosphokinase [Azotobacter vinelandii DJ]
 gi|226721113|gb|ACO80284.1| Ribose-phosphate pyrophosphokinase [Azotobacter vinelandii DJ]
          Length = 313

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 22/49 (44%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +L+DD+  T  T   AA ALK+ GA  V        L 
Sbjct: 205 HIIGDVEGRTCILVDDMVDTAGTLCHAAKALKEHGAAKVYAYCTHPVLS 253


>gi|326803020|ref|YP_004320838.1| hypoxanthine phosphoribosyltransferase [Aerococcus urinae
           ACS-120-V-Col10a]
 gi|326651496|gb|AEA01679.1| hypoxanthine phosphoribosyltransferase [Aerococcus urinae
           ACS-120-V-Col10a]
          Length = 177

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 25/51 (49%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   VAG  +LL++D+  TG T +  A   K+  A +V I  F
Sbjct: 77  GDVKILKDLEASVAGRHVLLVEDIVDTGYTLQRLAELFKERQAASVKICAF 127


>gi|295694780|ref|YP_003588018.1| hypoxanthine phosphoribosyltransferase [Bacillus tusciae DSM 2912]
 gi|295410382|gb|ADG04874.1| hypoxanthine phosphoribosyltransferase [Bacillus tusciae DSM 2912]
          Length = 195

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + + + V G  +L+++D+  TG T       L +  A +V I   
Sbjct: 87  GVVRILKDLDQDVDGRHVLIVEDIVDTGLTLAYLRDVLVRRNAASVKIAAL 137


>gi|224283824|ref|ZP_03647146.1| hypoxanthine-guanine phosphoribosyltransferase [Bifidobacterium
           bifidum NCIMB 41171]
 gi|310287910|ref|YP_003939168.1| Hypoxanthine-guanine phosphoribosyltransferase [Bifidobacterium
           bifidum S17]
 gi|311064791|ref|YP_003971516.1| hypoxanthine-guanine phosphoribosyltransferase HprT
           [Bifidobacterium bifidum PRL2010]
 gi|309251846|gb|ADO53594.1| Hypoxanthine-guanine phosphoribosyltransferase [Bifidobacterium
           bifidum S17]
 gi|310867110|gb|ADP36479.1| HprT Hypoxanthine-guanine phosphoribosyltransferase
           [Bifidobacterium bifidum PRL2010]
          Length = 185

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + Q +S  V G  IL+++D+  +G T       LK+ GA +V I   
Sbjct: 82  GTIAIRQDLSCDVRGRHILIVEDIVDSGRTLAWLVEELKRRGAASVEIFAL 132


>gi|212696150|ref|ZP_03304278.1| hypothetical protein ANHYDRO_00686 [Anaerococcus hydrogenalis DSM
           7454]
 gi|212676779|gb|EEB36386.1| hypothetical protein ANHYDRO_00686 [Anaerococcus hydrogenalis DSM
           7454]
          Length = 791

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 19/46 (41%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
               G   +L+DD+  T  T   AA  LK  GA  VSI      L 
Sbjct: 684 GDFEGKHCILVDDMIDTAGTICNAANYLKDHGAKDVSIAATHGVLS 729


>gi|167754969|ref|ZP_02427096.1| hypothetical protein CLORAM_00473 [Clostridium ramosum DSM 1402]
 gi|237735304|ref|ZP_04565785.1| ribose-phosphate pyrophosphokinase [Mollicutes bacterium D7]
 gi|167705019|gb|EDS19598.1| hypothetical protein CLORAM_00473 [Clostridium ramosum DSM 1402]
 gi|229381049|gb|EEO31140.1| ribose-phosphate pyrophosphokinase [Coprobacillus sp. D7]
          Length = 318

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 12/46 (26%), Positives = 20/46 (43%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
             V+G   +++DD+  TG T       LK+ GA +V +        
Sbjct: 208 GDVSGKNCIMVDDMIDTGGTIVAGIEMLKEKGAKSVHVACTHPVFS 253


>gi|163868008|ref|YP_001609212.1| amidophosphoribosyltransferase [Bartonella tribocorum CIP 105476]
 gi|161017659|emb|CAK01217.1| amidophosphoribosyltransferase [Bartonella tribocorum CIP 105476]
          Length = 497

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 14/52 (26%), Positives = 22/52 (42%), Gaps = 3/52 (5%)

Query: 4   AFNV---PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
           AF V          + G +++L+DD    G T+      L+ AGA  V +  
Sbjct: 349 AFGVKLKHSANRPVIEGKRVILVDDSIVRGTTSLKIVRMLRDAGAKEVHMRV 400


>gi|157149744|ref|YP_001451359.1| hypoxanthine phosphoribosyltransferase [Streptococcus gordonii str.
           Challis substr. CH1]
 gi|157074538|gb|ABV09221.1| hypoxanthine phosphoribosyltransferase [Streptococcus gordonii str.
           Challis substr. CH1]
          Length = 180

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
              NV + V + VAG  IL I+D+  TG T K      K   A +V I T 
Sbjct: 78  GVINVKKDVDQDVAGRHILFIEDIIDTGKTLKNLCEMFKDRNAASVKIATL 128


>gi|150014974|ref|YP_001307228.1| ribose-phosphate pyrophosphokinase [Clostridium beijerinckii NCIMB
           8052]
 gi|149901439|gb|ABR32272.1| ribose-phosphate pyrophosphokinase [Clostridium beijerinckii NCIMB
           8052]
          Length = 321

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 20/46 (43%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
             + G + +LIDD+  T  T   AA ALK  GA  V        L 
Sbjct: 214 GDIEGKRCILIDDMIDTAGTIANAANALKDLGAKNVYACCTHGVLS 259


>gi|325571395|ref|ZP_08146895.1| competence protein FC [Enterococcus casseliflavus ATCC 12755]
 gi|325155871|gb|EGC68067.1| competence protein FC [Enterococcus casseliflavus ATCC 12755]
          Length = 227

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 29/51 (56%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           F V    +  +   K+LLIDDVYTTG T   AA AL+  G  ++   +F+R
Sbjct: 177 FAVKPEATVEIKNKKLLLIDDVYTTGRTLYHAAEALQTFGPQSIRSFSFAR 227


>gi|226939033|ref|YP_002794104.1| ComF [Laribacter hongkongensis HLHK9]
 gi|226713957|gb|ACO73095.1| ComF [Laribacter hongkongensis HLHK9]
          Length = 234

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 30/58 (51%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           M  AF      +   AG   +L+DDV TTGAT   AA ALK+AGA  V    + R+  
Sbjct: 180 MAGAFA----SAALPAGQSCVLVDDVLTTGATLSAAARALKRAGAGRVEGWVWLRAQP 233


>gi|238797309|ref|ZP_04640810.1| Predicted amidophosphoribosyltransferase [Yersinia mollaretii ATCC
           43969]
 gi|238718946|gb|EEQ10761.1| Predicted amidophosphoribosyltransferase [Yersinia mollaretii ATCC
           43969]
          Length = 227

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           M+  F       + + G  I L+DDV TTG+T    A  L   G  ++ +    R+L
Sbjct: 175 MQGIFR----CKETIRGQHIALLDDVVTTGSTLNEIAKLLWTEGIASLQVWCICRTL 227


>gi|298345585|ref|YP_003718272.1| ribose-phosphate diphosphokinase [Mobiluncus curtisii ATCC 43063]
 gi|304391140|ref|ZP_07373092.1| phosphoribosyl pyrophosphate synthetase [Mobiluncus curtisii subsp.
           curtisii ATCC 35241]
 gi|315656041|ref|ZP_07908939.1| phosphoribosyl pyrophosphate synthetase [Mobiluncus curtisii ATCC
           51333]
 gi|315656082|ref|ZP_07908973.1| phosphoribosyl pyrophosphate synthetase [Mobiluncus curtisii subsp.
           holmesii ATCC 35242]
 gi|298235646|gb|ADI66778.1| ribose-phosphate diphosphokinase [Mobiluncus curtisii ATCC 43063]
 gi|304326023|gb|EFL93269.1| phosphoribosyl pyrophosphate synthetase [Mobiluncus curtisii subsp.
           curtisii ATCC 35241]
 gi|315490105|gb|EFU79732.1| phosphoribosyl pyrophosphate synthetase [Mobiluncus curtisii ATCC
           51333]
 gi|315493084|gb|EFU82684.1| phosphoribosyl pyrophosphate synthetase [Mobiluncus curtisii subsp.
           holmesii ATCC 35242]
          Length = 323

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 23/55 (41%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
             V   V   VAG   +L+DD+  TG T   A   LK AGA  V +        D
Sbjct: 211 VAVANRVVGDVAGRTCVLVDDLIDTGGTIAEAVGVLKHAGAKDVLVAATHAVFSD 265


>gi|120437817|ref|YP_863503.1| ribose-phosphate pyrophosphokinase [Gramella forsetii KT0803]
 gi|117579967|emb|CAL68436.1| ribose-phosphate pyrophosphokinase [Gramella forsetii KT0803]
          Length = 311

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 13/49 (26%), Positives = 22/49 (44%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            +   V G  ++L+DD+  T  T   AA  + + GA +V  +     L 
Sbjct: 205 ELIGDVTGKNVVLVDDMVDTAGTLTKAADLMMERGAKSVRAICTHPVLS 253


>gi|257867006|ref|ZP_05646659.1| ribose-phosphate pyrophosphokinase [Enterococcus casseliflavus
           EC30]
 gi|257873340|ref|ZP_05652993.1| ribose-phosphate pyrophosphokinase [Enterococcus casseliflavus
           EC10]
 gi|257877082|ref|ZP_05656735.1| ribose-phosphate pyrophosphokinase [Enterococcus casseliflavus
           EC20]
 gi|257801062|gb|EEV29992.1| ribose-phosphate pyrophosphokinase [Enterococcus casseliflavus
           EC30]
 gi|257807504|gb|EEV36326.1| ribose-phosphate pyrophosphokinase [Enterococcus casseliflavus
           EC10]
 gi|257811248|gb|EEV40068.1| ribose-phosphate pyrophosphokinase [Enterococcus casseliflavus
           EC20]
          Length = 325

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 17/40 (42%), Positives = 21/40 (52%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
             V G K +L+DD+  TG T   AA  LK+AGA  V    
Sbjct: 214 GDVVGKKCILVDDILNTGHTLAKAADLLKEAGASEVYACV 253


>gi|238792867|ref|ZP_04636497.1| Gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system [Yersinia
           intermedia ATCC 29909]
 gi|238727721|gb|EEQ19245.1| Gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system [Yersinia
           intermedia ATCC 29909]
          Length = 289

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 26/57 (45%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           MR  F   Q +     G  I L+DDV TTG+T    A  L   G  ++ +    R+L
Sbjct: 237 MRGIFRCTQSLR----GQHIALLDDVVTTGSTLNEIADLLWSEGIASLQVWCICRTL 289


>gi|319441661|ref|ZP_07990817.1| ribose-phosphate pyrophosphokinase [Corynebacterium variabile DSM
           44702]
          Length = 321

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 23/52 (44%)

Query: 8   PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
              V   V G   +LIDD+  TG T   A   L+KAGA  V I T      D
Sbjct: 213 ANRVIGDVEGRTCILIDDMIDTGGTIAGAVEVLRKAGASDVIIATTHGVFSD 264


>gi|71279095|ref|YP_270231.1| ribose-phosphate pyrophosphokinase [Colwellia psychrerythraea 34H]
 gi|71144835|gb|AAZ25308.1| ribose-phosphate pyrophosphokinase [Colwellia psychrerythraea 34H]
          Length = 314

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +++DD+  TG T   AA ALK+ GA  V        L 
Sbjct: 206 HIIGEVEGRDCIIVDDMIDTGGTLAKAAEALKEHGAKRVIAYATHPVLS 254


>gi|325268457|ref|ZP_08135087.1| putative amidophosphoribosyl-transferase [Prevotella multiformis
           DSM 16608]
 gi|324988985|gb|EGC20938.1| putative amidophosphoribosyl-transferase [Prevotella multiformis
           DSM 16608]
          Length = 229

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           +  AF +       V    +LL+DDV TTGAT   AA  L KAG + VS+L+ 
Sbjct: 173 VEKAFRLTDA--SAVRNRHVLLVDDVITTGATLVAAARELFKAGNVKVSVLSL 223


>gi|218289690|ref|ZP_03493898.1| amidophosphoribosyltransferase-like protein [Alicyclobacillus
           acidocaldarius LAA1]
 gi|218240147|gb|EED07331.1| amidophosphoribosyltransferase-like protein [Alicyclobacillus
           acidocaldarius LAA1]
          Length = 245

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +   F         + G ++LL+DDV TTGAT    A  L  AGA  V     +R 
Sbjct: 191 LAGQF--VAAAPGAIRGRRVLLVDDVMTTGATLATCAHVLYGAGARAVHAAVIARV 244


>gi|257876893|ref|ZP_05656546.1| amidophosphoribosyltransferase [Enterococcus casseliflavus EC20]
 gi|257811059|gb|EEV39879.1| amidophosphoribosyltransferase [Enterococcus casseliflavus EC20]
          Length = 320

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 14/41 (34%), Positives = 22/41 (53%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
            V   V G +++L+DD    G T++     LK+AGA  V +
Sbjct: 189 AVRGVVEGKRVILVDDSIVRGTTSRRIVQLLKEAGAKEVHV 229


>gi|217969957|ref|YP_002355191.1| competence protein F [Thauera sp. MZ1T]
 gi|217507284|gb|ACK54295.1| putative competence protein F [Thauera sp. MZ1T]
          Length = 228

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           R AF   +     ++G +++++DDV TTGAT    A  LK  GA  V  L  +R+  
Sbjct: 174 RGAFECVE----DLSGRRVIVVDDVMTTGATLDELARCLKGRGASWVGNLVVARTPS 226


>gi|294786617|ref|ZP_06751871.1| hypoxanthine phosphoribosyltransferase [Parascardovia denticolens
           F0305]
 gi|315226204|ref|ZP_07867992.1| hypoxanthine phosphoribosyltransferase [Parascardovia denticolens
           DSM 10105]
 gi|294485450|gb|EFG33084.1| hypoxanthine phosphoribosyltransferase [Parascardovia denticolens
           F0305]
 gi|315120336|gb|EFT83468.1| hypoxanthine phosphoribosyltransferase [Parascardovia denticolens
           DSM 10105]
          Length = 198

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 16/51 (31%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               V Q +S  VAG  +L+++D+  +G T       LK  GA +V I   
Sbjct: 82  GKVTVRQDLSTDVAGRHVLIVEDIIDSGFTLDWLVNELKSRGAASVEIFAM 132


>gi|269796485|ref|YP_003315940.1| hypoxanthine phosphoribosyltransferase [Sanguibacter keddieii DSM
           10542]
 gi|269098670|gb|ACZ23106.1| hypoxanthine phosphoribosyltransferase [Sanguibacter keddieii DSM
           10542]
          Length = 184

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 9/53 (16%), Positives = 23/53 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + +   ++G  +L+++D+  +G T       L+  G  +V +    R
Sbjct: 82  GVVRILKDLDADLSGRHVLIVEDIIDSGLTLSWLISNLRSRGPASVEVAAMLR 134


>gi|210620508|ref|ZP_03292084.1| hypothetical protein CLOHIR_00027 [Clostridium hiranonis DSM 13275]
 gi|210155318|gb|EEA86324.1| hypothetical protein CLOHIR_00027 [Clostridium hiranonis DSM 13275]
          Length = 299

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           ++NAF V +  S+ + G +I+L+DD++TTG T    +  LK  G   + +LTF
Sbjct: 242 LKNAFEV-KGGSEKIIGKRIILVDDIFTTGTTVNEISKKLKIYGVDEIIVLTF 293


>gi|189440709|ref|YP_001955790.1| hypoxanthine-guanine phosphoribosyltransferase [Bifidobacterium
           longum DJO10A]
 gi|189429144|gb|ACD99292.1| Hypoxanthine-guanine phosphoribosyltransferase [Bifidobacterium
           longum DJO10A]
          Length = 187

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               V Q +S  V G  IL+++D+  +G T       LK+ GA +V +   
Sbjct: 82  GEVTVRQDLSADVRGRHILIVEDIVDSGHTLAWLVAELKRRGAASVEVFAL 132


>gi|325568342|ref|ZP_08144709.1| phosphoribosyl pyrophosphate synthetase [Enterococcus casseliflavus
           ATCC 12755]
 gi|325158111|gb|EGC70264.1| phosphoribosyl pyrophosphate synthetase [Enterococcus casseliflavus
           ATCC 12755]
          Length = 321

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 17/40 (42%), Positives = 21/40 (52%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
             V G K +L+DD+  TG T   AA  LK+AGA  V    
Sbjct: 210 GDVVGKKCILVDDILNTGHTLAKAADLLKEAGASEVYACV 249


>gi|307258109|ref|ZP_07539861.1| hypothetical protein appser10_20890 [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306863472|gb|EFM95403.1| hypothetical protein appser10_20890 [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
          Length = 225

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 25/56 (44%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF             ++ +IDDV TTG+T       L K G   + + T +R+
Sbjct: 174 LKGAFYYQPIFPY----RRVAIIDDVVTTGSTLNAICSELLKQGVTEIQVWTLARA 225


>gi|307251278|ref|ZP_07533198.1| hypothetical protein appser4_20380 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306856676|gb|EFM88812.1| hypothetical protein appser4_20380 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
          Length = 225

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 25/56 (44%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF             ++ +IDDV TTG+T       L K G   + + T +R+
Sbjct: 174 LKGAFYYQPIFPY----RRVAIIDDVVTTGSTLNAICSELLKQGVTEIQVWTLARA 225


>gi|304440186|ref|ZP_07400076.1| hypoxanthine phosphoribosyltransferase [Peptoniphilus duerdenii
           ATCC BAA-1640]
 gi|304371235|gb|EFM24851.1| hypoxanthine phosphoribosyltransferase [Peptoniphilus duerdenii
           ATCC BAA-1640]
          Length = 187

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 10/51 (19%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + ++  + G  +L+++D+  TG T        K+  A +V  +T 
Sbjct: 86  GHIKISKDITVPIKGKDVLIVEDIIDTGNTLSHIIELFKEREARSVKTITL 136


>gi|303251778|ref|ZP_07337949.1| competence protein F [Actinobacillus pleuropneumoniae serovar 2
           str. 4226]
 gi|302649208|gb|EFL79393.1| competence protein F [Actinobacillus pleuropneumoniae serovar 2
           str. 4226]
          Length = 163

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 25/56 (44%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF             ++ +IDDV TTG+T       L K G   + + T +R+
Sbjct: 112 LKGAFYYQPIFPY----RRVAIIDDVVTTGSTLNAICSELLKQGVTEIQVWTLARA 163


>gi|32035475|ref|ZP_00135432.1| COG1040: Predicted amidophosphoribosyltransferases [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126209458|ref|YP_001054683.1| competence protein F [Actinobacillus pleuropneumoniae L20]
 gi|165977450|ref|YP_001653043.1| competence protein F [Actinobacillus pleuropneumoniae serovar 3
           str. JL03]
 gi|190151360|ref|YP_001969885.1| Competence protein F [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
 gi|303250438|ref|ZP_07336635.1| competence protein F [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|307246942|ref|ZP_07529007.1| hypothetical protein appser1_21320 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307249079|ref|ZP_07531086.1| hypothetical protein appser2_20410 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307251479|ref|ZP_07533386.1| hypothetical protein appser6_30 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307255924|ref|ZP_07537725.1| hypothetical protein appser9_21450 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307260377|ref|ZP_07542084.1| hypothetical protein appser11_21580 [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|307262507|ref|ZP_07544152.1| hypothetical protein appser12_20470 [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|307264715|ref|ZP_07546295.1| hypothetical protein appser13_21000 [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|126098250|gb|ABN75078.1| Competence protein F [Actinobacillus pleuropneumoniae serovar 5b
           str. L20]
 gi|165877551|gb|ABY70599.1| competence protein F [Actinobacillus pleuropneumoniae serovar 3
           str. JL03]
 gi|189916491|gb|ACE62743.1| Competence protein F [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
 gi|302650426|gb|EFL80585.1| competence protein F [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|306852227|gb|EFM84467.1| hypothetical protein appser1_21320 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306854367|gb|EFM86563.1| hypothetical protein appser2_20410 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306860943|gb|EFM92949.1| hypothetical protein appser6_30 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306861192|gb|EFM93185.1| hypothetical protein appser9_21450 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306865628|gb|EFM97509.1| hypothetical protein appser11_21580 [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306867884|gb|EFM99715.1| hypothetical protein appser12_20470 [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306870027|gb|EFN01791.1| hypothetical protein appser13_21000 [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 225

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 25/56 (44%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF             ++ +IDDV TTG+T       L K G   + + T +R+
Sbjct: 174 LKGAFYYQPIFPY----RRVAIIDDVVTTGSTLNAICSELLKQGVTEIQVWTLARA 225


>gi|320157703|ref|YP_004190082.1| competence protein F-like protein [Vibrio vulnificus MO6-24/O]
 gi|319933014|gb|ADV87878.1| phosphoribosyltransferase domain / protein YhgH required for
           utilization of DNA as sole source of carbon and energy
           [Vibrio vulnificus MO6-24/O]
          Length = 114

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 13/56 (23%), Positives = 25/56 (44%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  AF + +    +     + ++DDV TTG+T +     L   G  ++ I    R+
Sbjct: 55  LAGAFRLNRSALPYAIPKHVAIVDDVVTTGSTVRQLCQLLLAVGVESIDIYCLCRT 110


>gi|313886699|ref|ZP_07820409.1| ribose-phosphate diphosphokinase [Porphyromonas asaccharolytica
           PR426713P-I]
 gi|332300045|ref|YP_004441966.1| ribose-phosphate pyrophosphokinase [Porphyromonas asaccharolytica
           DSM 20707]
 gi|312923861|gb|EFR34660.1| ribose-phosphate diphosphokinase [Porphyromonas asaccharolytica
           PR426713P-I]
 gi|332177108|gb|AEE12798.1| ribose-phosphate pyrophosphokinase [Porphyromonas asaccharolytica
           DSM 20707]
          Length = 312

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 13/47 (27%), Positives = 21/47 (44%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
             V G  ++L+DD+  T  T   AA  + + GA +V        + D
Sbjct: 209 GDVTGKDVILVDDIVDTAGTMTKAADLMLEHGAKSVRAFATHAVMSD 255


>gi|312127293|ref|YP_003992167.1| phosphoribosyltransferase [Caldicellulosiruptor hydrothermalis 108]
 gi|311777312|gb|ADQ06798.1| phosphoribosyltransferase [Caldicellulosiruptor hydrothermalis 108]
          Length = 231

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 15/40 (37%), Positives = 25/40 (62%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           + G K++L+DD++TTGATA   +  L + GA  V +   +
Sbjct: 186 IKGKKVILVDDIFTTGATANECSKVLLENGAKCVFVSVLA 225


>gi|261867262|ref|YP_003255184.1| protein GntX [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|261412594|gb|ACX81965.1| protein GntX [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 228

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 28/56 (50%), Gaps = 1/56 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++NAF +            + L+DDV TTG+T    A  L++A  + + +   +R+
Sbjct: 174 LKNAFRISTNDRH-FPYRSVALVDDVITTGSTLNEIAKRLRQANVVHIQVWGLART 228


>gi|168209944|ref|ZP_02635569.1| amidophosphoribosyltransferase [Clostridium perfringens B str. ATCC
           3626]
 gi|170712032|gb|EDT24214.1| amidophosphoribosyltransferase [Clostridium perfringens B str. ATCC
           3626]
          Length = 481

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           A  +   +  +V G +++LIDD    G T+K    +L++AGA  V  L  S  +K
Sbjct: 349 AVKLNP-LKVNVNGKRVILIDDSIVRGTTSKHLIESLRRAGAKEVHFLVASPMVK 402


>gi|238786222|ref|ZP_04630169.1| Predicted amidophosphoribosyltransferase [Yersinia bercovieri ATCC
           43970]
 gi|238712863|gb|EEQ04928.1| Predicted amidophosphoribosyltransferase [Yersinia bercovieri ATCC
           43970]
          Length = 186

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R  F   +     + G  I L+DDV TTG+T    A  L   G  ++ +    R+L
Sbjct: 134 IRGIFRCMEP----IRGQHIALLDDVVTTGSTLNEIAKLLWAEGIASLQVWCICRTL 186


>gi|297620166|ref|YP_003708271.1| ribose-phosphate pyrophosphokinase [Methanococcus voltae A3]
 gi|297379143|gb|ADI37298.1| ribose-phosphate pyrophosphokinase [Methanococcus voltae A3]
          Length = 287

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 15/44 (34%), Positives = 21/44 (47%)

Query: 14  HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
            V G  +L++DD+ +TG T   A   LK+ GA  V        L
Sbjct: 201 DVKGRDVLIVDDIISTGGTMATAISMLKEQGANKVIASCVHPVL 244


>gi|258654639|ref|YP_003203795.1| ribose-phosphate pyrophosphokinase [Nakamurella multipartita DSM
           44233]
 gi|258557864|gb|ACV80806.1| ribose-phosphate pyrophosphokinase [Nakamurella multipartita DSM
           44233]
          Length = 324

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 23/53 (43%)

Query: 7   VPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           V   V   VA    +++DD+  TG T   A   + +AGA  V +      L D
Sbjct: 213 VANRVVGDVADRTCIVVDDMIDTGGTISKAVKQVLEAGAKKVIVAATHGVLSD 265


>gi|227546577|ref|ZP_03976626.1| hypoxanthine phosphoribosyltransferase [Bifidobacterium longum
           subsp. infantis ATCC 55813]
 gi|227212894|gb|EEI80773.1| hypoxanthine phosphoribosyltransferase [Bifidobacterium longum
           subsp. infantis ATCC 55813]
          Length = 190

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               V Q +S  V G  IL+++D+  +G T       LK+ GA +V +   
Sbjct: 85  GEVTVRQDLSADVRGRHILIVEDIVDSGRTLAWLVAELKRRGAASVEVFAL 135


>gi|170764255|ref|ZP_02639497.2| amidophosphoribosyltransferase [Clostridium perfringens CPE str.
           F4969]
 gi|170714610|gb|EDT26792.1| amidophosphoribosyltransferase [Clostridium perfringens CPE str.
           F4969]
          Length = 480

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           A  +   +  +V G +++LIDD    G T+K    +L++AGA  V  L  S  +K
Sbjct: 348 AVKLNP-LKVNVNGKRVILIDDSIVRGTTSKHLIESLRRAGAKEVHFLVASPMVK 401


>gi|146306089|ref|YP_001186554.1| ribose-phosphate pyrophosphokinase [Pseudomonas mendocina ymp]
 gi|145574290|gb|ABP83822.1| ribose-phosphate pyrophosphokinase [Pseudomonas mendocina ymp]
          Length = 310

 Score = 61.4 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 22/49 (44%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +L+DD+  T  T   AA ALK+ GA  V        L 
Sbjct: 202 HIIGDVEGRTCILVDDMVDTAGTLCHAAKALKERGAAKVYAYCTHPVLS 250


>gi|323142080|ref|ZP_08076928.1| amidophosphoribosyltransferase [Phascolarctobacterium sp. YIT
           12067]
 gi|322413467|gb|EFY04338.1| amidophosphoribosyltransferase [Phascolarctobacterium sp. YIT
           12067]
          Length = 481

 Score = 61.0 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 26/58 (44%), Gaps = 1/58 (1%)

Query: 3   NAFNVP-QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           NA  +    V   V G  ++++DD    G T+      LK+AGA  V +   S  + D
Sbjct: 345 NAVRLKLNPVRSVVEGKSVVMVDDSIVRGTTSGKIVKLLKEAGAREVHVCISSPPVTD 402


>gi|220929597|ref|YP_002506506.1| amidophosphoribosyltransferase [Clostridium cellulolyticum H10]
 gi|219999925|gb|ACL76526.1| amidophosphoribosyltransferase [Clostridium cellulolyticum H10]
          Length = 487

 Score = 61.0 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 1/56 (1%)

Query: 4   AFNV-PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           A  +    + K V G ++++IDD    G T +     LKKAGA  V +   S  +K
Sbjct: 355 AVRIKHNAIKKSVEGKRVVIIDDSIVRGTTTRRIVQILKKAGAKEVHMRVSSPPIK 410


>gi|187922548|ref|YP_001894190.1| phosphoribosyltransferase [Burkholderia phytofirmans PsJN]
 gi|187713742|gb|ACD14966.1| phosphoribosyltransferase [Burkholderia phytofirmans PsJN]
          Length = 261

 Score = 61.0 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 31/56 (55%), Gaps = 4/56 (7%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           AF V       V GL + ++DDV TTGAT +  A ALK AGA  V+     R+ K+
Sbjct: 210 AFKVA----GSVRGLHVGIVDDVMTTGATLEALARALKAAGARRVTNFVALRTPKN 261


>gi|113461631|ref|YP_719700.1| competence protein [Haemophilus somnus 129PT]
 gi|112823674|gb|ABI25763.1| competence protein [Haemophilus somnus 129PT]
          Length = 232

 Score = 61.0 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + NAF+V   + +      I LIDDV TTG+T    A  LK+AG   + +   +++
Sbjct: 179 LHNAFSVN--IKRAKQYHSIALIDDVITTGSTLNEIAKLLKQAGINVIHVWGLAKT 232


>gi|326796205|ref|YP_004314025.1| ribose-phosphate pyrophosphokinase [Marinomonas mediterranea MMB-1]
 gi|326546969|gb|ADZ92189.1| ribose-phosphate pyrophosphokinase [Marinomonas mediterranea MMB-1]
          Length = 315

 Score = 61.0 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +L+DD+  TG T   AA ALK+ GA  V        L 
Sbjct: 206 HLIGDVEGKTCVLVDDMCDTGGTLCAAAKALKEHGAEKVLAYCTHPVLS 254


>gi|184201370|ref|YP_001855577.1| ribose-phosphate pyrophosphokinase [Kocuria rhizophila DC2201]
 gi|183581600|dbj|BAG30071.1| phosphoribosylpyrophosphate synthase [Kocuria rhizophila DC2201]
          Length = 326

 Score = 61.0 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 22/53 (41%)

Query: 6   NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            V + V  ++ G   +LIDD+  TG T   A   LK  GA  V I        
Sbjct: 212 AVSKEVVGNIQGRTCVLIDDMIDTGGTITGAVQVLKDQGAKNVIIAATHAVFS 264


>gi|168204666|ref|ZP_02630671.1| amidophosphoribosyltransferase [Clostridium perfringens E str.
           JGS1987]
 gi|170663862|gb|EDT16545.1| amidophosphoribosyltransferase [Clostridium perfringens E str.
           JGS1987]
          Length = 481

 Score = 61.0 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           A  +   +  +V G +++LIDD    G T+K    +L++AGA  V  L  S  +K
Sbjct: 349 AVKLNP-LKVNVNGKRVILIDDSIVRGTTSKHLIESLRRAGAKEVHFLVASPMVK 402


>gi|116617377|ref|YP_817748.1| amidophosphoribosyltransferase [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
 gi|116096224|gb|ABJ61375.1| Predicted amidophosphoribosyltransferase [Leuconostoc mesenteroides
           subsp. mesenteroides ATCC 8293]
          Length = 224

 Score = 61.0 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 26/41 (63%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           + G  ILL+DDVYTTG+T   AA  L   GA +V  ++ +R
Sbjct: 184 IEGQSILLVDDVYTTGSTLHHAADLLLAHGADSVKSISLAR 224


>gi|110803721|ref|YP_697999.1| amidophosphoribosyltransferase [Clostridium perfringens SM101]
 gi|110684222|gb|ABG87592.1| amidophosphoribosyltransferase [Clostridium perfringens SM101]
          Length = 473

 Score = 61.0 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           A  +   +  +V G +++LIDD    G T+K    +L++AGA  V  L  S  +K
Sbjct: 341 AVKLNP-LKVNVNGKRVILIDDSIVRGTTSKHLIESLRRAGAKEVHFLVASPMVK 394


>gi|212640411|ref|YP_002316931.1| competence protein FC [Anoxybacillus flavithermus WK1]
 gi|212561891|gb|ACJ34946.1| Competence protein FC [Anoxybacillus flavithermus WK1]
          Length = 222

 Score = 61.0 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 21/44 (47%), Positives = 28/44 (63%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + VAG +I+++DD+YTTGAT   AA  L  AGA  +   T  RS
Sbjct: 179 EDVAGKRIVIVDDIYTTGATVHEAAKLLHDAGAQEICSFTLVRS 222


>gi|254455299|ref|ZP_05068728.1| ribose-phosphate pyrophosphokinase [Candidatus Pelagibacter sp.
           HTCC7211]
 gi|207082301|gb|EDZ59727.1| ribose-phosphate pyrophosphokinase [Candidatus Pelagibacter sp.
           HTCC7211]
          Length = 310

 Score = 61.0 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 21/46 (45%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
             V     +++DD+  +G T   AA ALKK GA  V +      L 
Sbjct: 205 GDVKDKTCIIVDDIIDSGGTIVNAAKALKKRGAKEVYVYITHGVLS 250


>gi|255322147|ref|ZP_05363294.1| ribose-Phosphate pyrophosphokinase [Campylobacter showae RM3277]
 gi|255300845|gb|EET80115.1| ribose-Phosphate pyrophosphokinase [Campylobacter showae RM3277]
          Length = 309

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 22/46 (47%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
             VAG  ++L+DD+  TG T   AA   K+ GA +V        L 
Sbjct: 207 GDVAGKDVILVDDMIDTGGTIVKAAKVFKERGATSVMACCTHAVLS 252


>gi|168217188|ref|ZP_02642813.1| amidophosphoribosyltransferase [Clostridium perfringens NCTC 8239]
 gi|169344538|ref|ZP_02865507.1| amidophosphoribosyltransferase [Clostridium perfringens C str.
           JGS1495]
 gi|169297458|gb|EDS79567.1| amidophosphoribosyltransferase [Clostridium perfringens C str.
           JGS1495]
 gi|182380731|gb|EDT78210.1| amidophosphoribosyltransferase [Clostridium perfringens NCTC 8239]
          Length = 481

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           A  +   +  +V G +++LIDD    G T+K    +L++AGA  V  L  S  +K
Sbjct: 349 AVKLNP-LKVNVNGKRVILIDDSIVRGTTSKHLIESLRRAGAKEVHFLVASPMVK 402


>gi|317509006|ref|ZP_07966637.1| ribose-phosphate diphosphokinase [Segniliparus rugosus ATCC
           BAA-974]
 gi|316252661|gb|EFV12100.1| ribose-phosphate diphosphokinase [Segniliparus rugosus ATCC
           BAA-974]
          Length = 326

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 22/49 (44%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           V   V G   ++IDD+  TG T   A   L ++GA  V +      L D
Sbjct: 217 VVGDVKGRTCVIIDDMIDTGGTIAGAIRLLHESGAKEVIVAATHGILSD 265


>gi|256833318|ref|YP_003162045.1| hypoxanthine phosphoribosyltransferase [Jonesia denitrificans DSM
           20603]
 gi|256686849|gb|ACV09742.1| hypoxanthine phosphoribosyltransferase [Jonesia denitrificans DSM
           20603]
          Length = 183

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 10/53 (18%), Positives = 23/53 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + +   + G  +L+++D+  +G T       LK  G  ++ + T  R
Sbjct: 82  GVVRILKDLDTDLEGRHVLIVEDIIDSGLTLSWLISNLKSRGPASLEVATMFR 134


>gi|148543504|ref|YP_001270874.1| hypoxanthine phosphoribosyltransferase [Lactobacillus reuteri DSM
           20016]
 gi|184152911|ref|YP_001841252.1| hypoxanthine-guanine phosphoribosyltransferase [Lactobacillus
           reuteri JCM 1112]
 gi|227363653|ref|ZP_03847767.1| hypoxanthine phosphoribosyltransferase [Lactobacillus reuteri
           MM2-3]
 gi|325681848|ref|ZP_08161367.1| hypoxanthine phosphoribosyltransferase [Lactobacillus reuteri
           MM4-1A]
 gi|148530538|gb|ABQ82537.1| hypoxanthine phosphoribosyltransferase [Lactobacillus reuteri DSM
           20016]
 gi|183224255|dbj|BAG24772.1| hypoxanthine-guanine phosphoribosyltransferase [Lactobacillus
           reuteri JCM 1112]
 gi|227071322|gb|EEI09631.1| hypoxanthine phosphoribosyltransferase [Lactobacillus reuteri
           MM2-3]
 gi|324978939|gb|EGC15887.1| hypoxanthine phosphoribosyltransferase [Lactobacillus reuteri
           MM4-1A]
          Length = 180

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 10/51 (19%), Positives = 21/51 (41%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               +   +   V    +L+++D+  TG T K     L   GA ++ + + 
Sbjct: 77  GKVKLIHDLKIDVKDRHVLIMEDIVDTGRTLKYLMDLLADRGAKSIKVCSL 127


>gi|227876328|ref|ZP_03994441.1| ribose-phosphate diphosphokinase [Mobiluncus mulieris ATCC 35243]
 gi|269976096|ref|ZP_06183095.1| ribose-phosphate pyrophosphokinase [Mobiluncus mulieris 28-1]
 gi|306817219|ref|ZP_07450966.1| phosphoribosyl pyrophosphate synthetase [Mobiluncus mulieris ATCC
           35239]
 gi|307701519|ref|ZP_07638537.1| ribose-phosphate diphosphokinase [Mobiluncus mulieris FB024-16]
 gi|227843101|gb|EEJ53297.1| ribose-phosphate diphosphokinase [Mobiluncus mulieris ATCC 35243]
 gi|269935689|gb|EEZ92224.1| ribose-phosphate pyrophosphokinase [Mobiluncus mulieris 28-1]
 gi|304650021|gb|EFM47299.1| phosphoribosyl pyrophosphate synthetase [Mobiluncus mulieris ATCC
           35239]
 gi|307613311|gb|EFN92562.1| ribose-phosphate diphosphokinase [Mobiluncus mulieris FB024-16]
          Length = 323

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 23/55 (41%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
             V   V   V G   +L+DD+  TG T   A   LK AGA  V +      L D
Sbjct: 211 VAVANRVVGEVEGRTCVLVDDLIDTGGTIAEAVGVLKAAGAKDVLVAATHGVLSD 265


>gi|18309665|ref|NP_561599.1| amidophosphoribosyltransferase [Clostridium perfringens str. 13]
 gi|18144342|dbj|BAB80389.1| phosphoribosylpyrophosphate amidotransferase [Clostridium
           perfringens str. 13]
          Length = 481

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           A  +   +  +V G +++LIDD    G T+K    +L++AGA  V  L  S  +K
Sbjct: 349 AVKLNP-LKVNVNGKRVILIDDSIVRGTTSKHLIESLRRAGAKEVHFLVASPMVK 402


>gi|291516360|emb|CBK69976.1| hypoxanthine phosphoribosyltransferase [Bifidobacterium longum
           subsp. longum F8]
          Length = 190

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               V Q +S  V G  IL+++D+  +G T       LK+ GA +V +   
Sbjct: 85  GEVTVRQDLSADVRGRHILIVEDIVDSGRTLAWLVAELKRRGAASVEVFAL 135


>gi|302900010|ref|XP_003048176.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256729108|gb|EEU42463.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 444

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 17/41 (41%), Positives = 21/41 (51%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51
           +   VA    +L+DD+  TG T   AA  LKK GA  V  L
Sbjct: 335 LVGDVANRICILVDDIIDTGNTITRAAKLLKKEGATKVYAL 375


>gi|163841718|ref|YP_001626123.1| ribose-phosphate pyrophosphokinase [Renibacterium salmoninarum ATCC
           33209]
 gi|162955194|gb|ABY24709.1| ribose-phosphate pyrophosphokinase [Renibacterium salmoninarum ATCC
           33209]
          Length = 326

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 23/54 (42%)

Query: 6   NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            V + V   + G   +LIDD+  TG T   A   LK AGA  V I        D
Sbjct: 212 AVSKQVVGQIEGRTCVLIDDMIDTGGTIAGAVQVLKDAGARDVIIAATHAVFSD 265


>gi|258512527|ref|YP_003185961.1| ComF family protein [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|257479253|gb|ACV59572.1| ComF family protein [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 245

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +   F         + G ++LL+DDV TTGAT    A AL  AGA  V  +  +R 
Sbjct: 191 LAGQF--VAADPGAIWGRRVLLVDDVMTTGATLATCAQALYGAGARAVHAVVIARV 244


>gi|288554948|ref|YP_003426883.1| amidophosphoribosyltransferase [Bacillus pseudofirmus OF4]
 gi|288546108|gb|ADC49991.1| amidophosphoribosyltransferase [Bacillus pseudofirmus OF4]
          Length = 470

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 26/50 (52%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            V   V G ++++IDD    G T++     L++AGA  V +   S  +K+
Sbjct: 341 AVRGVVEGKRVVMIDDSIVRGTTSRRIVRMLREAGAKEVHVRISSPPIKN 390


>gi|257870895|ref|ZP_05650548.1| ribose-phosphate pyrophosphokinase [Enterococcus gallinarum EG2]
 gi|257805059|gb|EEV33881.1| ribose-phosphate pyrophosphokinase [Enterococcus gallinarum EG2]
          Length = 325

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 17/40 (42%), Positives = 22/40 (55%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
             VAG K +L+DD+  TG T   AA  LK+AGA  +    
Sbjct: 214 GDVAGKKCILVDDILNTGKTLSKAADLLKEAGASEIYACV 253


>gi|150024259|ref|YP_001295085.1| ribose-phosphate pyrophosphokinase [Flavobacterium psychrophilum
           JIP02/86]
 gi|149770800|emb|CAL42265.1| Ribose-phosphate diphosphokinase [Flavobacterium psychrophilum
           JIP02/86]
          Length = 313

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 24/49 (48%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            +   V G  ++L+DD+  TG T   AA  + + GA++V  +     L 
Sbjct: 207 ELIGEVKGRHVILVDDMIDTGGTLAKAADLMIEKGALSVRAICTHAILS 255


>gi|332638169|ref|ZP_08417032.1| amidophosphoribosyltransferase [Weissella cibaria KACC 11862]
          Length = 511

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 25/49 (51%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            V   VAG +++L+DD    G T+      L++AGA  V +   S + K
Sbjct: 347 AVPSVVAGKRVVLVDDSIVRGTTSSYIVKMLREAGAKEVHVRIASPAFK 395


>gi|237786215|ref|YP_002906920.1| Hypoxanthine-guanine phosphoribosyltransferase [Corynebacterium
           kroppenstedtii DSM 44385]
 gi|237759127|gb|ACR18377.1| Hypoxanthine-guanine phosphoribosyltransferase [Corynebacterium
           kroppenstedtii DSM 44385]
          Length = 195

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 11/53 (20%), Positives = 24/53 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + + + + G  +++I+DV  +G T       LK     ++ I+T  R
Sbjct: 93  GVVRILKDLDRDIHGRNVVIIEDVIDSGLTLHWLIKNLKSRKPNSLRIVTLLR 145


>gi|198282558|ref|YP_002218879.1| competence protein F [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|198247079|gb|ACH82672.1| competence protein F [Acidithiobacillus ferrooxidans ATCC 53993]
          Length = 237

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 5/57 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +  AF + + V        + ++DDV TTG TA   A  L+ AG   + +   +R+L
Sbjct: 186 LDAAFALRERVPD-----HVAVVDDVLTTGTTAAQIASTLRAAGVQRIDVWVLARAL 237


>gi|145590121|ref|YP_001156718.1| phosphoribosyltransferase [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|145048527|gb|ABP35154.1| phosphoribosyltransferase [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
          Length = 247

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 15/59 (25%), Positives = 26/59 (44%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++N F +       +    +++ DDV T+GAT    A  LK++    V      R+ K 
Sbjct: 188 IQNMFFIDTKYLDFLKDKTVVVFDDVMTSGATLNEIARILKESDVKRVINWVLLRTTKQ 246


>gi|293191261|ref|ZP_06609168.1| hypoxanthine phosphoribosyltransferase [Actinomyces odontolyticus
           F0309]
 gi|292820586|gb|EFF79556.1| hypoxanthine phosphoribosyltransferase [Actinomyces odontolyticus
           F0309]
          Length = 179

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 14/53 (26%), Positives = 25/53 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + + + VAG  +L+++D+  +G T       L   GA +V I T  R
Sbjct: 77  GVVRILKDLDQDVAGRHVLIVEDIIDSGLTLSWLQANLLGRGASSVKIATALR 129


>gi|260881530|ref|ZP_05404655.2| hypoxanthine phosphoribosyltransferase [Mitsuokella multacida DSM
           20544]
 gi|260848700|gb|EEX68707.1| hypoxanthine phosphoribosyltransferase [Mitsuokella multacida DSM
           20544]
          Length = 184

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 8/51 (15%), Positives = 21/51 (41%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   VAG  +++I+D+  +G T        ++    +V +   
Sbjct: 83  GTVKILKDLDYDVAGKHLIIIEDIIDSGTTMNYLMKYFRERKPKSVKLCAL 133


>gi|46190491|ref|ZP_00121459.2| COG0634: Hypoxanthine-guanine phosphoribosyltransferase
           [Bifidobacterium longum DJO10A]
          Length = 190

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               V Q +S  V G  IL+++D+  +G T       LK+ GA +V +   
Sbjct: 85  GEVTVRQDLSADVRGRHILIVEDIVDSGHTLAWLVAELKRRGAASVEVFAL 135


>gi|326204444|ref|ZP_08194302.1| amidophosphoribosyltransferase [Clostridium papyrosolvens DSM 2782]
 gi|325985476|gb|EGD46314.1| amidophosphoribosyltransferase [Clostridium papyrosolvens DSM 2782]
          Length = 487

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 1/56 (1%)

Query: 4   AFNV-PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           A  +    + K V G ++++IDD    G T +     LKKAGA  V +   S  +K
Sbjct: 355 AVRIKHNAIKKSVEGKRVVIIDDSIVRGTTTRRIVQVLKKAGAKEVHMRVSSPPIK 410


>gi|110800675|ref|YP_695127.1| amidophosphoribosyltransferase [Clostridium perfringens ATCC 13124]
 gi|110675322|gb|ABG84309.1| amidophosphoribosyltransferase [Clostridium perfringens ATCC 13124]
          Length = 473

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           A  +   +  +V G +++LIDD    G T+K    +L++AGA  V  L  S  +K
Sbjct: 341 AVKLNP-LKVNVNGKRVILIDDSIVRGTTSKHLIESLRRAGAKEVHFLVASPMVK 394


>gi|327401410|ref|YP_004342249.1| ribose-phosphate pyrophosphokinase [Archaeoglobus veneficus SNP6]
 gi|327316918|gb|AEA47534.1| ribose-phosphate pyrophosphokinase [Archaeoglobus veneficus SNP6]
          Length = 284

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 26/51 (50%)

Query: 7   VPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           + +     V G  ++++DD+ +TGAT   A   LK+AG   + ++     L
Sbjct: 192 IIESAPADVEGRDVIIVDDMISTGATVVQAIKVLKRAGCGKIYVMCTHPVL 242


>gi|325929420|ref|ZP_08190548.1| putative amidophosphoribosyltransferase [Xanthomonas perforans
           91-118]
 gi|325540195|gb|EGD11809.1| putative amidophosphoribosyltransferase [Xanthomonas perforans
           91-118]
          Length = 222

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 5/56 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R+AF     +        + L+DDV TTGAT   AA AL+KAG   V     +R 
Sbjct: 171 LRDAFEARGALPA-----HVALVDDVMTTGATLHAAAKALRKAGVQRVDAWVCARV 221


>gi|319945955|ref|ZP_08020205.1| amidophosphoribosyltransferase [Streptococcus australis ATCC
           700641]
 gi|319748020|gb|EFW00264.1| amidophosphoribosyltransferase [Streptococcus australis ATCC
           700641]
          Length = 479

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 26/48 (54%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
            VS  V G ++++IDD    G T++     LK+AGA  V +   S +L
Sbjct: 343 AVSGVVKGKRVVMIDDSIVRGTTSRRIVKLLKEAGATEVHVAIASPAL 390


>gi|296454757|ref|YP_003661900.1| hypoxanthine phosphoribosyltransferase [Bifidobacterium longum
           subsp. longum JDM301]
 gi|312133973|ref|YP_004001312.1| hpt [Bifidobacterium longum subsp. longum BBMN68]
 gi|322691769|ref|YP_004221339.1| hypoxanthine-guanine phosphoribosyltransferase [Bifidobacterium
           longum subsp. longum JCM 1217]
 gi|296184188|gb|ADH01070.1| hypoxanthine phosphoribosyltransferase [Bifidobacterium longum
           subsp. longum JDM301]
 gi|311773272|gb|ADQ02760.1| Hpt [Bifidobacterium longum subsp. longum BBMN68]
 gi|320456625|dbj|BAJ67247.1| hypoxanthine-guanine phosphoribosyltransferase [Bifidobacterium
           longum subsp. longum JCM 1217]
          Length = 187

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               V Q +S  V G  IL+++D+  +G T       LK+ GA +V +   
Sbjct: 82  GEVTVRQDLSADVRGRHILIVEDIVDSGRTLAWLVAELKRRGAASVEVFAL 132


>gi|163841945|ref|YP_001626350.1| hypoxanthine-guanine phosphoribosyltransferase [Renibacterium
           salmoninarum ATCC 33209]
 gi|162955421|gb|ABY24936.1| hypoxanthine-guanine phosphoribosyltransferase [Renibacterium
           salmoninarum ATCC 33209]
          Length = 183

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 11/53 (20%), Positives = 22/53 (41%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + +   + G  +L+++D+  +G T       L   G  +V I T  R
Sbjct: 82  GVVRILKDLETDLMGKHVLIVEDIIDSGLTLSWLRANLISRGPASVEICTLLR 134


>gi|90412786|ref|ZP_01220786.1| ribose-phosphate pyrophosphokinase [Photobacterium profundum 3TCK]
 gi|90326145|gb|EAS42572.1| ribose-phosphate pyrophosphokinase [Photobacterium profundum 3TCK]
          Length = 315

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 21/49 (42%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +++DD+  TG T   AA ALK  GA  V          
Sbjct: 206 HLIGDVEGRDCIIVDDMIDTGGTLCKAAEALKDRGAKRVFAYATHPVFS 254


>gi|298207388|ref|YP_003715567.1| ribose-phosphate pyrophosphokinase [Croceibacter atlanticus
           HTCC2559]
 gi|83850024|gb|EAP87892.1| ribose-phosphate pyrophosphokinase [Croceibacter atlanticus
           HTCC2559]
          Length = 313

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 13/49 (26%), Positives = 22/49 (44%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            +   V G  ++L+DD+  T  T   AA  + + GA +V  +     L 
Sbjct: 207 ELIGDVTGKNVILVDDMVDTAGTLTKAADLMMERGAKSVRAICTHPILS 255


>gi|329122060|ref|ZP_08250668.1| hypoxanthine phosphoribosyltransferase [Dialister micraerophilus
           DSM 19965]
 gi|327466867|gb|EGF12383.1| hypoxanthine phosphoribosyltransferase [Dialister micraerophilus
           DSM 19965]
          Length = 181

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 9/50 (18%), Positives = 21/50 (42%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
               + + +   + G  +++++D+  TG T         + GA +V I  
Sbjct: 78  GEVQIKKDIDSDIKGKHVIIVEDIIDTGITMAALKNIFCERGAESVEIAV 127


>gi|300727430|ref|ZP_07060839.1| competence protein [Prevotella bryantii B14]
 gi|299775310|gb|EFI71909.1| competence protein [Prevotella bryantii B14]
          Length = 231

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 22/53 (41%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           +R  F +       V G  ILLIDD+ TTGAT       + KAG + +SILT 
Sbjct: 176 VRGLFKLTHPEK--VRGKHILLIDDICTTGATMVSCGKEIAKAGNVKISILTL 226


>gi|256848387|ref|ZP_05553830.1| hypoxanthine phosphoribosyltransferase [Lactobacillus coleohominis
           101-4-CHN]
 gi|256714985|gb|EEU29963.1| hypoxanthine phosphoribosyltransferase [Lactobacillus coleohominis
           101-4-CHN]
          Length = 183

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
            +  +   +   + G  +++ +D+  TG T K     LK  GA ++ I + 
Sbjct: 78  GSVKLLHDLKNDIKGKDVIVCEDIVDTGRTLKFLIDLLKDRGANSIKICSI 128


>gi|256420578|ref|YP_003121231.1| ribose-phosphate pyrophosphokinase [Chitinophaga pinensis DSM 2588]
 gi|256035486|gb|ACU59030.1| ribose-phosphate pyrophosphokinase [Chitinophaga pinensis DSM 2588]
          Length = 315

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 20/46 (43%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
             V    I+LIDD+  T  T   AA  LK+ GA +V        L 
Sbjct: 207 GDVKDRDIVLIDDICDTAGTLTKAANLLKEKGARSVRAFCTHPVLS 252


>gi|225568551|ref|ZP_03777576.1| hypothetical protein CLOHYLEM_04628 [Clostridium hylemonae DSM
           15053]
 gi|225162779|gb|EEG75398.1| hypothetical protein CLOHYLEM_04628 [Clostridium hylemonae DSM
           15053]
          Length = 235

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 24/53 (45%), Positives = 30/53 (56%), Gaps = 3/53 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           +R AF V ++     +   +LLIDD+YTTG T   AA  LKKAG   V  LT 
Sbjct: 180 VRGAFAVTEHFRPVPS---VLLIDDIYTTGNTVDAAAEILKKAGVENVCFLTI 229


>gi|149917476|ref|ZP_01905974.1| hypoxanthine-guanine phosphoribosyltransferase [Plesiocystis
           pacifica SIR-1]
 gi|149821813|gb|EDM81209.1| hypoxanthine-guanine phosphoribosyltransferase [Plesiocystis
           pacifica SIR-1]
          Length = 195

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 8/51 (15%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + + + ++G  +++++D+  +G T +     L+  G  +V I   
Sbjct: 90  GVVRILKDLDRSISGRDVIIVEDIIDSGLTLQYLRENLRGRGPASVEIAAL 140


>gi|229824540|ref|ZP_04450609.1| hypothetical protein GCWU000282_01884 [Catonella morbi ATCC 51271]
 gi|229785911|gb|EEP22025.1| hypothetical protein GCWU000282_01884 [Catonella morbi ATCC 51271]
          Length = 181

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V G  IL+++D+  TG T K     L    A +V + T 
Sbjct: 78  GEVKIVKDLDTRVEGKDILIVEDIIDTGQTLKYIVDLLHYRKANSVKVCTL 128


>gi|254468484|ref|ZP_05081890.1| hypoxanthine-guanine phosphoribosyltransferase [beta
           proteobacterium KB13]
 gi|207087294|gb|EDZ64577.1| hypoxanthine-guanine phosphoribosyltransferase [beta
           proteobacterium KB13]
          Length = 174

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 23/53 (43%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           + N   V +   + V    ILL+DD+   G T       LKK GA TV+    
Sbjct: 76  LHNGIWVHKPTREEVLNKHILLVDDILDEGNTLFECQSLLKKLGAKTVTSCVL 128


>gi|182624135|ref|ZP_02951922.1| amidophosphoribosyltransferase [Clostridium perfringens D str.
           JGS1721]
 gi|177910751|gb|EDT73111.1| amidophosphoribosyltransferase [Clostridium perfringens D str.
           JGS1721]
          Length = 481

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           A  +   +  +V G +++LIDD    G T+K    +L++AGA  V  L  S  +K
Sbjct: 349 AVKLNP-LKVNVNGKRVILIDDSIVRGTTSKHLIESLRRAGAKEVHFLVASPMVK 402


>gi|121535065|ref|ZP_01666882.1| hypoxanthine phosphoribosyltransferase [Thermosinus carboxydivorans
           Nor1]
 gi|121306315|gb|EAX47240.1| hypoxanthine phosphoribosyltransferase [Thermosinus carboxydivorans
           Nor1]
          Length = 179

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 9/51 (17%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + + + V G  +L+++D+  +G T       L+     ++ I T 
Sbjct: 77  GVVRILKDLDEDVEGKHLLIVEDIIDSGLTLNYLLDNLRSRKPASIKICTL 127


>gi|332532473|ref|ZP_08408351.1| ribose-phosphate pyrophosphokinase [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332038116|gb|EGI74563.1| ribose-phosphate pyrophosphokinase [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 315

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +++DD+  TG T   AA ALK+ GA  V        L 
Sbjct: 206 HIIGDVEGRDCIIVDDMIDTGGTLCKAAEALKEHGAKRVFAYATHPILS 254


>gi|227873146|ref|ZP_03991437.1| possible competence protein F [Oribacterium sinus F0268]
 gi|227840977|gb|EEJ51316.1| possible competence protein F [Oribacterium sinus F0268]
          Length = 252

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 29/46 (63%), Gaps = 2/46 (4%)

Query: 9   QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           + +   V   ++LL+DD++TTGAT +  +  L +AGA  V IL+ +
Sbjct: 204 EALPSDV--KRVLLVDDIFTTGATMEACSRKLLEAGAEEVHILSIA 247


>gi|328908360|gb|EGG28119.1| ribose-phosphate pyrophosphokinase [Propionibacterium sp. P08]
          Length = 322

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 23/52 (44%)

Query: 8   PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
              V   V G   LL+DD+  T  T   AA+ALKK GA  V        L D
Sbjct: 213 THEVVGEVEGKTCLLVDDMVDTAGTMCQAALALKKHGAKRVIAAATHPILSD 264


>gi|23466229|ref|NP_696832.1| hypoxanthine-guanine phosphoribosyltransferase [Bifidobacterium
           longum NCC2705]
 gi|317482116|ref|ZP_07941140.1| hypoxanthine phosphoribosyltransferase [Bifidobacterium sp.
           12_1_47BFAA]
 gi|322689830|ref|YP_004209564.1| hypoxanthine-guanine phosphoribosyltransferase [Bifidobacterium
           longum subsp. infantis 157F]
 gi|23326974|gb|AAN25468.1| hypoxanthine-guanine phosphoribosyltransferase [Bifidobacterium
           longum NCC2705]
 gi|316916475|gb|EFV37873.1| hypoxanthine phosphoribosyltransferase [Bifidobacterium sp.
           12_1_47BFAA]
 gi|320461166|dbj|BAJ71786.1| hypoxanthine-guanine phosphoribosyltransferase [Bifidobacterium
           longum subsp. infantis 157F]
          Length = 187

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               V Q +S  V G  IL+++D+  +G T       LK+ GA +V +   
Sbjct: 82  GEVTVRQDLSADVRGRHILIVEDIVDSGRTLAWLVAELKRRGAASVEVFAL 132


>gi|325962652|ref|YP_004240558.1| ribose-phosphate pyrophosphokinase [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323468739|gb|ADX72424.1| ribose-phosphate pyrophosphokinase [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 326

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 23/54 (42%)

Query: 6   NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            V + V   + G   +LIDD+  TG T   A   LK AGA  V I        D
Sbjct: 212 AVSKTVVGQIEGRTCVLIDDMIDTGGTISGAVQVLKNAGAKDVIIAATHAVFSD 265


>gi|163786661|ref|ZP_02181109.1| ribose-phosphate diphosphokinase (phosphoribosylpyrophosphate
           synthetase) [Flavobacteriales bacterium ALC-1]
 gi|159878521|gb|EDP72577.1| ribose-phosphate diphosphokinase (phosphoribosylpyrophosphate
           synthetase) [Flavobacteriales bacterium ALC-1]
          Length = 313

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 13/49 (26%), Positives = 22/49 (44%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            +   V G  ++L+DD+  T  T   AA  + + GA +V  +     L 
Sbjct: 207 ELIGDVTGKNVVLVDDMVDTAGTLTKAADLMMERGAKSVRAICTHPILS 255


>gi|154505998|ref|ZP_02042736.1| hypothetical protein RUMGNA_03540 [Ruminococcus gnavus ATCC 29149]
 gi|153793497|gb|EDN75917.1| hypothetical protein RUMGNA_03540 [Ruminococcus gnavus ATCC 29149]
          Length = 191

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           ++ AF V +     +    +L+IDD+YTTG T    A  LK AGA  V  LT 
Sbjct: 136 LKGAFGVTKSW---IPKKCVLVIDDIYTTGNTIHRVAKVLKNAGAQKVYFLTI 185


>gi|26987458|ref|NP_742883.1| ribose-phosphate pyrophosphokinase [Pseudomonas putida KT2440]
 gi|325277194|ref|ZP_08142837.1| ribose-phosphate pyrophosphokinase [Pseudomonas sp. TJI-51]
 gi|32469696|sp|Q88PX6|KPRS_PSEPK RecName: Full=Ribose-phosphate pyrophosphokinase; Short=RPPK;
           AltName: Full=Phosphoribosyl pyrophosphate synthase;
           Short=P-Rib-PP synthase; Short=PRPP synthase
 gi|24982121|gb|AAN66347.1|AE016263_4 ribose-phosphate pyrophosphokinase [Pseudomonas putida KT2440]
 gi|313497088|gb|ADR58454.1| PrsA [Pseudomonas putida BIRD-1]
 gi|324097680|gb|EGB95883.1| ribose-phosphate pyrophosphokinase [Pseudomonas sp. TJI-51]
          Length = 313

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 22/49 (44%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +L+DD+  T  T   AA ALK+ GA  V        L 
Sbjct: 205 HIIGDVEGRTCILVDDMVDTAGTLCHAAKALKEHGAAKVYAYCTHPVLS 253


>gi|15899961|ref|NP_344565.1| hypoxanthine-guanine phosphoribosyltransferase [Streptococcus
           pneumoniae TIGR4]
 gi|15902055|ref|NP_357605.1| hypoxanthine-guanine phosphoribosyltransferase [Streptococcus
           pneumoniae R6]
 gi|111658619|ref|ZP_01409269.1| hypothetical protein SpneT_02000209 [Streptococcus pneumoniae
           TIGR4]
 gi|116516681|ref|YP_815435.1| hypoxanthine-guanine phosphoribosyltransferase [Streptococcus
           pneumoniae D39]
 gi|148984556|ref|ZP_01817844.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           SP3-BS71]
 gi|148988916|ref|ZP_01820331.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           SP6-BS73]
 gi|148993573|ref|ZP_01823044.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           SP9-BS68]
 gi|149013372|ref|ZP_01834081.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           SP19-BS75]
 gi|168484296|ref|ZP_02709248.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           CDC1873-00]
 gi|168489347|ref|ZP_02713546.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           SP195]
 gi|168493988|ref|ZP_02718131.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           CDC3059-06]
 gi|182682981|ref|YP_001834728.1| hypoxanthine-guanine phosphoribosyltransferase [Streptococcus
           pneumoniae CGSP14]
 gi|194397408|ref|YP_002036733.1| hypoxanthine-guanine phosphoribosyltransferase [Streptococcus
           pneumoniae G54]
 gi|221230960|ref|YP_002510112.1| hypoxanthine-guanine phosphoribosyltransferase [Streptococcus
           pneumoniae ATCC 700669]
 gi|225853623|ref|YP_002735135.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           JJA]
 gi|303254913|ref|ZP_07340998.1| hypoxanthine-guanine phosphoribosyltransferase [Streptococcus
           pneumoniae BS455]
 gi|303259738|ref|ZP_07345714.1| hypoxanthine-guanine phosphoribosyltransferase [Streptococcus
           pneumoniae SP-BS293]
 gi|303262205|ref|ZP_07348150.1| hypoxanthine-guanine phosphoribosyltransferase [Streptococcus
           pneumoniae SP14-BS292]
 gi|303265401|ref|ZP_07351308.1| hypoxanthine-guanine phosphoribosyltransferase [Streptococcus
           pneumoniae BS397]
 gi|303266051|ref|ZP_07351945.1| hypoxanthine-guanine phosphoribosyltransferase [Streptococcus
           pneumoniae BS457]
 gi|303268459|ref|ZP_07354253.1| hypoxanthine-guanine phosphoribosyltransferase [Streptococcus
           pneumoniae BS458]
 gi|76363204|sp|Q97TC4|HPRT_STRPN RecName: Full=Hypoxanthine-guanine phosphoribosyltransferase;
           Short=HGPRT; Short=HGPRTase
 gi|76363205|sp|Q8DRP8|HPRT_STRR6 RecName: Full=Hypoxanthine-guanine phosphoribosyltransferase;
           Short=HGPRT; Short=HGPRTase
 gi|14971476|gb|AAK74205.1| hypoxanthine-guanine phosphoribosyltransferase [Streptococcus
           pneumoniae TIGR4]
 gi|15457539|gb|AAK98815.1| Hypoxanthine guanine phosphoribosyltransferase [Streptococcus
           pneumoniae R6]
 gi|116077257|gb|ABJ54977.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           D39]
 gi|147762895|gb|EDK69843.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           SP19-BS75]
 gi|147923333|gb|EDK74447.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           SP3-BS71]
 gi|147925727|gb|EDK76803.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           SP6-BS73]
 gi|147927794|gb|EDK78816.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           SP9-BS68]
 gi|172042419|gb|EDT50465.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           CDC1873-00]
 gi|182628315|gb|ACB89263.1| hypoxanthine-guanine phosphoribosyltransferase [Streptococcus
           pneumoniae CGSP14]
 gi|183572298|gb|EDT92826.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           SP195]
 gi|183575891|gb|EDT96419.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           CDC3059-06]
 gi|194357075|gb|ACF55523.1| hypoxanthine-guanine phosphoribosyltransferase [Streptococcus
           pneumoniae G54]
 gi|220673420|emb|CAR67878.1| hypoxanthine-guanine phosphoribosyltransferase [Streptococcus
           pneumoniae ATCC 700669]
 gi|225722940|gb|ACO18793.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           JJA]
 gi|301793337|emb|CBW35696.1| hypoxanthine-guanine phosphoribosyltransferase [Streptococcus
           pneumoniae INV104]
 gi|301799161|emb|CBW31673.1| hypoxanthine-guanine phosphoribosyltransferase [Streptococcus
           pneumoniae OXC141]
 gi|301800985|emb|CBW33646.1| hypoxanthine-guanine phosphoribosyltransferase [Streptococcus
           pneumoniae INV200]
 gi|302598184|gb|EFL65245.1| hypoxanthine-guanine phosphoribosyltransferase [Streptococcus
           pneumoniae BS455]
 gi|302636845|gb|EFL67335.1| hypoxanthine-guanine phosphoribosyltransferase [Streptococcus
           pneumoniae SP14-BS292]
 gi|302639290|gb|EFL69749.1| hypoxanthine-guanine phosphoribosyltransferase [Streptococcus
           pneumoniae SP-BS293]
 gi|302641960|gb|EFL72313.1| hypoxanthine-guanine phosphoribosyltransferase [Streptococcus
           pneumoniae BS458]
 gi|302644355|gb|EFL74608.1| hypoxanthine-guanine phosphoribosyltransferase [Streptococcus
           pneumoniae BS457]
 gi|302645078|gb|EFL75318.1| hypoxanthine-guanine phosphoribosyltransferase [Streptococcus
           pneumoniae BS397]
 gi|332071715|gb|EGI82208.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           GA17570]
 gi|332198669|gb|EGJ12752.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           GA41317]
 gi|332198876|gb|EGJ12958.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           GA47368]
          Length = 180

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 25/51 (49%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
              N+ Q V++ + G  +L ++D+  TG T K      K+  A +V I T 
Sbjct: 78  GVINIKQDVTQDIKGRHVLFVEDIIDTGQTLKNLRDMFKEREAASVKIATL 128


>gi|53804513|ref|YP_113594.1| competence protein F [Methylococcus capsulatus str. Bath]
 gi|53758274|gb|AAU92565.1| competence protein F [Methylococcus capsulatus str. Bath]
          Length = 233

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF     + + V    + + DDV TTGATA   A  L+ AG   + +   +R+
Sbjct: 182 IRGAFR----MERAVNVRHVAIFDDVVTTGATAGELARTLRAAGVERIDVWAVARA 233


>gi|331090124|ref|ZP_08339013.1| hypothetical protein HMPREF1025_02596 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|330402586|gb|EGG82155.1| hypothetical protein HMPREF1025_02596 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 191

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 27/53 (50%), Positives = 34/53 (64%), Gaps = 3/53 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           +R+AF + +     VA   +LLIDD+YTTGAT + AA  LKKAGA  V  LT 
Sbjct: 136 LRDAFALSERWKP-VAN--VLLIDDIYTTGATVEQAAKILKKAGAQNVYFLTI 185


>gi|123444170|ref|YP_001008140.1| gluconate periplasmic binding protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|122091131|emb|CAL14014.1| Putative competence-related protein F [Yersinia enterocolitica
           subsp. enterocolitica 8081]
          Length = 227

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           M+  F       + V G  I L+DDV TTG+T    A  L   G  ++ +    R+L
Sbjct: 175 MQGIFR----CMESVRGQHIALLDDVVTTGSTVNEIARLLWAEGIASLQVWCICRTL 227


>gi|238853036|ref|ZP_04643429.1| hypoxanthine phosphoribosyltransferase [Lactobacillus gasseri
           202-4]
 gi|238834334|gb|EEQ26578.1| hypoxanthine phosphoribosyltransferase [Lactobacillus gasseri
           202-4]
          Length = 189

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 20/51 (39%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               +   V   V    +LL++D+  TG T K     L K GA +V     
Sbjct: 83  GKVRLDIDVQADVKDRDVLLVEDIVDTGHTLKFMKDLLNKRGAKSVKCCAL 133


>gi|290969235|ref|ZP_06560760.1| hypoxanthine phosphoribosyltransferase [Megasphaera genomosp.
           type_1 str. 28L]
 gi|290780741|gb|EFD93344.1| hypoxanthine phosphoribosyltransferase [Megasphaera genomosp.
           type_1 str. 28L]
          Length = 179

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 25/51 (49%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
            +  + + +   V G  +L+++D+  TG T       L++ GA +V + T 
Sbjct: 77  GSLTIRKDLDTDVRGKDLLVVEDIIDTGVTLSHLVPLLQERGARSVKLATL 127


>gi|312115454|ref|YP_004013050.1| phosphoribosyltransferase [Rhodomicrobium vannielii ATCC 17100]
 gi|311220583|gb|ADP71951.1| phosphoribosyltransferase [Rhodomicrobium vannielii ATCC 17100]
          Length = 261

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 33/54 (61%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +  AFNV     + VAG ++LL+DDV TTGATA   + AL  AGA  V IL  +
Sbjct: 191 VAEAFNVGASGRRAVAGKRVLLVDDVITTGATANACSTALLAAGARAVDILAVA 244


>gi|299143246|ref|ZP_07036326.1| ribose-phosphate pyrophosphokinase [Peptoniphilus sp. oral taxon
           386 str. F0131]
 gi|298517731|gb|EFI41470.1| ribose-phosphate pyrophosphokinase [Peptoniphilus sp. oral taxon
           386 str. F0131]
          Length = 318

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 20/46 (43%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
             + G   +L+DD+  T  T   AA ALKK GA  V        L 
Sbjct: 212 GDIKGKNCILVDDIVDTAGTICQAAEALKKKGAKKVYGCATHGVLS 257


>gi|297563884|ref|YP_003682857.1| hypoxanthine phosphoribosyltransferase [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
 gi|296848333|gb|ADH70351.1| hypoxanthine phosphoribosyltransferase [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
          Length = 179

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 11/53 (20%), Positives = 22/53 (41%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + +   +    +L+++DV  +G T       LK  G  +V + T  R
Sbjct: 77  GVVRILKDLETDIKDRDVLIVEDVIDSGLTLSWLIGNLKSRGPRSVEVCTMIR 129


>gi|227489339|ref|ZP_03919655.1| hypoxanthine phosphoribosyltransferase [Corynebacterium
           glucuronolyticum ATCC 51867]
 gi|227090712|gb|EEI26024.1| hypoxanthine phosphoribosyltransferase [Corynebacterium
           glucuronolyticum ATCC 51867]
          Length = 186

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 8/53 (15%), Positives = 24/53 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + + + +    +L+++D+  +G T       LK     +++++T  R
Sbjct: 84  GVVRILKDLDREIENRHVLIVEDIIDSGLTLSWLVRNLKSRHPASLNVITLLR 136


>gi|170742923|ref|YP_001771578.1| phosphoribosyltransferase [Methylobacterium sp. 4-46]
 gi|168197197|gb|ACA19144.1| phosphoribosyltransferase [Methylobacterium sp. 4-46]
          Length = 279

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 39/59 (66%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           ++ AF VP+     +AG ++LL+DDV TTG+TA  AA AL + GA  V +L F+  ++D
Sbjct: 205 LQGAFRVPEAARPRLAGRRVLLVDDVITTGSTANAAARALLRGGAAAVDVLAFACVVQD 263


>gi|295132326|ref|YP_003583002.1| ribose-phosphate pyrophosphokinase [Zunongwangia profunda SM-A87]
 gi|294980341|gb|ADF50806.1| ribose-phosphate pyrophosphokinase [Zunongwangia profunda SM-A87]
          Length = 313

 Score = 61.0 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 13/49 (26%), Positives = 22/49 (44%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            +   V G  ++L+DD+  T  T   AA  + + GA +V  +     L 
Sbjct: 207 ELIGDVTGKNVVLVDDMVDTAGTLTKAADLMIERGAKSVRAICTHPVLS 255


>gi|229494981|ref|ZP_04388730.1| ribose-Phosphate pyrophosphokinase [Rhodococcus erythropolis SK121]
 gi|229318075|gb|EEN83947.1| ribose-Phosphate pyrophosphokinase [Rhodococcus erythropolis SK121]
          Length = 326

 Score = 61.0 bits (148), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 23/52 (44%)

Query: 8   PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
              V   V G   +LIDD+  TG T   A   LK+AGA  V I      L D
Sbjct: 214 SNRVVGEVEGRTCILIDDMIDTGGTIAGAVKVLKEAGAGDVVIAATHGVLSD 265


>gi|291457315|ref|ZP_06596705.1| hypoxanthine phosphoribosyltransferase [Bifidobacterium breve DSM
           20213]
 gi|291381150|gb|EFE88668.1| hypoxanthine phosphoribosyltransferase [Bifidobacterium breve DSM
           20213]
          Length = 187

 Score = 61.0 bits (148), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               V Q +S  V G  I++++D+  +G T       LK+ GA +V +   
Sbjct: 82  GEITVRQDLSADVRGRHIVIVEDIVDSGRTLAWLVEELKRRGAASVEVFAL 132


>gi|268611075|ref|ZP_06144802.1| amidophosphoribosyltransferase [Ruminococcus flavefaciens FD-1]
          Length = 473

 Score = 61.0 bits (148), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 2   RNAFNVP-QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
            NA  +    V + VAG ++++IDD    G T+      L+ AGA  V +
Sbjct: 335 ENAVKIKLNAVRETVAGKRVIMIDDSIVRGTTSARIVKLLRDAGAKEVHV 384


>gi|217965695|ref|YP_002351373.1| bifunctional protein TilS/hprT [Listeria monocytogenes HCC23]
 gi|217334965|gb|ACK40759.1| bifunctional protein TilS/hprT [Listeria monocytogenes HCC23]
 gi|307569758|emb|CAR82937.1| bifunctional protein TilS/HprT [Listeria monocytogenes L99]
          Length = 648

 Score = 61.0 bits (148), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + ++  V G  +L+I+D+  +G T       +K   A +V ++T 
Sbjct: 546 GEVKIIKDLNASVEGRDVLVIEDIIDSGRTLSYLVDLIKYRKAKSVKLVTL 596


>gi|27375320|ref|NP_766849.1| competence protein F [Bradyrhizobium japonicum USDA 110]
 gi|27348456|dbj|BAC45474.1| competence protein F [Bradyrhizobium japonicum USDA 110]
          Length = 265

 Score = 61.0 bits (148), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 33/57 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++ AF V       V G +I+LIDDV T+GAT    A AL +A A  V +L F+R +
Sbjct: 206 VQGAFQVSPDRQAEVQGRRIVLIDDVLTSGATLDACARALLRAKAAQVDVLVFARVV 262


>gi|296134288|ref|YP_003641535.1| phosphoribosyltransferase [Thermincola sp. JR]
 gi|296032866|gb|ADG83634.1| phosphoribosyltransferase [Thermincola potens JR]
          Length = 251

 Score = 61.0 bits (148), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++F V      ++ G  +LLIDDV TTG+T +     L  AGA  V +LT +
Sbjct: 186 DSFAVVAD--ANLKGKNVLLIDDVLTTGSTVQECTRTLIMAGAHRVCVLTLA 235


>gi|148546002|ref|YP_001266104.1| ribose-phosphate pyrophosphokinase [Pseudomonas putida F1]
 gi|167031781|ref|YP_001667012.1| ribose-phosphate pyrophosphokinase [Pseudomonas putida GB-1]
 gi|170723622|ref|YP_001751310.1| ribose-phosphate pyrophosphokinase [Pseudomonas putida W619]
 gi|148510060|gb|ABQ76920.1| ribose-phosphate pyrophosphokinase [Pseudomonas putida F1]
 gi|166858269|gb|ABY96676.1| ribose-phosphate pyrophosphokinase [Pseudomonas putida GB-1]
 gi|169761625|gb|ACA74941.1| ribose-phosphate pyrophosphokinase [Pseudomonas putida W619]
          Length = 310

 Score = 61.0 bits (148), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 22/49 (44%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +L+DD+  T  T   AA ALK+ GA  V        L 
Sbjct: 202 HIIGDVEGRTCILVDDMVDTAGTLCHAAKALKEHGAAKVYAYCTHPVLS 250


>gi|299820663|ref|ZP_07052552.1| phosphoribosyl pyrophosphate synthetase [Listeria grayi DSM 20601]
 gi|299817684|gb|EFI84919.1| phosphoribosyl pyrophosphate synthetase [Listeria grayi DSM 20601]
          Length = 318

 Score = 61.0 bits (148), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 21/46 (45%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            +V G   +LIDD+  T  T   AA ALK AGA  V        L 
Sbjct: 214 GNVEGKVCILIDDIIDTAGTITLAANALKNAGATQVYACCTHPVLS 259


>gi|302348864|ref|YP_003816502.1| Phosphoribosyl pyrophosphate synthase (PRPP synthase) [Acidilobus
           saccharovorans 345-15]
 gi|302329276|gb|ADL19471.1| Phosphoribosyl pyrophosphate synthase (PRPP synthase) [Acidilobus
           saccharovorans 345-15]
          Length = 294

 Score = 61.0 bits (148), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 27/49 (55%)

Query: 9   QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +     VAG  ++++DD+ +TG T   AA  LK+ GA ++ ++     L
Sbjct: 199 RPKQLDVAGKDVIIVDDIISTGGTVAKAAEMLKEQGARSIIVMVAHAVL 247


>gi|88811929|ref|ZP_01127182.1| competence protein F [Nitrococcus mobilis Nb-231]
 gi|88790813|gb|EAR21927.1| competence protein F [Nitrococcus mobilis Nb-231]
          Length = 219

 Score = 61.0 bits (148), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 4/55 (7%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           R AF V            + +IDDV TTGAT       L++AGA  V I   +R+
Sbjct: 164 RGAFQVTTRHVPA----HVAVIDDVLTTGATVTELTKTLRRAGAERVEIWVMART 214


>gi|323359403|ref|YP_004225799.1| phosphoribosylpyrophosphate synthetase [Microbacterium testaceum
           StLB037]
 gi|323275774|dbj|BAJ75919.1| phosphoribosylpyrophosphate synthetase [Microbacterium testaceum
           StLB037]
          Length = 344

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 1/59 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           + N  +V + +   V G   LL+DD+  TG T + AA ALK +GA  V +        D
Sbjct: 226 VANQVSVHE-IVGDVKGRTCLLVDDMIDTGGTIQKAAQALKASGARKVIVAATHAIFSD 283


>gi|319655021|ref|ZP_08009092.1| amidophosphoribosyltransferase [Bacillus sp. 2_A_57_CT2]
 gi|317393288|gb|EFV74055.1| amidophosphoribosyltransferase [Bacillus sp. 2_A_57_CT2]
          Length = 465

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 27/50 (54%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            V   V G +++++DD    G T++     LK+AGA  V +L  S  +K+
Sbjct: 341 PVRGVVEGKRVIMVDDSIVRGTTSRRIVTMLKEAGATEVHVLISSPPIKN 390


>gi|268317963|ref|YP_003291682.1| ribose-phosphate pyrophosphokinase [Rhodothermus marinus DSM 4252]
 gi|262335497|gb|ACY49294.1| ribose-phosphate pyrophosphokinase [Rhodothermus marinus DSM 4252]
          Length = 316

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 22/46 (47%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
             V G  +LLIDD+  T  T   AA AL++AGA  +        L 
Sbjct: 213 GEVKGKNVLLIDDIVDTAGTLTNAAKALREAGAREIYAACTHALLS 258


>gi|238754093|ref|ZP_04615451.1| Gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system [Yersinia
           ruckeri ATCC 29473]
 gi|238707589|gb|EEP99948.1| Gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system [Yersinia
           ruckeri ATCC 29473]
          Length = 165

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 26/57 (45%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R  F   +       G  ++L+DDV TTG+T    +  L +    ++ +    R+L
Sbjct: 113 LRGVFRFTEDFR----GQDVVLLDDVITTGSTVSEISHTLMEQKVSSLQVWCICRTL 165


>gi|205372442|ref|ZP_03225255.1| amidophosphoribosyltransferase [Bacillus coahuilensis m4-4]
          Length = 461

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 25/49 (51%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            V   V G +++++DD    G T++     L++AGA  V +   S  +K
Sbjct: 330 PVRGVVEGKRVVMVDDSIVRGTTSRRIVTMLREAGAKEVHVAISSPPIK 378


>gi|188025991|ref|ZP_02960452.2| hypothetical protein PROSTU_02402 [Providencia stuartii ATCC 25827]
 gi|188021174|gb|EDU59214.1| hypothetical protein PROSTU_02402 [Providencia stuartii ATCC 25827]
          Length = 342

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V+G   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 233 HIIGDVSGRDCILVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 281


>gi|77359997|ref|YP_339572.1| ribose-phosphate pyrophosphokinase [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76874908|emb|CAI86129.1| phosphoribosylpyrophosphate synthetase [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 315

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +++DD+  TG T   AA ALK+ GA  V        L 
Sbjct: 206 HIIGDVEGRDCIIVDDMIDTGGTLCKAAEALKEHGAKRVFAYATHPILS 254


>gi|229818435|ref|ZP_04448716.1| hypothetical protein BIFANG_03742 [Bifidobacterium angulatum DSM
           20098]
 gi|229784305|gb|EEP20419.1| hypothetical protein BIFANG_03742 [Bifidobacterium angulatum DSM
           20098]
          Length = 201

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 24/49 (48%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
             V Q +S  V G  IL+++D+  +G T       LK+ GA +V I   
Sbjct: 98  ITVRQDLSTDVRGRHILIVEDIVDSGRTLAWLVEELKRRGAASVEIFAL 146


>gi|213691453|ref|YP_002322039.1| hypoxanthine phosphoribosyltransferase [Bifidobacterium longum
           subsp. infantis ATCC 15697]
 gi|213522914|gb|ACJ51661.1| hypoxanthine phosphoribosyltransferase [Bifidobacterium longum
           subsp. infantis ATCC 15697]
 gi|320457525|dbj|BAJ68146.1| hypoxanthine-guanine phosphoribosyltransferase [Bifidobacterium
           longum subsp. infantis ATCC 15697]
          Length = 187

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               V Q +S  V G  IL+++D+  +G T       LK+ GA +V +   
Sbjct: 82  GEVTVRQDLSADVRGRHILIVEDIVDSGHTLAWLVTELKRRGAASVEVFAL 132


>gi|229829628|ref|ZP_04455697.1| hypothetical protein GCWU000342_01725 [Shuttleworthia satelles DSM
           14600]
 gi|229791617|gb|EEP27731.1| hypothetical protein GCWU000342_01725 [Shuttleworthia satelles DSM
           14600]
          Length = 258

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +  AF + +     + G +ILL+DD+YTTG+T   A+  L +AGA  V +LT  
Sbjct: 200 LEGAFALARE-DICLRGNRILLVDDIYTTGSTCDAASKVLLEAGAEAVYLLTIC 252


>gi|227540927|ref|ZP_03970976.1| hypoxanthine phosphoribosyltransferase [Corynebacterium
           glucuronolyticum ATCC 51866]
 gi|227183187|gb|EEI64159.1| hypoxanthine phosphoribosyltransferase [Corynebacterium
           glucuronolyticum ATCC 51866]
          Length = 186

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 8/53 (15%), Positives = 24/53 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + + + +    +L+++D+  +G T       LK     +++++T  R
Sbjct: 84  GVVRILKDLDREIENRHVLIVEDIIDSGLTLSWLVRNLKSRHPASLNVITLLR 136


>gi|83319716|ref|YP_424203.1| hypoxanthine phosphoribosyltransferase [Mycoplasma capricolum
           subsp. capricolum ATCC 27343]
 gi|83283602|gb|ABC01534.1| hypoxanthine phosphoribosyltransferase [Mycoplasma capricolum
           subsp. capricolum ATCC 27343]
          Length = 190

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 23/48 (47%)

Query: 6   NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
            +   ++  V    IL+++D+  TG T K     L   GA +V ILT 
Sbjct: 88  KINLDLNTDVKDRDILIVEDIIDTGFTLKYVKEYLLNKGAKSVKILTM 135


>gi|313635123|gb|EFS01457.1| bifunctional protein TilS/hprT [Listeria seeligeri FSL N1-067]
          Length = 648

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + ++  V G  +L+I+D+  +G T       +K   A +V ++T 
Sbjct: 546 GEVKIIKDLNASVEGRDVLVIEDIIDSGRTLSYLVDLIKYRKAKSVKLVTL 596


>gi|269836555|ref|YP_003318783.1| phosphoribosyltransferase [Sphaerobacter thermophilus DSM 20745]
 gi|269785818|gb|ACZ37961.1| phosphoribosyltransferase [Sphaerobacter thermophilus DSM 20745]
          Length = 235

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 31/55 (56%), Gaps = 4/55 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           M+ AF         V G  +LLIDDV TTGAT + A +AL +AGA  V  L  +R
Sbjct: 183 MQGAFRSGPG----VRGASVLLIDDVVTTGATMEAAGLALLEAGARHVRGLALAR 233


>gi|270308578|ref|YP_003330636.1| amidophosphoribosyltransferase [Dehalococcoides sp. VS]
 gi|270154470|gb|ACZ62308.1| amidophosphoribosyltransferase [Dehalococcoides sp. VS]
          Length = 472

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 12/50 (24%), Positives = 23/50 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            +   + G +++L+DD    G T       L+KAGA  V +   +  + +
Sbjct: 334 PLRSVLEGKRVVLVDDSIVRGTTTPQVIRLLRKAGAKEVHMRVCAPPITN 383


>gi|123430777|ref|XP_001307954.1| hypoxanthine phosphoribosyltransferase [Trichomonas vaginalis G3]
 gi|121889609|gb|EAX95024.1| hypoxanthine phosphoribosyltransferase, putative [Trichomonas
          vaginalis G3]
          Length = 134

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 24/51 (47%)

Query: 3  NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
              + + +S  +    IL+++D+  TG T       LK  GA ++ I+T 
Sbjct: 29 GEVRILKDISTSIVDKDILIVEDIIDTGVTLSYLTKILKSRGARSIEIVTM 79


>gi|88861340|ref|ZP_01135970.1| ribose-phosphate pyrophosphokinase [Pseudoalteromonas tunicata D2]
 gi|88816606|gb|EAR26431.1| ribose-phosphate pyrophosphokinase [Pseudoalteromonas tunicata D2]
          Length = 312

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +++DD+  TG T   AA ALK+ GA  V        L 
Sbjct: 203 HIIGDVEGRDCIIVDDMIDTGGTLCKAAEALKEHGAKRVFAYATHPILS 251


>gi|313639795|gb|EFS04533.1| bifunctional protein TilS/hprT [Listeria seeligeri FSL S4-171]
          Length = 648

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + ++  V G  +L+I+D+  +G T       +K   A +V ++T 
Sbjct: 546 GEVKIIKDLNASVEGRDVLVIEDIIDSGRTLSYLVDLIKYRKAKSVKLVTL 596


>gi|304440477|ref|ZP_07400365.1| phosphoribosyl pyrophosphate synthetase [Peptoniphilus duerdenii
           ATCC BAA-1640]
 gi|304371043|gb|EFM24661.1| phosphoribosyl pyrophosphate synthetase [Peptoniphilus duerdenii
           ATCC BAA-1640]
          Length = 318

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 20/46 (43%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
             + G   +LIDD+  T  T   AA AL+K GA  V        L 
Sbjct: 214 GDIDGKNCILIDDIIDTAGTICKAAEALRKNGAKKVYGCASHGVLS 259


>gi|302388371|ref|YP_003824193.1| hypoxanthine phosphoribosyltransferase [Clostridium saccharolyticum
           WM1]
 gi|302198999|gb|ADL06570.1| hypoxanthine phosphoribosyltransferase [Clostridium saccharolyticum
           WM1]
          Length = 175

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 8/51 (15%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   + G  +L+++D+  +G T       LK+    ++ + T 
Sbjct: 76  GIVKIIKDLDDPIEGKDVLIVEDIIDSGNTLAYLIEVLKQRNPNSIELCTL 126


>gi|313835382|gb|EFS73096.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL037PA2]
          Length = 310

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 23/52 (44%)

Query: 8   PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
              V   V G   LL+DD+  T  T   AA+ALKK GA  V        L D
Sbjct: 201 THEVVGEVEGKTCLLVDDMVDTAGTMCQAALALKKHGAKRVIAAATHPILSD 252


>gi|104780085|ref|YP_606583.1| ribose-phosphate pyrophosphokinase [Pseudomonas entomophila L48]
 gi|95109072|emb|CAK13768.1| ribose-phosphate pyrophosphokinase (Phosphoribosyl pyrophosphate
           synthetase) [Pseudomonas entomophila L48]
          Length = 309

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 22/49 (44%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +L+DD+  T  T   AA ALK+ GA  V        L 
Sbjct: 201 HIIGDVEGRTCILVDDMVDTAGTLCHAAKALKEHGAAKVYAYCTHPVLS 249


>gi|299142045|ref|ZP_07035179.1| competence protein F [Prevotella oris C735]
 gi|298576507|gb|EFI48379.1| competence protein F [Prevotella oris C735]
          Length = 231

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           +++AF +     + + G  +LLIDDV TTG+T    A  L KAG + VS+L+ 
Sbjct: 176 VKDAFRLQH--PERIIGRHLLLIDDVITTGSTMLACAKELAKAGDIKVSVLSL 226


>gi|220927549|ref|YP_002504458.1| phosphoribosyltransferase [Clostridium cellulolyticum H10]
 gi|219997877|gb|ACL74478.1| phosphoribosyltransferase [Clostridium cellulolyticum H10]
          Length = 220

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 1   MRNAF-NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +++AF  + Q +   +    ILLIDD+ TTG+T      ALK+AGA  V     + +
Sbjct: 164 LQDAFVAINQRM---IVNKNILLIDDILTTGSTVNQCCKALKEAGAGKVIAGVVATT 217


>gi|319899208|ref|YP_004159301.1| competence protein ComF [Bartonella clarridgeiae 73]
 gi|319403172|emb|CBI76731.1| competence protein ComF [Bartonella clarridgeiae 73]
          Length = 247

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 33/58 (56%), Positives = 39/58 (67%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++NAF VP  V K++ G  ILLIDDV TTG T   A   LK AGA  V++LTFSR LK
Sbjct: 182 VQNAFKVPNKVKKYLEGRSILLIDDVLTTGVTVTAATKTLKHAGARQVNVLTFSRVLK 239


>gi|306821123|ref|ZP_07454739.1| hypoxanthine phosphoribosyltransferase [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
 gi|304550816|gb|EFM38791.1| hypoxanthine phosphoribosyltransferase [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
          Length = 172

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   + G  +++++D+  TG T K     L    A +VSI T 
Sbjct: 75  GVVKINKDIEMDLTGKNVIIVEDIIDTGLTLKYIKDYLTGKNAKSVSICTL 125


>gi|306823060|ref|ZP_07456436.1| conserved hypothetical protein [Bifidobacterium dentium ATCC 27679]
 gi|309801325|ref|ZP_07695454.1| phosphoribosyl transferase domain protein [Bifidobacterium dentium
           JCVIHMP022]
 gi|304553692|gb|EFM41603.1| conserved hypothetical protein [Bifidobacterium dentium ATCC 27679]
 gi|308222214|gb|EFO78497.1| phosphoribosyl transferase domain protein [Bifidobacterium dentium
           JCVIHMP022]
          Length = 252

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++    V   +   V G+ ++LIDD+ T+G T +     L++AGA  V++L  + +  
Sbjct: 183 LKGHVAVRSGI--DVRGVPVVLIDDIITSGTTMRRCVEVLQQAGATVVTVLALAYTPP 238


>gi|315274600|ref|ZP_07869470.1| bifunctional protein TilS/hprT [Listeria marthii FSL S4-120]
 gi|313615770|gb|EFR89028.1| bifunctional protein TilS/hprT [Listeria marthii FSL S4-120]
          Length = 648

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + ++  V G  +L+I+D+  +G T       +K   A +V ++T 
Sbjct: 546 GEVKIIKDLNASVEGRDVLVIEDIIDSGRTLSYLVDLIKYRKAKSVKLVTL 596


>gi|153814658|ref|ZP_01967326.1| hypothetical protein RUMTOR_00873 [Ruminococcus torques ATCC 27756]
 gi|317501132|ref|ZP_07959338.1| hypothetical protein HMPREF1026_01281 [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|145848152|gb|EDK25070.1| hypothetical protein RUMTOR_00873 [Ruminococcus torques ATCC 27756]
 gi|316897519|gb|EFV19584.1| hypothetical protein HMPREF1026_01281 [Lachnospiraceae bacterium
           8_1_57FAA]
          Length = 191

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 27/53 (50%), Positives = 34/53 (64%), Gaps = 3/53 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           +R+AF + +     VA   +LLIDD+YTTGAT + AA  LKKAGA  V  LT 
Sbjct: 136 LRDAFALSERWKP-VAN--VLLIDDIYTTGATVEQAAKILKKAGAQNVYFLTI 185


>gi|16802265|ref|NP_463750.1| hypothetical protein lmo0219 [Listeria monocytogenes EGD-e]
 gi|47097258|ref|ZP_00234818.1| conserved hypothetical protein/hypoxanthine
           phosphoribosyltransferase, fusion [Listeria
           monocytogenes str. 1/2a F6854]
 gi|224500330|ref|ZP_03668679.1| hypothetical protein LmonF1_11939 [Listeria monocytogenes Finland
           1988]
 gi|224503461|ref|ZP_03671768.1| hypothetical protein LmonFR_13287 [Listeria monocytogenes FSL
           R2-561]
 gi|254900996|ref|ZP_05260920.1| hypothetical protein LmonJ_14318 [Listeria monocytogenes J0161]
 gi|254913936|ref|ZP_05263948.1| tilS/hprT [Listeria monocytogenes J2818]
 gi|254938274|ref|ZP_05269971.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes F6900]
 gi|284803042|ref|YP_003414907.1| hypothetical protein LM5578_2799 [Listeria monocytogenes 08-5578]
 gi|284996183|ref|YP_003417951.1| hypothetical protein LM5923_2748 [Listeria monocytogenes 08-5923]
 gi|61216688|sp|Q8YAC7|TILS_LISMO RecName: Full=Bifunctional protein tilS/hprT; Includes: RecName:
           Full=tRNA(Ile)-lysidine synthase; AltName:
           Full=tRNA(Ile)-2-lysyl-cytidine synthase; AltName:
           Full=tRNA(Ile)-lysidine synthetase; Includes: RecName:
           Full=Hypoxanthine-guanine phosphoribosyltransferase;
           Short=HGPRT; Short=HGPRTase
 gi|16409584|emb|CAD00746.1| fusion protein, N-terminal part similar to B. subtilis YacA
           protein, C-terminal part similar to hypoxanthine-guanine
           phosphoribosyltransferase [Listeria monocytogenes EGD-e]
 gi|47014358|gb|EAL05331.1| conserved hypothetical protein/hypoxanthine
           phosphoribosyltransferase, fusion [Listeria
           monocytogenes str. 1/2a F6854]
 gi|258610884|gb|EEW23492.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes F6900]
 gi|284058604|gb|ADB69545.1| hypothetical protein LM5578_2799 [Listeria monocytogenes 08-5578]
 gi|284061650|gb|ADB72589.1| hypothetical protein LM5923_2748 [Listeria monocytogenes 08-5923]
 gi|293591954|gb|EFG00289.1| tilS/hprT [Listeria monocytogenes J2818]
          Length = 648

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + ++  V G  +L+I+D+  +G T       +K   A +V ++T 
Sbjct: 546 GEVKIIKDLNASVEGRDVLVIEDIIDSGRTLSYLVDLIKYRKAKSVKLVTL 596


>gi|322375227|ref|ZP_08049741.1| hypoxanthine phosphoribosyltransferase [Streptococcus sp. C300]
 gi|321280727|gb|EFX57766.1| hypoxanthine phosphoribosyltransferase [Streptococcus sp. C300]
          Length = 180

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
              N+ Q V++ + G  +L ++D+  TG T K       +  A +V I T 
Sbjct: 78  GVINIKQDVTQDIKGRHVLFVEDIIDTGQTLKNLRDMFIERKAASVKIATL 128


>gi|293552844|ref|ZP_06673502.1| amidophosphoribosyltransferase [Enterococcus faecium E1039]
 gi|291602978|gb|EFF33172.1| amidophosphoribosyltransferase [Enterococcus faecium E1039]
          Length = 479

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 25/49 (51%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            V   V G K++++DD    G T++     LK+AGA  V +   S  LK
Sbjct: 343 AVRGVVEGKKVIMVDDSIVRGTTSRRIVHLLKEAGAKEVHVRIASPPLK 391


>gi|291513696|emb|CBK62906.1| ribose-phosphate pyrophosphokinase [Alistipes shahii WAL 8301]
          Length = 313

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 14/46 (30%), Positives = 19/46 (41%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
             V G  +L++DD+  T  T   AA  L   GA +V        L 
Sbjct: 208 GDVEGRNVLIVDDMIDTAGTICMAADMLMSRGAKSVRAAITHPVLS 253


>gi|284989490|ref|YP_003408044.1| ribose-phosphate pyrophosphokinase [Geodermatophilus obscurus DSM
           43160]
 gi|284062735|gb|ADB73673.1| ribose-phosphate pyrophosphokinase [Geodermatophilus obscurus DSM
           43160]
          Length = 326

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 22/52 (42%)

Query: 7   VPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           V   V   V G   +L+DD+  TG T   AA  L  AGA  V +      L 
Sbjct: 213 VANRVVGEVEGRVCILVDDMIDTGGTIVKAAETLFDAGAADVIVCATHGVLS 264


>gi|283783578|ref|YP_003374332.1| hypoxanthine phosphoribosyltransferase [Gardnerella vaginalis
           409-05]
 gi|283441740|gb|ADB14206.1| hypoxanthine phosphoribosyltransferase [Gardnerella vaginalis
           409-05]
          Length = 186

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               V + +S  V G  +L+++D+  +G T       LK  GA +V +   
Sbjct: 84  GQITVREDLSTDVRGRDVLIVEDIVDSGRTLAWLVDELKGRGAASVKVFAL 134


>gi|261333063|emb|CBH16058.1| phosphoribosylpyrophosphate synthetase, putative [Trypanosoma
           brucei gambiense DAL972]
          Length = 377

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 21/49 (42%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +   V G   +++DD+  T  T   AA  LK+ GA  V        L D
Sbjct: 229 LVGEVKGCTCIIVDDMIDTAGTLCKAAEVLKEYGAKEVHAWATHGILTD 277


>gi|50842015|ref|YP_055242.1| ribose-phosphate pyrophosphokinase [Propionibacterium acnes
           KPA171202]
 gi|282853605|ref|ZP_06262942.1| ribose-phosphate diphosphokinase [Propionibacterium acnes J139]
 gi|289424324|ref|ZP_06426107.1| ribose-phosphate diphosphokinase [Propionibacterium acnes SK187]
 gi|289428399|ref|ZP_06430085.1| ribose-phosphate diphosphokinase [Propionibacterium acnes J165]
 gi|295130097|ref|YP_003580760.1| Ribose-phosphate pyrophosphokinase [Propionibacterium acnes SK137]
 gi|50839617|gb|AAT82284.1| ribose-phosphate pyrophosphokinase [Propionibacterium acnes
           KPA171202]
 gi|282583058|gb|EFB88438.1| ribose-phosphate diphosphokinase [Propionibacterium acnes J139]
 gi|289155021|gb|EFD03703.1| ribose-phosphate diphosphokinase [Propionibacterium acnes SK187]
 gi|289158371|gb|EFD06588.1| ribose-phosphate diphosphokinase [Propionibacterium acnes J165]
 gi|291375542|gb|ADD99396.1| Ribose-phosphate pyrophosphokinase [Propionibacterium acnes SK137]
 gi|332674938|gb|AEE71754.1| ribose-phosphate pyrophosphokinase [Propionibacterium acnes 266]
          Length = 322

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 23/52 (44%)

Query: 8   PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
              V   V G   LL+DD+  T  T   AA+ALKK GA  V        L D
Sbjct: 213 THEVVGEVEGKTCLLVDDMVDTAGTMCQAALALKKHGAKRVIAAATHPILSD 264


>gi|116629229|ref|YP_814401.1| hypoxanthine-guanine phosphoribosyltransferase [Lactobacillus
           gasseri ATCC 33323]
 gi|282850984|ref|ZP_06260358.1| hypoxanthine phosphoribosyltransferase [Lactobacillus gasseri
           224-1]
 gi|311110995|ref|ZP_07712392.1| hypoxanthine phosphoribosyltransferase [Lactobacillus gasseri
           MV-22]
 gi|116094811|gb|ABJ59963.1| hypoxanthine phosphoribosyltransferase [Lactobacillus gasseri ATCC
           33323]
 gi|282557936|gb|EFB63524.1| hypoxanthine phosphoribosyltransferase [Lactobacillus gasseri
           224-1]
 gi|311066149|gb|EFQ46489.1| hypoxanthine phosphoribosyltransferase [Lactobacillus gasseri
           MV-22]
          Length = 189

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 20/51 (39%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               +   V   V    +LL++D+  TG T K     L K GA +V     
Sbjct: 83  GKVRLDIDVQADVKDRDVLLVEDIVDTGHTLKFMKDLLNKRGAKSVKCCAL 133


>gi|26247530|ref|NP_753570.1| ribose-phosphate pyrophosphokinase [Escherichia coli CFT073]
 gi|91210428|ref|YP_540414.1| ribose-phosphate pyrophosphokinase [Escherichia coli UTI89]
 gi|117623425|ref|YP_852338.1| ribose-phosphate pyrophosphokinase [Escherichia coli APEC O1]
 gi|170680628|ref|YP_001743987.1| ribose-phosphate pyrophosphokinase [Escherichia coli SMS-3-5]
 gi|195939094|ref|ZP_03084476.1| ribose-phosphate pyrophosphokinase [Escherichia coli O157:H7 str.
           EC4024]
 gi|237705169|ref|ZP_04535650.1| ribose-phosphate pyrophosphokinase [Escherichia sp. 3_2_53FAA]
 gi|253773794|ref|YP_003036625.1| ribose-phosphate pyrophosphokinase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|256018543|ref|ZP_05432408.1| ribose-phosphate pyrophosphokinase [Shigella sp. D9]
 gi|256023116|ref|ZP_05436981.1| ribose-phosphate pyrophosphokinase [Escherichia sp. 4_1_40B]
 gi|261224939|ref|ZP_05939220.1| ribose-phosphate pyrophosphokinase [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261257204|ref|ZP_05949737.1| ribose-phosphate pyrophosphokinase [Escherichia coli O157:H7 str.
           FRIK966]
 gi|297517602|ref|ZP_06935988.1| ribose-phosphate pyrophosphokinase [Escherichia coli OP50]
 gi|306813895|ref|ZP_07448068.1| ribose-phosphate pyrophosphokinase [Escherichia coli NC101]
 gi|307137821|ref|ZP_07497177.1| ribose-phosphate pyrophosphokinase [Escherichia coli H736]
 gi|307310038|ref|ZP_07589688.1| ribose-phosphate pyrophosphokinase [Escherichia coli W]
 gi|331641736|ref|ZP_08342871.1| ribose-phosphate pyrophosphokinase (RPPK)
           (Phosphoribosylpyrophosphate synthetase) (P-Rib-PP
           synthetase) (PRPP synthetase) [Escherichia coli H736]
 gi|331646525|ref|ZP_08347628.1| ribose-phosphate pyrophosphokinase (RPPK)
           (Phosphoribosylpyrophosphate synthetase) (P-Rib-PP
           synthetase) (PRPP synthetase) [Escherichia coli M605]
 gi|331652245|ref|ZP_08353264.1| ribose-phosphate pyrophosphokinase (RPPK)
           (Phosphoribosylpyrophosphate synthetase) (P-Rib-PP
           synthetase) (PRPP synthetase) [Escherichia coli M718]
 gi|331657258|ref|ZP_08358220.1| ribose-phosphate pyrophosphokinase (RPPK)
           (Phosphoribosylpyrophosphate synthetase) (P-Rib-PP
           synthetase) (PRPP synthetase) [Escherichia coli TA206]
 gi|331662610|ref|ZP_08363533.1| ribose-phosphate pyrophosphokinase (RPPK)
           (Phosphoribosylpyrophosphate synthetase) (P-Rib-PP
           synthetase) (PRPP synthetase) [Escherichia coli TA143]
 gi|331676987|ref|ZP_08377683.1| ribose-phosphate pyrophosphokinase (RPPK)
           (Phosphoribosylpyrophosphate synthetase) (P-Rib-PP
           synthetase) (PRPP synthetase) [Escherichia coli H591]
 gi|331682696|ref|ZP_08383315.1| ribose-phosphate pyrophosphokinase (RPPK)
           (Phosphoribosylpyrophosphate synthetase) (P-Rib-PP
           synthetase) (PRPP synthetase) [Escherichia coli H299]
 gi|332279603|ref|ZP_08392016.1| ribose-phosphate pyrophosphokinase [Shigella sp. D9]
 gi|26107931|gb|AAN80130.1|AE016759_404 Ribose-phosphate pyrophosphokinase [Escherichia coli CFT073]
 gi|91072002|gb|ABE06883.1| ribose-phosphate pyrophosphokinase [Escherichia coli UTI89]
 gi|115512549|gb|ABJ00624.1| phosphoribosylpyrophosphate synthase [Escherichia coli APEC O1]
 gi|170518346|gb|ACB16524.1| ribose-phosphate pyrophosphokinase [Escherichia coli SMS-3-5]
 gi|226899926|gb|EEH86185.1| ribose-phosphate pyrophosphokinase [Escherichia sp. 3_2_53FAA]
 gi|253324838|gb|ACT29440.1| ribose-phosphate pyrophosphokinase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|260449658|gb|ACX40080.1| ribose-phosphate pyrophosphokinase [Escherichia coli DH1]
 gi|305852532|gb|EFM52980.1| ribose-phosphate pyrophosphokinase [Escherichia coli NC101]
 gi|306909756|gb|EFN40250.1| ribose-phosphate pyrophosphokinase [Escherichia coli W]
 gi|307627270|gb|ADN71574.1| ribose-phosphate pyrophosphokinase [Escherichia coli UM146]
 gi|312945837|gb|ADR26664.1| ribose-phosphate pyrophosphokinase [Escherichia coli O83:H1 str.
           NRG 857C]
 gi|315060458|gb|ADT74785.1| phosphoribosylpyrophosphate synthase [Escherichia coli W]
 gi|315135843|dbj|BAJ43002.1| ribose-phosphate pyrophosphokinase [Escherichia coli DH1]
 gi|320195783|gb|EFW70408.1| Ribose-phosphate pyrophosphokinase [Escherichia coli WV_060327]
 gi|320637359|gb|EFX07166.1| ribose-phosphate pyrophosphokinase [Escherichia coli O157:H7 str.
           G5101]
 gi|320643221|gb|EFX12422.1| ribose-phosphate pyrophosphokinase [Escherichia coli O157:H- str.
           493-89]
 gi|320648158|gb|EFX16834.1| ribose-phosphate pyrophosphokinase [Escherichia coli O157:H- str. H
           2687]
 gi|320653992|gb|EFX22066.1| ribose-phosphate pyrophosphokinase [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320659471|gb|EFX27040.1| ribose-phosphate pyrophosphokinase [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320664608|gb|EFX31759.1| ribose-phosphate pyrophosphokinase [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323953938|gb|EGB49737.1| ribose-phosphate diphosphokinase [Escherichia coli H263]
 gi|323964705|gb|EGB60176.1| ribose-phosphate diphosphokinase [Escherichia coli M863]
 gi|331038534|gb|EGI10754.1| ribose-phosphate pyrophosphokinase (RPPK)
           (Phosphoribosylpyrophosphate synthetase) (P-Rib-PP
           synthetase) (PRPP synthetase) [Escherichia coli H736]
 gi|331045277|gb|EGI17404.1| ribose-phosphate pyrophosphokinase (RPPK)
           (Phosphoribosylpyrophosphate synthetase) (P-Rib-PP
           synthetase) (PRPP synthetase) [Escherichia coli M605]
 gi|331050523|gb|EGI22581.1| ribose-phosphate pyrophosphokinase (RPPK)
           (Phosphoribosylpyrophosphate synthetase) (P-Rib-PP
           synthetase) (PRPP synthetase) [Escherichia coli M718]
 gi|331055506|gb|EGI27515.1| ribose-phosphate pyrophosphokinase (RPPK)
           (Phosphoribosylpyrophosphate synthetase) (P-Rib-PP
           synthetase) (PRPP synthetase) [Escherichia coli TA206]
 gi|331061032|gb|EGI32996.1| ribose-phosphate pyrophosphokinase (RPPK)
           (Phosphoribosylpyrophosphate synthetase) (P-Rib-PP
           synthetase) (PRPP synthetase) [Escherichia coli TA143]
 gi|331075676|gb|EGI46974.1| ribose-phosphate pyrophosphokinase (RPPK)
           (Phosphoribosylpyrophosphate synthetase) (P-Rib-PP
           synthetase) (PRPP synthetase) [Escherichia coli H591]
 gi|331080327|gb|EGI51506.1| ribose-phosphate pyrophosphokinase (RPPK)
           (Phosphoribosylpyrophosphate synthetase) (P-Rib-PP
           synthetase) (PRPP synthetase) [Escherichia coli H299]
 gi|332101955|gb|EGJ05301.1| ribose-phosphate pyrophosphokinase [Shigella sp. D9]
          Length = 337

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 228 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 276


>gi|332519192|ref|ZP_08395659.1| ribose-phosphate pyrophosphokinase [Lacinutrix algicola 5H-3-7-4]
 gi|332045040|gb|EGI81233.1| ribose-phosphate pyrophosphokinase [Lacinutrix algicola 5H-3-7-4]
          Length = 313

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 13/49 (26%), Positives = 22/49 (44%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            +   V G  ++L+DD+  T  T   AA  + + GA +V  +     L 
Sbjct: 207 ELIGDVTGKNVVLVDDMVDTAGTLTKAADLMMERGAKSVRAICTHPILS 255


>gi|253579910|ref|ZP_04857178.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251848909|gb|EES76871.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 234

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 28/54 (51%), Gaps = 4/54 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           +  AF V       V G  IL+IDDVYTTG+T    A  LK+ GA  V  LT  
Sbjct: 181 LEKAFCVT----GDVRGKNILVIDDVYTTGSTIDAMAGCLKRKGAGNVYFLTVC 230


>gi|213965067|ref|ZP_03393265.1| hypoxanthine phosphoribosyltransferase [Corynebacterium amycolatum
           SK46]
 gi|213952181|gb|EEB63565.1| hypoxanthine phosphoribosyltransferase [Corynebacterium amycolatum
           SK46]
          Length = 194

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 7/53 (13%), Positives = 24/53 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + + + + G  +++++D+  +G T       L+     ++ ++T  R
Sbjct: 92  GVVRILKDLDRDIEGRDVVIVEDIIDSGLTLSWLMKNLRNRNPRSLEVITLLR 144


>gi|283779422|ref|YP_003370177.1| hypoxanthine phosphoribosyltransferase [Pirellula staleyi DSM 6068]
 gi|283437875|gb|ADB16317.1| hypoxanthine phosphoribosyltransferase [Pirellula staleyi DSM 6068]
          Length = 175

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 13/54 (24%), Positives = 23/54 (42%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           R    +   +   +AG  +LLIDD++ TG T       L + G  ++      +
Sbjct: 69  RGKLRINSEMMPDIAGRDVLLIDDIFDTGHTLFEVIGMLDEFGPKSIRSAVLLK 122


>gi|269965877|ref|ZP_06179970.1| ComF-related protein [Vibrio alginolyticus 40B]
 gi|269829430|gb|EEZ83671.1| ComF-related protein [Vibrio alginolyticus 40B]
          Length = 241

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 13/56 (23%), Positives = 26/56 (46%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF + +          + ++DDV TTG+T +     L + G  ++ I    R+
Sbjct: 184 LKGAFILNKRPHSS----HVAIVDDVVTTGSTVRQLCHLLLEVGVESIDIYCICRT 235


>gi|261207675|ref|ZP_05922360.1| amidophosphoribosyl transferase [Enterococcus faecium TC 6]
 gi|289565793|ref|ZP_06446236.1| amidophosphoribosyltransferase [Enterococcus faecium D344SRF]
 gi|294615898|ref|ZP_06695740.1| amidophosphoribosyltransferase [Enterococcus faecium E1636]
 gi|294620310|ref|ZP_06699627.1| amidophosphoribosyltransferase [Enterococcus faecium E1679]
 gi|260078058|gb|EEW65764.1| amidophosphoribosyl transferase [Enterococcus faecium TC 6]
 gi|289162431|gb|EFD10288.1| amidophosphoribosyltransferase [Enterococcus faecium D344SRF]
 gi|291591284|gb|EFF22951.1| amidophosphoribosyltransferase [Enterococcus faecium E1636]
 gi|291593451|gb|EFF25008.1| amidophosphoribosyltransferase [Enterococcus faecium E1679]
          Length = 479

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 25/49 (51%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            V   V G K++++DD    G T++     LK+AGA  V +   S  LK
Sbjct: 343 AVRGVVEGKKVIMVDDSIVRGTTSRRIVHLLKEAGAKEVHVRIASPPLK 391


>gi|255994736|ref|ZP_05427871.1| putative competence protein F [Eubacterium saphenum ATCC 49989]
 gi|255993449|gb|EEU03538.1| putative competence protein F [Eubacterium saphenum ATCC 49989]
          Length = 254

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 23/54 (42%), Positives = 31/54 (57%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           ++    + +  +  V G  +LLIDDVYTTGATA   A  LK AGA+ V    F+
Sbjct: 198 IKGQILLSETKAHLVRGKTVLLIDDVYTTGATADECAKVLKSAGAIKVCFAGFA 251


>gi|290894273|ref|ZP_06557240.1| hypoxanthine phosphoribosyltransferase [Listeria monocytogenes FSL
           J2-071]
 gi|290556157|gb|EFD89704.1| hypoxanthine phosphoribosyltransferase [Listeria monocytogenes FSL
           J2-071]
          Length = 648

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + ++  V G  +L+I+D+  +G T       +K   A +V ++T 
Sbjct: 546 GEVKIIKDLNASVEGRDVLVIEDIIDSGRTLSYLVDLIKYRKAKSVKLVTL 596


>gi|254228560|ref|ZP_04921985.1| hypothetical protein VEx25_0092 [Vibrio sp. Ex25]
 gi|151938942|gb|EDN57775.1| hypothetical protein VEx25_0092 [Vibrio sp. Ex25]
          Length = 241

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 13/56 (23%), Positives = 26/56 (46%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF + +          + ++DDV TTG+T +     L + G  ++ I    R+
Sbjct: 184 LKGAFILNKRPHSS----HVAIVDDVVTTGSTVRQLCHLLLEVGVESIDIYCICRT 235


>gi|315127046|ref|YP_004069049.1| ribose-phosphate pyrophosphokinase [Pseudoalteromonas sp. SM9913]
 gi|315015560|gb|ADT68898.1| ribose-phosphate pyrophosphokinase [Pseudoalteromonas sp. SM9913]
          Length = 315

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +++DD+  TG T   AA ALK+ GA  V        L 
Sbjct: 206 HIIGDVEGRDCIIVDDMIDTGGTLCKAAEALKEHGAKRVFAYATHPILS 254


>gi|227529545|ref|ZP_03959594.1| competence protein FC [Lactobacillus vaginalis ATCC 49540]
 gi|227350630|gb|EEJ40921.1| competence protein FC [Lactobacillus vaginalis ATCC 49540]
          Length = 225

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 25/46 (54%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               ++ G K+LL+DD+YTTG T   AA    + G   V  L+ +R
Sbjct: 180 DKDINLRGRKVLLVDDIYTTGRTLYHAAELCYQNGCKRVQSLSLAR 225


>gi|289433574|ref|YP_003463446.1| hypothetical protein lse_0205 [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289169818|emb|CBH26356.1| conserved hypothetical protein [Listeria seeligeri serovar 1/2b
           str. SLCC3954]
          Length = 648

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + ++  V G  +L+I+D+  +G T       +K   A +V ++T 
Sbjct: 546 GEVKIIKDLNASVEGRDVLVIEDIIDSGRTLSYLVDLIKYRKAKSVKLVTL 596


>gi|314929239|gb|EFS93070.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL044PA1]
 gi|314972368|gb|EFT16465.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL037PA3]
          Length = 310

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 23/52 (44%)

Query: 8   PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
              V   V G   LL+DD+  T  T   AA+ALKK GA  V        L D
Sbjct: 201 THEVVGEVEGKTCLLVDDMVDTAGTMCQAALALKKHGAKRVIAAATHPILSD 252


>gi|229819484|ref|YP_002881010.1| ribose-phosphate pyrophosphokinase [Beutenbergia cavernae DSM
           12333]
 gi|229565397|gb|ACQ79248.1| ribose-phosphate pyrophosphokinase [Beutenbergia cavernae DSM
           12333]
          Length = 326

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 22/54 (40%)

Query: 6   NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            V   V   V G   +L+DD+  TG T   A   L   GA +V +      L D
Sbjct: 212 AVANRVVGEVEGRDCVLVDDLIDTGGTIAEAVRVLLHQGANSVIVAATHGVLSD 265


>gi|260905553|ref|ZP_05913875.1| hypoxanthine phosphoribosyltransferase [Brevibacterium linens BL2]
          Length = 183

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 12/53 (22%), Positives = 24/53 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + +   ++   +L+++D+  +G T       L+  GA TV I T  R
Sbjct: 82  GVVRILKDLDTDLSDRHVLIVEDIIDSGLTLSWLVQNLRSRGAATVEICTMLR 134


>gi|150390663|ref|YP_001320712.1| hypoxanthine phosphoribosyltransferase [Alkaliphilus
           metalliredigens QYMF]
 gi|149950525|gb|ABR49053.1| hypoxanthine phosphoribosyltransferase [Alkaliphilus
           metalliredigens QYMF]
          Length = 179

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 10/51 (19%), Positives = 21/51 (41%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   +    IL+++D+  TG T K     LK     ++ + T 
Sbjct: 78  GVVRILKDLDLEIEDKHILIVEDIVDTGLTLKYLTENLKSRNTKSIKVCTL 128


>gi|330465677|ref|YP_004403420.1| ribose-phosphate pyrophosphokinase [Verrucosispora maris AB-18-032]
 gi|328808648|gb|AEB42820.1| ribose-phosphate pyrophosphokinase [Verrucosispora maris AB-18-032]
          Length = 326

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 26/53 (49%)

Query: 7   VPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           V   V   V G   L++DD+  TG T   AA  LK++GA  V + +    L D
Sbjct: 213 VANRVVGEVEGRVCLIVDDMIDTGGTICKAADILKESGAADVIVASTHALLSD 265


>gi|304405793|ref|ZP_07387451.1| hypoxanthine phosphoribosyltransferase [Paenibacillus
           curdlanolyticus YK9]
 gi|304345036|gb|EFM10872.1| hypoxanthine phosphoribosyltransferase [Paenibacillus
           curdlanolyticus YK9]
          Length = 179

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 10/51 (19%), Positives = 26/51 (50%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V G ++L+++D+  +G T       L++  A +V+++T 
Sbjct: 77  GVVKIIKDLDVTVEGREVLIVEDIIDSGLTLSYLIDVLERRNAKSVTVVTL 127


>gi|182420069|ref|ZP_02951303.1| ribose-phosphate pyrophosphokinase [Clostridium butyricum 5521]
 gi|237669523|ref|ZP_04529503.1| ribose-Phosphate pyrophosphokinase [Clostridium butyricum E4 str.
           BoNT E BL5262]
 gi|182376106|gb|EDT73693.1| ribose-phosphate pyrophosphokinase [Clostridium butyricum 5521]
 gi|237654967|gb|EEP52527.1| ribose-Phosphate pyrophosphokinase [Clostridium butyricum E4 str.
           BoNT E BL5262]
          Length = 321

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 20/46 (43%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
             V G + +LIDD+  T  T   AA ALK  GA  V        L 
Sbjct: 214 GDVEGKRCILIDDMIDTAGTITNAANALKDLGAKNVYACCTHGVLS 259


>gi|224085253|ref|XP_002307524.1| predicted protein [Populus trichocarpa]
 gi|118484836|gb|ABK94285.1| unknown [Populus trichocarpa]
 gi|222856973|gb|EEE94520.1| predicted protein [Populus trichocarpa]
          Length = 187

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
            A  +   +   V    ++L++D+  TG T  C    L+  GA  VS+ TF
Sbjct: 81  GAPRISLDLKLDVKEKHVILVEDIVDTGNTLSCLIKHLESKGASAVSVCTF 131


>gi|254832460|ref|ZP_05237115.1| hypothetical protein Lmon1_13981 [Listeria monocytogenes 10403S]
          Length = 648

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + ++  V G  +L+I+D+  +G T       +K   A +V ++T 
Sbjct: 546 GEVKIIKDLNASVEGRDVLVIEDIIDSGRTLSYLVDLIKYRKAKSVKLVTL 596


>gi|254829310|ref|ZP_05233997.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes FSL N3-165]
 gi|258601723|gb|EEW15048.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes FSL N3-165]
          Length = 648

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + ++  V G  +L+I+D+  +G T       +K   A +V ++T 
Sbjct: 546 GEVKIIKDLNASVEGRDVLVIEDIIDSGRTLSYLVDLIKYRKAKSVKLVTL 596


>gi|116669779|ref|YP_830712.1| ribose-phosphate pyrophosphokinase [Arthrobacter sp. FB24]
 gi|116609888|gb|ABK02612.1| ribose-phosphate pyrophosphokinase [Arthrobacter sp. FB24]
          Length = 326

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 23/54 (42%)

Query: 6   NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            V + V   + G   +LIDD+  TG T   A   LK AGA  V I        D
Sbjct: 212 AVSKTVVGQIEGRTCVLIDDMIDTGGTISGAVQVLKNAGAKDVIIAATHAVFSD 265


>gi|113461139|ref|YP_719207.1| ribose-phosphate pyrophosphokinase [Haemophilus somnus 129PT]
 gi|170717723|ref|YP_001784794.1| ribose-phosphate pyrophosphokinase [Haemophilus somnus 2336]
 gi|112823182|gb|ABI25271.1| ribose-phosphate pyrophosphokinase [Haemophilus somnus 129PT]
 gi|168825852|gb|ACA31223.1| ribose-phosphate pyrophosphokinase [Haemophilus somnus 2336]
          Length = 315

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 207 HIIGDVAGRDCILVDDMIDTGGTLCKAAEALKERGAKRVFAYATHAVFS 255


>gi|290890866|ref|ZP_06553932.1| hypothetical protein AWRIB429_1322 [Oenococcus oeni AWRIB429]
 gi|290479517|gb|EFD88175.1| hypothetical protein AWRIB429_1322 [Oenococcus oeni AWRIB429]
          Length = 138

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 18/43 (41%), Positives = 25/43 (58%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
             +    +LL+DDVYTTG T    A  L +AGA  V+ +T +R
Sbjct: 96  SSIENKSVLLLDDVYTTGTTLHQTAAVLYEAGAKKVNSITLAR 138


>gi|330502028|ref|YP_004378897.1| ribose-phosphate pyrophosphokinase [Pseudomonas mendocina NK-01]
 gi|328916314|gb|AEB57145.1| ribose-phosphate pyrophosphokinase [Pseudomonas mendocina NK-01]
          Length = 273

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 22/49 (44%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +L+DD+  T  T   AA ALK+ GA  V        L 
Sbjct: 165 HIIGDVEGRTCILVDDMVDTAGTLCHAAKALKERGAAKVYAYCTHPVLS 213


>gi|307204518|gb|EFN83198.1| Amidophosphoribosyltransferase [Harpegnathos saltator]
          Length = 545

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 25/49 (51%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            +S++V G +I+L+DD    G T       L+ AGA  V +   S  LK
Sbjct: 418 ALSENVKGKRIILVDDSIVRGNTIGPIIKLLRDAGAKEVHVRIASPPLK 466


>gi|257884786|ref|ZP_05664439.1| amidophosphoribosyl transferase [Enterococcus faecium 1,231,501]
 gi|257820624|gb|EEV47772.1| amidophosphoribosyl transferase [Enterococcus faecium 1,231,501]
          Length = 479

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 25/49 (51%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            V   V G K++++DD    G T++     LK+AGA  V +   S  LK
Sbjct: 343 AVRGVVEGKKVIMVDDSIVRGTTSRRIVHLLKEAGAKEVHVRIASPPLK 391


>gi|325479527|gb|EGC82623.1| hypoxanthine phosphoribosyltransferase [Anaerococcus prevotii
           ACS-065-V-Col13]
          Length = 189

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V G ++L+++D+  TG T +     L    A  V I+T 
Sbjct: 82  GNVKILKDLDIDVKGKEVLIVEDIIDTGYTLRKTKENLINREAKDVKIVTL 132


>gi|282899726|ref|ZP_06307689.1| conserved hypothetical protein [Cylindrospermopsis raciborskii
           CS-505]
 gi|281195341|gb|EFA70275.1| conserved hypothetical protein [Cylindrospermopsis raciborskii
           CS-505]
          Length = 225

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 33/59 (55%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +  AF++ +          ILLIDD+YTTGATA  A  +L   G   + + T ++++KD
Sbjct: 162 LMGAFDLGKDFFNRYPNKPILLIDDIYTTGATANSAIHSLDAYGINVIGLATVAKAIKD 220


>gi|257887622|ref|ZP_05667275.1| amidophosphoribosyl transferase [Enterococcus faecium 1,141,733]
 gi|257898752|ref|ZP_05678405.1| amidophosphoribosyl transferase [Enterococcus faecium Com15]
 gi|257823676|gb|EEV50608.1| amidophosphoribosyl transferase [Enterococcus faecium 1,141,733]
 gi|257836664|gb|EEV61738.1| amidophosphoribosyl transferase [Enterococcus faecium Com15]
          Length = 479

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 25/49 (51%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            V   V G K++++DD    G T++     LK+AGA  V +   S  LK
Sbjct: 343 AVRGVVEGKKVIMVDDSIVRGTTSRRIVHLLKEAGAKEVHVRIASPPLK 391


>gi|153939245|ref|YP_001392159.1| amidophosphoribosyltransferase [Clostridium botulinum F str.
           Langeland]
 gi|152935141|gb|ABS40639.1| amidophosphoribosyltransferase [Clostridium botulinum F str.
           Langeland]
 gi|295320164|gb|ADG00542.1| amidophosphoribosyltransferase [Clostridium botulinum F str.
           230613]
          Length = 482

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 1/56 (1%)

Query: 4   AFNVP-QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           A +V    +  +V G ++++IDD    G T+K     L+KAGA  V     S  +K
Sbjct: 352 AVSVKLNPLKINVEGKRVVIIDDSIVRGTTSKRLVQILRKAGAKEVHFRVSSPVVK 407


>gi|147669861|ref|YP_001214679.1| amidophosphoribosyltransferase [Dehalococcoides sp. BAV1]
 gi|146270809|gb|ABQ17801.1| amidophosphoribosyltransferase [Dehalococcoides sp. BAV1]
          Length = 472

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 12/50 (24%), Positives = 23/50 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            +   + G +++L+DD    G T       L+KAGA  V +   +  + +
Sbjct: 334 PLKSVLEGKRVVLVDDSIVRGTTTPQVIRLLRKAGAKEVHMRVCAPPITN 383


>gi|110635335|ref|YP_675543.1| phosphoribosyltransferase [Mesorhizobium sp. BNC1]
 gi|110286319|gb|ABG64378.1| phosphoribosyltransferase [Chelativorans sp. BNC1]
          Length = 270

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 41/59 (69%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +R AF VP    + + G +++LIDDV+TTGAT   A  ALK+ GA  V +LTF+R+LK+
Sbjct: 202 VRGAFVVPPAAERILTGKRVILIDDVFTTGATVAAATRALKRGGAGEVDVLTFARALKE 260


>gi|117924701|ref|YP_865318.1| phosphoribosyltransferase [Magnetococcus sp. MC-1]
 gi|117608457|gb|ABK43912.1| phosphoribosyltransferase [Magnetococcus sp. MC-1]
          Length = 242

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           MR  F              +LL+DD  TTGAT + AA ALKK+G   V+++  +++++D
Sbjct: 180 MRGVFRAQWGERAVAE--HLLLVDDTMTTGATVREAAAALKKSGVGQVTVMVLAKAMRD 236


>gi|323492381|ref|ZP_08097534.1| ribose-phosphate pyrophosphokinase [Vibrio brasiliensis LMG 20546]
 gi|323313428|gb|EGA66539.1| ribose-phosphate pyrophosphokinase [Vibrio brasiliensis LMG 20546]
          Length = 314

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 21/48 (43%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +   V G   +++DD+  TG T   AA ALK+ GA  V          
Sbjct: 207 LIGDVEGRDCVIVDDMIDTGGTLCKAAEALKERGAKRVFAYATHAVFS 254


>gi|257064230|ref|YP_003143902.1| predicted amidophosphoribosyltransferase [Slackia
           heliotrinireducens DSM 20476]
 gi|256791883|gb|ACV22553.1| predicted amidophosphoribosyltransferase [Slackia
           heliotrinireducens DSM 20476]
          Length = 230

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           MR+   V            +LLIDDV TTGAT + A  ALK AGA TV  LT +R+
Sbjct: 178 MRHVLKVLPDTKPP---QNVLLIDDVMTTGATLEAATTALKDAGAQTVRCLTLARA 230


>gi|227551261|ref|ZP_03981310.1| amidophosphoribosyltransferase [Enterococcus faecium TX1330]
 gi|257896117|ref|ZP_05675770.1| amidophosphoribosyl transferase [Enterococcus faecium Com12]
 gi|227179601|gb|EEI60573.1| amidophosphoribosyltransferase [Enterococcus faecium TX1330]
 gi|257832682|gb|EEV59103.1| amidophosphoribosyl transferase [Enterococcus faecium Com12]
          Length = 479

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 25/49 (51%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            V   V G K++++DD    G T++     LK+AGA  V +   S  LK
Sbjct: 343 AVRGVVEGKKVIMVDDSIVRGTTSRRIVHLLKEAGAKEVHVRIASPPLK 391


>gi|220912059|ref|YP_002487368.1| ribose-phosphate pyrophosphokinase [Arthrobacter chlorophenolicus
           A6]
 gi|219858937|gb|ACL39279.1| ribose-phosphate pyrophosphokinase [Arthrobacter chlorophenolicus
           A6]
          Length = 326

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 23/54 (42%)

Query: 6   NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            V + V   + G   +LIDD+  TG T   A   LK AGA  V I        +
Sbjct: 212 AVSKTVVGQIEGRTCVLIDDMIDTGGTISGAVQVLKNAGAKDVIIAATHAVFSE 265


>gi|69246319|ref|ZP_00603892.1| Amidophosphoribosyl transferase [Enterococcus faecium DO]
 gi|257878091|ref|ZP_05657744.1| amidophosphoribosyl transferase [Enterococcus faecium 1,230,933]
 gi|257881123|ref|ZP_05660776.1| amidophosphoribosyl transferase [Enterococcus faecium 1,231,502]
 gi|257889710|ref|ZP_05669363.1| amidophosphoribosyl transferase [Enterococcus faecium 1,231,410]
 gi|257892351|ref|ZP_05672004.1| amidophosphoribosyl transferase [Enterococcus faecium 1,231,408]
 gi|260559141|ref|ZP_05831327.1| amidophosphoribosyl transferase [Enterococcus faecium C68]
 gi|293563729|ref|ZP_06678169.1| amidophosphoribosyltransferase [Enterococcus faecium E1162]
 gi|293569372|ref|ZP_06680669.1| amidophosphoribosyltransferase [Enterococcus faecium E1071]
 gi|294621307|ref|ZP_06700488.1| amidophosphoribosyltransferase [Enterococcus faecium U0317]
 gi|314938743|ref|ZP_07846018.1| amidophosphoribosyltransferase [Enterococcus faecium TX0133a04]
 gi|314941155|ref|ZP_07848052.1| amidophosphoribosyltransferase [Enterococcus faecium TX0133C]
 gi|314947894|ref|ZP_07851299.1| amidophosphoribosyltransferase [Enterococcus faecium TX0082]
 gi|314953053|ref|ZP_07856012.1| amidophosphoribosyltransferase [Enterococcus faecium TX0133A]
 gi|314993318|ref|ZP_07858689.1| amidophosphoribosyltransferase [Enterococcus faecium TX0133B]
 gi|314997619|ref|ZP_07862550.1| amidophosphoribosyltransferase [Enterococcus faecium TX0133a01]
 gi|68195333|gb|EAN09783.1| Amidophosphoribosyl transferase [Enterococcus faecium DO]
 gi|257812319|gb|EEV41077.1| amidophosphoribosyl transferase [Enterococcus faecium 1,230,933]
 gi|257816781|gb|EEV44109.1| amidophosphoribosyl transferase [Enterococcus faecium 1,231,502]
 gi|257826070|gb|EEV52696.1| amidophosphoribosyl transferase [Enterococcus faecium 1,231,410]
 gi|257828730|gb|EEV55337.1| amidophosphoribosyl transferase [Enterococcus faecium 1,231,408]
 gi|260074898|gb|EEW63214.1| amidophosphoribosyl transferase [Enterococcus faecium C68]
 gi|291587898|gb|EFF19749.1| amidophosphoribosyltransferase [Enterococcus faecium E1071]
 gi|291599145|gb|EFF30181.1| amidophosphoribosyltransferase [Enterococcus faecium U0317]
 gi|291604307|gb|EFF33801.1| amidophosphoribosyltransferase [Enterococcus faecium E1162]
 gi|313588336|gb|EFR67181.1| amidophosphoribosyltransferase [Enterococcus faecium TX0133a01]
 gi|313592220|gb|EFR71065.1| amidophosphoribosyltransferase [Enterococcus faecium TX0133B]
 gi|313594855|gb|EFR73700.1| amidophosphoribosyltransferase [Enterococcus faecium TX0133A]
 gi|313600015|gb|EFR78858.1| amidophosphoribosyltransferase [Enterococcus faecium TX0133C]
 gi|313641956|gb|EFS06536.1| amidophosphoribosyltransferase [Enterococcus faecium TX0133a04]
 gi|313645663|gb|EFS10243.1| amidophosphoribosyltransferase [Enterococcus faecium TX0082]
          Length = 479

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 25/49 (51%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            V   V G K++++DD    G T++     LK+AGA  V +   S  LK
Sbjct: 343 AVRGVVEGKKVIMVDDSIVRGTTSRRIVHLLKEAGAKEVHVRIASPPLK 391


>gi|313891668|ref|ZP_07825275.1| hypoxanthine phosphoribosyltransferase [Dialister microaerophilus
           UPII 345-E]
 gi|313119946|gb|EFR43131.1| hypoxanthine phosphoribosyltransferase [Dialister microaerophilus
           UPII 345-E]
          Length = 181

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 10/50 (20%), Positives = 21/50 (42%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
               + + +   + G  +++++D+  TG T         K GA +V I  
Sbjct: 78  GEVQIKKDIDSDIKGKHVIIVEDIIDTGITMAALKNIFCKRGAESVEIAV 127


>gi|262341259|ref|YP_003284114.1| ribose-phosphate diphosphokinase [Blattabacterium sp. (Blattella
           germanica) str. Bge]
 gi|262272596|gb|ACY40504.1| ribose-phosphate diphosphokinase [Blattabacterium sp. (Blattella
           germanica) str. Bge]
          Length = 312

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 24/48 (50%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +  +V G  I+LIDD+  T  T   AA  +KK GA +V  +     L 
Sbjct: 205 LIGNVKGKNIILIDDMVDTAGTLTEAANLIKKQGAKSVRAIATHPVLS 252


>gi|46906451|ref|YP_012840.1| hypoxanthine phosphoribosyltransferase, fusion [Listeria
           monocytogenes serotype 4b str. F2365]
 gi|61216556|sp|Q724J4|TILS_LISMF RecName: Full=Bifunctional protein tilS/hprT; Includes: RecName:
           Full=tRNA(Ile)-lysidine synthase; AltName:
           Full=tRNA(Ile)-2-lysyl-cytidine synthase; AltName:
           Full=tRNA(Ile)-lysidine synthetase; Includes: RecName:
           Full=Hypoxanthine-guanine phosphoribosyltransferase;
           Short=HGPRT; Short=HGPRTase
 gi|46879715|gb|AAT03017.1| conserved hypothetical protein/hypoxanthine
           phosphoribosyltransferase, fusion [Listeria
           monocytogenes serotype 4b str. F2365]
          Length = 648

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + ++  V G  +L+I+D+  +G T       +K   A +V ++T 
Sbjct: 546 GEVKIIKDLNASVEGRDVLVIEDIIDSGRTLSYLVDLIKYRKAKSVKLVTL 596


>gi|319407048|emb|CBI80685.1| amidophosphoribosyltransferase [Bartonella sp. 1-1C]
          Length = 496

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 15/52 (28%), Positives = 22/52 (42%), Gaps = 3/52 (5%)

Query: 4   AFNV---PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
           AF V          + G +++LIDD    G T+      L+ AGA  V +  
Sbjct: 348 AFGVKLKHSANRSIIEGKRVILIDDSIVRGTTSVKIVRMLRNAGAKEVHMRV 399


>gi|237640661|pdb|3H83|A Chain A, 2.06 Angstrom Resolution Structure Of A Hypoxanthine-
           Guanine Phosphoribosyltransferase (Hpt-1) From Bacillus
           Anthracis Str. 'ames Ancestor'
 gi|237640662|pdb|3H83|B Chain B, 2.06 Angstrom Resolution Structure Of A Hypoxanthine-
           Guanine Phosphoribosyltransferase (Hpt-1) From Bacillus
           Anthracis Str. 'ames Ancestor'
 gi|237640663|pdb|3H83|C Chain C, 2.06 Angstrom Resolution Structure Of A Hypoxanthine-
           Guanine Phosphoribosyltransferase (Hpt-1) From Bacillus
           Anthracis Str. 'ames Ancestor'
 gi|237640664|pdb|3H83|D Chain D, 2.06 Angstrom Resolution Structure Of A Hypoxanthine-
           Guanine Phosphoribosyltransferase (Hpt-1) From Bacillus
           Anthracis Str. 'ames Ancestor'
 gi|241913542|pdb|3HVU|A Chain A, 1.95 Angstrom Crystal Structure Of Complex Of Hypoxantine-
           Guanine Phosphoribosyltransferase From Bacillus
           Anthracis With 2-(N-Morpholino)ethanesulfonic Acid (Mes)
 gi|241913543|pdb|3HVU|B Chain B, 1.95 Angstrom Crystal Structure Of Complex Of Hypoxantine-
           Guanine Phosphoribosyltransferase From Bacillus
           Anthracis With 2-(N-Morpholino)ethanesulfonic Acid (Mes)
 gi|241913544|pdb|3HVU|C Chain C, 1.95 Angstrom Crystal Structure Of Complex Of Hypoxantine-
           Guanine Phosphoribosyltransferase From Bacillus
           Anthracis With 2-(N-Morpholino)ethanesulfonic Acid (Mes)
 gi|241913545|pdb|3HVU|D Chain D, 1.95 Angstrom Crystal Structure Of Complex Of Hypoxantine-
           Guanine Phosphoribosyltransferase From Bacillus
           Anthracis With 2-(N-Morpholino)ethanesulfonic Acid (Mes)
 gi|262118824|pdb|3KB8|A Chain A, 2.09 Angstrom Resolution Structure Of A
           Hypoxanthine-Guanine Phosphoribosyltransferase (Hpt-1)
           From Bacillus Anthracis Str. 'ames Ancestor' In Complex
           With Gmp
 gi|262118825|pdb|3KB8|B Chain B, 2.09 Angstrom Resolution Structure Of A
           Hypoxanthine-Guanine Phosphoribosyltransferase (Hpt-1)
           From Bacillus Anthracis Str. 'ames Ancestor' In Complex
           With Gmp
 gi|262118826|pdb|3KB8|C Chain C, 2.09 Angstrom Resolution Structure Of A
           Hypoxanthine-Guanine Phosphoribosyltransferase (Hpt-1)
           From Bacillus Anthracis Str. 'ames Ancestor' In Complex
           With Gmp
 gi|262118827|pdb|3KB8|D Chain D, 2.09 Angstrom Resolution Structure Of A
           Hypoxanthine-Guanine Phosphoribosyltransferase (Hpt-1)
           From Bacillus Anthracis Str. 'ames Ancestor' In Complex
           With Gmp
          Length = 204

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V G  IL+++D+  +G T        K   A +V I+T 
Sbjct: 102 GEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTL 152


>gi|227903925|ref|ZP_04021730.1| hypoxanthine phosphoribosyltransferase [Lactobacillus acidophilus
           ATCC 4796]
 gi|227868316|gb|EEJ75737.1| hypoxanthine phosphoribosyltransferase [Lactobacillus acidophilus
           ATCC 4796]
          Length = 177

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + Q V   V G  ++ ++D+  TG T K  +  + K GA +V ++  
Sbjct: 76  GKVKIVQDVKSDVNGRPVIFMEDIIDTGRTLKALSEEMHKRGAKSVEVVAM 126


>gi|148380834|ref|YP_001255375.1| amidophosphoribosyltransferase [Clostridium botulinum A str. ATCC
           3502]
 gi|153934120|ref|YP_001385140.1| amidophosphoribosyltransferase [Clostridium botulinum A str. ATCC
           19397]
 gi|153935419|ref|YP_001388609.1| amidophosphoribosyltransferase [Clostridium botulinum A str. Hall]
 gi|148290318|emb|CAL84442.1| amidophosphoribosyltransferase precursor [Clostridium botulinum A
           str. ATCC 3502]
 gi|152930164|gb|ABS35664.1| amidophosphoribosyltransferase [Clostridium botulinum A str. ATCC
           19397]
 gi|152931333|gb|ABS36832.1| amidophosphoribosyltransferase [Clostridium botulinum A str. Hall]
          Length = 482

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 1/56 (1%)

Query: 4   AFNVP-QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           A +V    +  +V G ++++IDD    G T+K     L+KAGA  V     S  +K
Sbjct: 352 AVSVKLNPLKINVEGKRVVIIDDSIVRGTTSKRLVQILRKAGAKEVHFRVSSPVVK 407


>gi|293571973|ref|ZP_06682987.1| amidophosphoribosyltransferase [Enterococcus faecium E980]
 gi|291607991|gb|EFF37299.1| amidophosphoribosyltransferase [Enterococcus faecium E980]
          Length = 479

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 25/49 (51%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            V   V G K++++DD    G T++     LK+AGA  V +   S  LK
Sbjct: 343 AVRGVVEGKKVIMVDDSIVRGTTSRRIVHLLKEAGAKEVHVRIASPPLK 391


>gi|291561228|emb|CBL40027.1| hypoxanthine phosphoribosyltransferase [butyrate-producing
           bacterium SS3/4]
          Length = 175

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 8/51 (15%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + + + + G  +L+++D+  +G T       L K    ++ + T 
Sbjct: 76  GVVKIIKDLDQPLEGKNVLIVEDIIDSGRTLAYLIDILHKRNPNSIHLCTL 126


>gi|261253602|ref|ZP_05946175.1| ribose-phosphate pyrophosphokinase [Vibrio orientalis CIP 102891]
 gi|260936993|gb|EEX92982.1| ribose-phosphate pyrophosphokinase [Vibrio orientalis CIP 102891]
          Length = 314

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 21/48 (43%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +   V G   +++DD+  TG T   AA ALK+ GA  V          
Sbjct: 207 LIGDVEGRDCVIVDDMIDTGGTLCKAAEALKERGAKRVFAYATHAVFS 254


>gi|251789672|ref|YP_003004393.1| ribose-phosphate pyrophosphokinase [Dickeya zeae Ech1591]
 gi|307131082|ref|YP_003883098.1| phosphoribosylpyrophosphate synthase [Dickeya dadantii 3937]
 gi|247538293|gb|ACT06914.1| ribose-phosphate pyrophosphokinase [Dickeya zeae Ech1591]
 gi|306528611|gb|ADM98541.1| phosphoribosylpyrophosphate synthase [Dickeya dadantii 3937]
          Length = 315

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|254854449|ref|ZP_05243797.1| conserved hypothetical protein [Listeria monocytogenes FSL R2-503]
 gi|300766352|ref|ZP_07076311.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes FSL N1-017]
 gi|258607849|gb|EEW20457.1| conserved hypothetical protein [Listeria monocytogenes FSL R2-503]
 gi|300512951|gb|EFK40039.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes FSL N1-017]
          Length = 648

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + ++  V G  +L+I+D+  +G T       +K   A +V ++T 
Sbjct: 546 GEVKIIKDLNASVEGRDVLVIEDIIDSGRTLSYLVDLIKYRKAKSVKLVTL 596


>gi|146298887|ref|YP_001193478.1| ribose-phosphate pyrophosphokinase [Flavobacterium johnsoniae
           UW101]
 gi|146153305|gb|ABQ04159.1| ribose-phosphate pyrophosphokinase [Flavobacterium johnsoniae
           UW101]
          Length = 313

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 24/49 (48%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            +   V G  ++L+DD+  TG T   AA  + + GA++V  +     L 
Sbjct: 207 ELIGEVKGRNVILVDDMIDTGGTLAKAADLMIEKGALSVRAICTHAILS 255


>gi|47093161|ref|ZP_00230936.1| conserved hypothetical protein/hypoxanthine
           phosphoribosyltransferase, fusion [Listeria
           monocytogenes str. 4b H7858]
 gi|226222848|ref|YP_002756955.1| hypothetical protein Lm4b_00217 [Listeria monocytogenes Clip81459]
 gi|254933059|ref|ZP_05266418.1| conserved hypothetical protein [Listeria monocytogenes HPB2262]
 gi|21667249|gb|AAM74001.1|AF467001_2 YacA/HprT-like protein [Listeria monocytogenes]
 gi|47018468|gb|EAL09226.1| conserved hypothetical protein/hypoxanthine
           phosphoribosyltransferase, fusion [Listeria
           monocytogenes str. 4b H7858]
 gi|225875310|emb|CAS04007.1| Hypothetical protein of unknown function [Listeria monocytogenes
           serotype 4b str. CLIP 80459]
 gi|293584617|gb|EFF96649.1| conserved hypothetical protein [Listeria monocytogenes HPB2262]
 gi|332310628|gb|EGJ23723.1| Bifunctional protein tilS/hprT [Listeria monocytogenes str. Scott
           A]
          Length = 648

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + ++  V G  +L+I+D+  +G T       +K   A +V ++T 
Sbjct: 546 GEVKIIKDLNASVEGRDVLVIEDIIDSGRTLSYLVDLIKYRKAKSVKLVTL 596


>gi|326627611|gb|EGE33954.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 337

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 228 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 276


>gi|226950309|ref|YP_002805400.1| amidophosphoribosyltransferase [Clostridium botulinum A2 str.
           Kyoto]
 gi|226842409|gb|ACO85075.1| amidophosphoribosyltransferase [Clostridium botulinum A2 str.
           Kyoto]
          Length = 482

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 1/56 (1%)

Query: 4   AFNVP-QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           A +V    +  +V G ++++IDD    G T+K     L+KAGA  V     S  +K
Sbjct: 352 AVSVKLNPLKINVEGKRVVIIDDSIVRGTTSKRLVQILRKAGAKEVHFRVSSPVVK 407


>gi|163803589|ref|ZP_02197456.1| ribose-phosphate pyrophosphokinase [Vibrio sp. AND4]
 gi|159172631|gb|EDP57488.1| ribose-phosphate pyrophosphokinase [Vibrio sp. AND4]
          Length = 314

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 21/48 (43%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +   V G   +++DD+  TG T   AA ALK+ GA  V          
Sbjct: 207 LIGDVEGRDCVIVDDMIDTGGTLCKAAEALKERGAKRVFAYATHAVFS 254


>gi|312127502|ref|YP_003992376.1| amidophosphoribosyltransferase [Caldicellulosiruptor hydrothermalis
           108]
 gi|311777521|gb|ADQ07007.1| amidophosphoribosyltransferase [Caldicellulosiruptor hydrothermalis
           108]
          Length = 474

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 1/47 (2%)

Query: 4   AFNVPQY-VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVS 49
           A  +    +  +V G +++LIDD    G T++     L+ AGA  V 
Sbjct: 340 AVRIKLNVLKSNVEGKRVVLIDDSIVRGTTSRKIIKMLRDAGATEVH 386


>gi|262274712|ref|ZP_06052523.1| ribose-phosphate pyrophosphokinase [Grimontia hollisae CIP 101886]
 gi|262221275|gb|EEY72589.1| ribose-phosphate pyrophosphokinase [Grimontia hollisae CIP 101886]
          Length = 315

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 21/49 (42%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +++DD+  TG T   AA ALK  GA  V          
Sbjct: 206 HLIGDVEGRDCIIVDDMIDTGGTLCKAAEALKNRGAKRVFAYATHAVFS 254


>gi|110805212|ref|YP_688732.1| ribose-phosphate pyrophosphokinase [Shigella flexneri 5 str. 8401]
 gi|110614760|gb|ABF03427.1| phosphoribosylpyrophosphate synthetase [Shigella flexneri 5 str.
           8401]
 gi|281600631|gb|ADA73615.1| Ribose-phosphate pyrophosphokinase [Shigella flexneri 2002017]
          Length = 337

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 228 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 276


>gi|315179412|gb|ADT86326.1| ribose-phosphate pyrophosphokinase [Vibrio furnissii NCTC 11218]
          Length = 330

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 21/48 (43%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +   V G   +++DD+  TG T   AA ALK+ GA  V          
Sbjct: 207 LIGDVEGRDCVIVDDMIDTGGTLCKAAEALKERGAKRVFAYATHAVFS 254


>gi|293395770|ref|ZP_06640052.1| ribose-phosphate pyrophosphokinase [Serratia odorifera DSM 4582]
 gi|291421707|gb|EFE94954.1| ribose-phosphate pyrophosphokinase [Serratia odorifera DSM 4582]
          Length = 344

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 235 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 283


>gi|302865256|ref|YP_003833893.1| ribose-phosphate pyrophosphokinase [Micromonospora aurantiaca ATCC
           27029]
 gi|315501800|ref|YP_004080687.1| ribose-phosphate pyrophosphokinase [Micromonospora sp. L5]
 gi|302568115|gb|ADL44317.1| ribose-phosphate pyrophosphokinase [Micromonospora aurantiaca ATCC
           27029]
 gi|315408419|gb|ADU06536.1| ribose-phosphate pyrophosphokinase [Micromonospora sp. L5]
          Length = 326

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 25/53 (47%)

Query: 7   VPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           V   V   V G   L++DD+  TG T   AA  LK+ GA  + + +    L D
Sbjct: 213 VANRVVGEVEGRVCLIVDDMIDTGGTITKAADILKEQGAAEIVVASTHALLSD 265


>gi|271500553|ref|YP_003333578.1| ribose-phosphate pyrophosphokinase [Dickeya dadantii Ech586]
 gi|270344108|gb|ACZ76873.1| ribose-phosphate pyrophosphokinase [Dickeya dadantii Ech586]
          Length = 315

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|257463686|ref|ZP_05628076.1| hypoxanthine-guanine phosphoribosyltransferase [Fusobacterium sp.
           D12]
 gi|317061233|ref|ZP_07925718.1| hypoxanthine-guanine phosphoribosyltransferase [Fusobacterium sp.
           D12]
 gi|313686909|gb|EFS23744.1| hypoxanthine-guanine phosphoribosyltransferase [Fusobacterium sp.
           D12]
          Length = 178

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 10/51 (19%), Positives = 20/51 (39%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + +     + G  +L+++D+  +G T       L   GA  + I T 
Sbjct: 78  GVVKILKDTDFDIKGKNLLIVEDIIDSGLTLNYVKEFLYAKGAAEIKICTL 128


>gi|227873317|ref|ZP_03991579.1| hypoxanthine phosphoribosyltransferase [Oribacterium sinus F0268]
 gi|227840832|gb|EEJ51200.1| hypoxanthine phosphoribosyltransferase [Oribacterium sinus F0268]
          Length = 176

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 10/51 (19%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + + + + G  +LL++D+  TG T       L++    ++ I T 
Sbjct: 79  GVVKIVKDLDEPLEGKNVLLVEDIIDTGRTLHHLEHLLRERRPASLEICTL 129


>gi|254825867|ref|ZP_05230868.1| hypoxanthine phosphoribosyltransferase [Listeria monocytogenes FSL
           J1-194]
 gi|255521743|ref|ZP_05388980.1| hypothetical protein LmonocFSL_11047 [Listeria monocytogenes FSL
           J1-175]
 gi|293595106|gb|EFG02867.1| hypoxanthine phosphoribosyltransferase [Listeria monocytogenes FSL
           J1-194]
          Length = 648

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + ++  V G  +L+I+D+  +G T       +K   A +V ++T 
Sbjct: 546 GEVKIIKDLNASVEGRDVLVIEDIIDSGRTLSYLVDLIKYRKAKSVKLVTL 596


>gi|62180344|ref|YP_216761.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|237731784|ref|ZP_04562265.1| ribose-phosphate pyrophosphokinase [Citrobacter sp. 30_2]
 gi|289825868|ref|ZP_06545033.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|62127977|gb|AAX65680.1| phosphoribosylpyrophosphate synthetase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|226907323|gb|EEH93241.1| ribose-phosphate pyrophosphokinase [Citrobacter sp. 30_2]
 gi|322714819|gb|EFZ06390.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
          Length = 337

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 228 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 276


>gi|21229867|ref|NP_635784.1| competence protein F [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66766744|ref|YP_241506.1| competence protein F [Xanthomonas campestris pv. campestris str.
           8004]
 gi|188989813|ref|YP_001901823.1| hypothetical protein xccb100_0417 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21111369|gb|AAM39708.1| competence protein F [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66572076|gb|AAY47486.1| competence protein F [Xanthomonas campestris pv. campestris str.
           8004]
 gi|167731573|emb|CAP49748.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris]
          Length = 243

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 5/56 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R+AF     +        + L+DDV TTGAT   AA AL++AG   V     +R 
Sbjct: 192 LRDAFLAHGPLPT-----HVALVDDVMTTGATLHAAAQALRRAGVQRVDAWVCARV 242


>gi|168179311|ref|ZP_02613975.1| amidophosphoribosyltransferase [Clostridium botulinum NCTC 2916]
 gi|182669750|gb|EDT81726.1| amidophosphoribosyltransferase [Clostridium botulinum NCTC 2916]
          Length = 480

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 1/56 (1%)

Query: 4   AFNVP-QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           A +V    +  +V G ++++IDD    G T+K     L+KAGA  V     S  +K
Sbjct: 350 AVSVKLNPLKINVEGKRVVIIDDSIVRGTTSKRLVQILRKAGAKEVHFRVSSPVVK 405


>gi|171464200|ref|YP_001798313.1| ribose-phosphate pyrophosphokinase [Polynucleobacter necessarius
           subsp. necessarius STIR1]
 gi|171193738|gb|ACB44699.1| ribose-phosphate pyrophosphokinase [Polynucleobacter necessarius
           subsp. necessarius STIR1]
          Length = 321

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 24/49 (48%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +++DD+  TG T   AA ALK+ GA  V+       L 
Sbjct: 212 HLIGEVEGRHCVIMDDIIDTGGTLCKAAEALKERGAKGVTAYCTHAVLS 260


>gi|71082802|ref|YP_265521.1| ribose-phosphate pyrophosphokinase [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|91762775|ref|ZP_01264740.1| Ribose-phosphate pyrophosphokinase [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|71061915|gb|AAZ20918.1| Ribose-phosphate pyrophosphokinase [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|91718577|gb|EAS85227.1| Ribose-phosphate pyrophosphokinase [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 310

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 22/46 (47%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            +V G   +++DD+  +G T   AA ALK  GA  V +      L 
Sbjct: 205 GNVKGKTCIIVDDIIDSGGTIVNAAKALKDRGAKEVYVYITHGVLS 250


>gi|289551117|ref|YP_003472021.1| Amidophosphoribosyltransferase [Staphylococcus lugdunensis
           HKU09-01]
 gi|315658618|ref|ZP_07911488.1| amidophosphoribosyltransferase [Staphylococcus lugdunensis M23590]
 gi|289180649|gb|ADC87894.1| Amidophosphoribosyltransferase [Staphylococcus lugdunensis
           HKU09-01]
 gi|315496249|gb|EFU84574.1| amidophosphoribosyltransferase [Staphylococcus lugdunensis M23590]
          Length = 494

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 16/41 (39%), Positives = 20/41 (48%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
            V   V G KI+L+DD    G T K     LK +GA  V +
Sbjct: 342 AVKDIVEGKKIILVDDSIVRGTTIKRIVKMLKDSGAKEVHV 382


>gi|300781619|ref|ZP_07091473.1| phosphoribosyl pyrophosphate synthetase [Corynebacterium genitalium
           ATCC 33030]
 gi|300533326|gb|EFK54387.1| phosphoribosyl pyrophosphate synthetase [Corynebacterium genitalium
           ATCC 33030]
          Length = 325

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 24/53 (45%)

Query: 7   VPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           V   V   V G   +L+DD+  TG T   A   LK AGA +V I T      D
Sbjct: 213 VANRVVGDVEGKDCVLLDDMIDTGGTIAGAVGVLKDAGARSVVIATTHGVFSD 265


>gi|225848080|ref|YP_002728243.1| amidophosphoribosyltransferase [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225643104|gb|ACN98154.1| amidophosphoribosyltransferase [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 467

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 23/42 (54%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51
            V   + G +I++IDD    G T++     L++AGA  V +L
Sbjct: 345 PVRDVIEGKRIIVIDDSIVRGTTSRKIVNMLRRAGAKEVHML 386


>gi|160933231|ref|ZP_02080620.1| hypothetical protein CLOLEP_02077 [Clostridium leptum DSM 753]
 gi|156868305|gb|EDO61677.1| hypothetical protein CLOLEP_02077 [Clostridium leptum DSM 753]
          Length = 472

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 1   MRNAFNVP-QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
           + N+  V    + + V G +++LIDD   +G T+      L++AGA  V +  
Sbjct: 333 VENSVRVKMTALKESVRGKRLVLIDDSIVSGGTSAYIVKILREAGAREVHMRV 385


>gi|58580077|ref|YP_199093.1| competence protein F [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84622075|ref|YP_449447.1| competence protein F [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|58424671|gb|AAW73708.1| competence protein F [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84366015|dbj|BAE67173.1| competence protein F [Xanthomonas oryzae pv. oryzae MAFF 311018]
          Length = 243

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 5/56 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R+AF     +        + L+DDV TTGAT   AA AL+KAG   V     +R 
Sbjct: 192 LRDAFVARGPLPA-----HVALVDDVMTTGATLHAAAKALRKAGVQRVDAWVCARV 242


>gi|325698020|gb|EGD39901.1| hypoxanthine phosphoribosyltransferase [Streptococcus sanguinis
           SK160]
          Length = 184

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
              NV + + + + G  IL ++D+  TG T K      K+  A +V I T 
Sbjct: 82  GVINVIKDIDQDITGRDILFVEDIIDTGQTLKNLCNLFKERNAASVKIATL 132


>gi|269961565|ref|ZP_06175927.1| Ribose-phosphate pyrophosphokinase [Vibrio harveyi 1DA3]
 gi|269833606|gb|EEZ87703.1| Ribose-phosphate pyrophosphokinase [Vibrio harveyi 1DA3]
          Length = 311

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 21/48 (43%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +   V G   +++DD+  TG T   AA ALK+ GA  V          
Sbjct: 204 LIGDVEGRDCVIVDDMIDTGGTLCKAAEALKERGAKRVFAYATHAVFS 251


>gi|260779389|ref|ZP_05888281.1| ribose-phosphate pyrophosphokinase [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260605553|gb|EEX31848.1| ribose-phosphate pyrophosphokinase [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 314

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 21/48 (43%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +   V G   +++DD+  TG T   AA ALK+ GA  V          
Sbjct: 207 LIGDVEGRDCVIVDDMIDTGGTLCKAAEALKERGAKRVFAYATHAVFS 254


>gi|116871602|ref|YP_848383.1| hypothetical protein lwe0182 [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|116740480|emb|CAK19600.1| conserved hypothetical/hypoxanthine phosphoribosyltransferase,
           fusion protein [Listeria welshimeri serovar 6b str.
           SLCC5334]
          Length = 648

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + ++  V G  +L+I+D+  +G T       +K   A +V ++T 
Sbjct: 546 GEVKIIKDLNASVEGRDVLVIEDIIDSGRTLSYLVDLIKYRKAKSVKLVTL 596


>gi|323490421|ref|ZP_08095633.1| amidophosphoribosyltransferase [Planococcus donghaensis MPA1U2]
 gi|323395920|gb|EGA88754.1| amidophosphoribosyltransferase [Planococcus donghaensis MPA1U2]
          Length = 473

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 28/50 (56%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            V + V G +++++DD    G T++     LK+AGA  V ++  S  +K+
Sbjct: 341 PVRQVVKGKRVIMVDDSIVRGTTSRRIVNLLKEAGATEVHVVISSPPIKN 390


>gi|289664360|ref|ZP_06485941.1| putative competence protein [Xanthomonas campestris pv. vasculorum
           NCPPB702]
          Length = 243

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 5/56 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R+AF     +        + L+DDV TTGAT   AA AL+KAG   V     +R 
Sbjct: 192 LRDAFVARGALPA-----HVALVDDVMTTGATLHAAAKALRKAGVQRVDAWVCARV 242


>gi|256383969|gb|ACU78539.1| hypoxanthine phosphoribosyltransferase [Mycoplasma mycoides subsp.
           capri str. GM12]
 gi|256384801|gb|ACU79370.1| hypoxanthine phosphoribosyltransferase [Mycoplasma mycoides subsp.
           capri str. GM12]
 gi|296455221|gb|ADH21456.1| hypoxanthine phosphoribosyltransferase [synthetic Mycoplasma
           mycoides JCVI-syn1.0]
          Length = 190

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 23/48 (47%)

Query: 6   NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
            +   ++  V    IL+++D+  TG T K     L   GA +V ILT 
Sbjct: 88  KINLDLNTDVKDRDILIVEDIIDTGFTLKYVKEYLLNKGAKSVKILTM 135


>gi|170755843|ref|YP_001782515.1| amidophosphoribosyltransferase [Clostridium botulinum B1 str. Okra]
 gi|169121055|gb|ACA44891.1| amidophosphoribosyltransferase [Clostridium botulinum B1 str. Okra]
          Length = 482

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 1/56 (1%)

Query: 4   AFNVP-QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           A +V    +  +V G ++++IDD    G T+K     L+KAGA  V     S  +K
Sbjct: 352 AVSVKLNPLKINVEGKRVVIIDDSIVRGTTSKRLVQILRKAGAKEVHFRVSSPVVK 407


>gi|262392652|ref|YP_003284506.1| putative amidophosphoribosyltransferase [Vibrio sp. Ex25]
 gi|262336246|gb|ACY50041.1| predicted amidophosphoribosyltransferase [Vibrio sp. Ex25]
          Length = 180

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 13/56 (23%), Positives = 26/56 (46%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF + +          + ++DDV TTG+T +     L + G  ++ I    R+
Sbjct: 123 LKGAFILNKRPHSS----HVAIVDDVVTTGSTVRQLCHLLLEVGVESIDIYCICRT 174


>gi|332365106|gb|EGJ42871.1| hypoxanthine phosphoribosyltransferase [Streptococcus sanguinis
           SK355]
          Length = 184

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
              NV + + + + G  IL ++D+  TG T K      ++  A +V I T 
Sbjct: 82  GVINVIKDIDQDITGRDILFVEDIIDTGKTLKSLCDLFRERNAASVKIATL 132


>gi|332359484|gb|EGJ37303.1| hypoxanthine phosphoribosyltransferase [Streptococcus sanguinis
           SK1056]
          Length = 184

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
              NV + + + + G  IL ++D+  TG T K      K+  A +V I T 
Sbjct: 82  GVINVIKDIDQDITGRDILFVEDIIDTGQTLKNLCNLFKERNAASVKIATL 132


>gi|308235338|ref|ZP_07666075.1| hypoxanthine-guanine phosphoribosyltransferase [Gardnerella
           vaginalis ATCC 14018]
 gi|311114325|ref|YP_003985546.1| hypoxanthine phosphoribosyltransferase [Gardnerella vaginalis ATCC
           14019]
 gi|310945819|gb|ADP38523.1| hypoxanthine phosphoribosyltransferase [Gardnerella vaginalis ATCC
           14019]
          Length = 184

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               V + ++  V G  +L+++D+  +G T       LK  GA +V +   
Sbjct: 82  GQITVREDLTTDVRGRNVLIVEDIVDSGKTLDWLVKELKSRGAASVKVFAL 132


>gi|261367065|ref|ZP_05979948.1| putative competence protein F [Subdoligranulum variabile DSM 15176]
 gi|282571184|gb|EFB76719.1| putative competence protein F [Subdoligranulum variabile DSM 15176]
          Length = 257

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 18/45 (40%), Positives = 27/45 (60%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
                + G ++LL+DD+ TTGAT    A+AL KAGA+ V+    +
Sbjct: 196 RTDADLGGKRVLLVDDIITTGATVSACALALLKAGAVDVTAAAIA 240


>gi|50121113|ref|YP_050280.1| ribose-phosphate pyrophosphokinase [Pectobacterium atrosepticum
           SCRI1043]
 gi|227111326|ref|ZP_03824982.1| ribose-phosphate pyrophosphokinase [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
 gi|253688504|ref|YP_003017694.1| ribose-phosphate pyrophosphokinase [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|49611639|emb|CAG75088.1| ribose-phosphate pyrophosphokinase [Pectobacterium atrosepticum
           SCRI1043]
 gi|251755082|gb|ACT13158.1| ribose-phosphate pyrophosphokinase [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 315

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|85713258|ref|ZP_01044283.1| ribose-phosphate pyrophosphokinase [Idiomarina baltica OS145]
 gi|85692927|gb|EAQ30900.1| ribose-phosphate pyrophosphokinase [Idiomarina baltica OS145]
          Length = 312

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 13/49 (26%), Positives = 21/49 (42%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   +     +++DD+  TG T   AA ALK+ GA  V          
Sbjct: 203 HIIGDIKDRDCIIVDDMIDTGGTLCKAAEALKQHGAKRVFAYATHPVFS 251


>gi|320531220|ref|ZP_08032205.1| hypoxanthine phosphoribosyltransferase [Actinomyces sp. oral taxon
           171 str. F0337]
 gi|325067911|ref|ZP_08126584.1| hypoxanthine phosphoribosyltransferase [Actinomyces oris K20]
 gi|326773853|ref|ZP_08233135.1| hypoxanthine phosphoribosyltransferase [Actinomyces viscosus C505]
 gi|320136589|gb|EFW28552.1| hypoxanthine phosphoribosyltransferase [Actinomyces sp. oral taxon
           171 str. F0337]
 gi|326635992|gb|EGE36896.1| hypoxanthine phosphoribosyltransferase [Actinomyces viscosus C505]
          Length = 184

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 14/53 (26%), Positives = 22/53 (41%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + +   V    IL+++DV  +G T       L   GA +V I T  R
Sbjct: 82  GVVRILKDLDTDVTDRHILIVEDVIDSGLTLSWLVGNLSSRGAASVEIATLLR 134


>gi|297583329|ref|YP_003699109.1| competence protein F [Bacillus selenitireducens MLS10]
 gi|297141786|gb|ADH98543.1| competence protein F [Bacillus selenitireducens MLS10]
          Length = 249

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +   F++   +   + G  + +IDD+YTTG+T   A+  L KAGA  V  +T  R+
Sbjct: 195 LDGVFSLVSSL-PDLNGKTVCIIDDLYTTGSTLYSASALLYKAGAKHVVAVTAVRA 249


>gi|254413742|ref|ZP_05027511.1| amidophosphoribosyltransferase [Microcoleus chthonoplastes PCC
           7420]
 gi|196179339|gb|EDX74334.1| amidophosphoribosyltransferase [Microcoleus chthonoplastes PCC
           7420]
          Length = 497

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 12/48 (25%), Positives = 25/48 (52%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
            +   +AG +++++DD    G T++    AL+ AGA  V +   +  +
Sbjct: 367 PLKDVLAGKRVIIVDDSIVRGTTSRKIVKALRDAGATEVHMRVSAPPV 414


>gi|148381466|ref|YP_001256007.1| hypoxanthine phosphoribosyltransferase [Clostridium botulinum A
           str. ATCC 3502]
 gi|153931026|ref|YP_001385841.1| hypoxanthine phosphoribosyltransferase [Clostridium botulinum A
           str. ATCC 19397]
 gi|153937274|ref|YP_001389248.1| hypoxanthine phosphoribosyltransferase [Clostridium botulinum A
           str. Hall]
 gi|153941309|ref|YP_001392880.1| hypoxanthine phosphoribosyltransferase [Clostridium botulinum F
           str. Langeland]
 gi|168180995|ref|ZP_02615659.1| hypoxanthine phosphoribosyltransferase [Clostridium botulinum NCTC
           2916]
 gi|170754732|ref|YP_001783166.1| hypoxanthine phosphoribosyltransferase [Clostridium botulinum B1
           str. Okra]
 gi|226950982|ref|YP_002806073.1| hypoxanthine phosphoribosyltransferase [Clostridium botulinum A2
           str. Kyoto]
 gi|148290950|emb|CAL85086.1| hypoxanthine phosphoribosyltransferase [Clostridium botulinum A
           str. ATCC 3502]
 gi|152927070|gb|ABS32570.1| hypoxanthine phosphoribosyltransferase [Clostridium botulinum A
           str. ATCC 19397]
 gi|152933188|gb|ABS38687.1| hypoxanthine phosphoribosyltransferase [Clostridium botulinum A
           str. Hall]
 gi|152937205|gb|ABS42703.1| hypoxanthine phosphoribosyltransferase [Clostridium botulinum F
           str. Langeland]
 gi|169119944|gb|ACA43780.1| hypoxanthine phosphoribosyltransferase [Clostridium botulinum B1
           str. Okra]
 gi|182668126|gb|EDT80105.1| hypoxanthine phosphoribosyltransferase [Clostridium botulinum NCTC
           2916]
 gi|226843572|gb|ACO86238.1| hypoxanthine phosphoribosyltransferase [Clostridium botulinum A2
           str. Kyoto]
 gi|295320857|gb|ADG01235.1| hypoxanthine phosphoribosyltransferase [Clostridium botulinum F
           str. 230613]
 gi|322807851|emb|CBZ05426.1| hypoxanthine-guanine phosphoribosyltransferase [Clostridium
           botulinum H04402 065]
          Length = 181

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 9/51 (17%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   + G  IL+++D+  +G T K     L+     +++I   
Sbjct: 80  GVVRILKDLDFEIEGKDILIVEDIIDSGITLKYLLENLRARKPASINIACL 130


>gi|332289243|ref|YP_004420095.1| gluconate periplasmic binding protein [Gallibacterium anatis
           UMN179]
 gi|330432139|gb|AEC17198.1| gluconate periplasmic binding protein [Gallibacterium anatis
           UMN179]
          Length = 232

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           M+ AF + Q +   +   +I LIDDV TTGAT +     L +     + +    R+ K
Sbjct: 177 MQQAFTLKQRLPAQI--KRIALIDDVITTGATMEAICRCLMQQELAEIQVWALCRTQK 232


>gi|229130437|ref|ZP_04259394.1| ComF operon protein 3 [Bacillus cereus BDRD-Cer4]
 gi|228653032|gb|EEL08913.1| ComF operon protein 3 [Bacillus cereus BDRD-Cer4]
          Length = 190

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 21/45 (46%), Positives = 27/45 (60%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
            +  +G  ILL+DDVYTTG+T +     L + GA  VS LT  RS
Sbjct: 146 EEMFSGQHILLVDDVYTTGSTVRQIGSLLYERGAREVSSLTLCRS 190


>gi|30023225|ref|NP_834856.1| comF operon protein 3 [Bacillus cereus ATCC 14579]
 gi|29898785|gb|AAP12057.1| Competence protein F [Bacillus cereus ATCC 14579]
          Length = 234

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 21/45 (46%), Positives = 27/45 (60%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
            +  +G  ILL+DDVYTTG+T +     L + GA  VS LT  RS
Sbjct: 190 EEMFSGQHILLVDDVYTTGSTVRQIGSLLYERGAREVSSLTLCRS 234


>gi|289668158|ref|ZP_06489233.1| putative competence protein [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 243

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 5/56 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R+AF     +        + L+DDV TTGAT   AA AL+KAG   V     +R 
Sbjct: 192 LRDAFVARGALPA-----HVALVDDVMTTGATLHAAAKALRKAGVQRVDAWVCARV 242


>gi|288904250|ref|YP_003429471.1| glutamine phosphoribosylpyrophosphate amidotransferase
           [Streptococcus gallolyticus UCN34]
 gi|288730975|emb|CBI12519.1| glutamine phosphoribosylpyrophosphate amidotransferase
           [Streptococcus gallolyticus UCN34]
          Length = 487

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 13/42 (30%), Positives = 23/42 (54%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51
            VS  V G +++++DD    G T++     L++AGA  V + 
Sbjct: 343 AVSGVVKGKRVVMVDDSIVRGTTSRRIVRLLREAGATEVHVA 384


>gi|296128487|ref|YP_003635737.1| hypoxanthine phosphoribosyltransferase [Cellulomonas flavigena DSM
           20109]
 gi|296020302|gb|ADG73538.1| hypoxanthine phosphoribosyltransferase [Cellulomonas flavigena DSM
           20109]
          Length = 184

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 11/53 (20%), Positives = 23/53 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + +   + G  +L+++D+  +G T       L+  G  +V I T  R
Sbjct: 82  GVVRILKDLDTDLTGRHVLIVEDIIDSGLTLSWLLSNLRSRGPASVEIATMLR 134


>gi|242239286|ref|YP_002987467.1| ribose-phosphate pyrophosphokinase [Dickeya dadantii Ech703]
 gi|242131343|gb|ACS85645.1| ribose-phosphate pyrophosphokinase [Dickeya dadantii Ech703]
          Length = 315

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|170718660|ref|YP_001783855.1| competence protein [Haemophilus somnus 2336]
 gi|168826789|gb|ACA32160.1| competence protein [Haemophilus somnus 2336]
          Length = 232

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + NAFNV   + +      I LIDDV TTG+T    A  LK+AG   + +   +++
Sbjct: 179 LHNAFNVN--IKRAKQYHSIALIDDVITTGSTLNEIAKLLKQAGINVIHVWGLAKT 232


>gi|116492229|ref|YP_803964.1| amidophosphoribosyltransferase [Pediococcus pentosaceus ATCC 25745]
 gi|116102379|gb|ABJ67522.1| Predicted amidophosphoribosyltransferase [Pediococcus pentosaceus
           ATCC 25745]
          Length = 143

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 26/42 (61%)

Query: 14  HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
            ++G  ILL+DD+YTTGAT + A   L + GA  V  +T  R
Sbjct: 102 DISGEHILLVDDIYTTGATLRQARTTLLRNGATQVRSVTLCR 143


>gi|111022688|ref|YP_705660.1| ribose-phosphate pyrophosphokinase [Rhodococcus jostii RHA1]
 gi|110822218|gb|ABG97502.1| ribose-phosphate diphosphokinase [Rhodococcus jostii RHA1]
          Length = 326

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 23/52 (44%)

Query: 8   PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
              V   V G   +LIDD+  TG T   A   LK+AGA  V I      L D
Sbjct: 214 SNRVVGDVEGHTCILIDDMIDTGGTIAGAVKILKEAGAGDVIIAATHGVLSD 265


>gi|15613193|ref|NP_241496.1| amidophosphoribosyltransferase [Bacillus halodurans C-125]
 gi|10173244|dbj|BAB04349.1| phosphoribosylpyrophosphate amidotransferase [Bacillus halodurans
           C-125]
          Length = 473

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 25/49 (51%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            V   V G ++++IDD    G T++     L++AGA  V +   +  +K
Sbjct: 341 AVRGVVEGKRVVMIDDSIVRGTTSRRIVNMLREAGAKEVHVRISAPPIK 389


>gi|315222416|ref|ZP_07864320.1| amidophosphoribosyltransferase [Streptococcus anginosus F0211]
 gi|315188501|gb|EFU22212.1| amidophosphoribosyltransferase [Streptococcus anginosus F0211]
          Length = 489

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 13/42 (30%), Positives = 23/42 (54%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51
            VS  V G +++++DD    G T++     L++AGA  V + 
Sbjct: 345 AVSGVVKGKRVVMVDDSIVRGTTSRRIVRLLREAGATEVHVA 386


>gi|306830277|ref|ZP_07463448.1| amidophosphoribosyltransferase [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|306832526|ref|ZP_07465666.1| amidophosphoribosyltransferase [Streptococcus bovis ATCC 700338]
 gi|325977226|ref|YP_004286942.1| amidophosphoribosyltransferase [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
 gi|304425284|gb|EFM28410.1| amidophosphoribosyltransferase [Streptococcus bovis ATCC 700338]
 gi|304427524|gb|EFM30625.1| amidophosphoribosyltransferase [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|325177154|emb|CBZ47198.1| amidophosphoribosyltransferase [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
          Length = 487

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 13/42 (30%), Positives = 23/42 (54%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51
            VS  V G +++++DD    G T++     L++AGA  V + 
Sbjct: 343 AVSGVVKGKRVVMVDDSIVRGTTSRRIVRLLREAGATEVHVA 384


>gi|260767757|ref|ZP_05876692.1| ribose-phosphate pyrophosphokinase [Vibrio furnissii CIP 102972]
 gi|260617266|gb|EEX42450.1| ribose-phosphate pyrophosphokinase [Vibrio furnissii CIP 102972]
          Length = 314

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 21/48 (43%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +   V G   +++DD+  TG T   AA ALK+ GA  V          
Sbjct: 207 LIGDVEGRDCVIVDDMIDTGGTLCKAAEALKERGAKRVFAYATHAVFS 254


>gi|171778353|ref|ZP_02919532.1| hypothetical protein STRINF_00383 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171282884|gb|EDT48308.1| hypothetical protein STRINF_00383 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 487

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 13/42 (30%), Positives = 23/42 (54%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51
            VS  V G +++++DD    G T++     L++AGA  V + 
Sbjct: 343 AVSGVVKGKRVVMVDDSIVRGTTSRRIVRLLREAGATEVHVA 384


>gi|299132843|ref|ZP_07026038.1| phosphoribosyltransferase [Afipia sp. 1NLS2]
 gi|298592980|gb|EFI53180.1| phosphoribosyltransferase [Afipia sp. 1NLS2]
          Length = 266

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 34/57 (59%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           M+ AF V       VAG  ++L+DDV T+GAT    A AL +A A +V +L F+R +
Sbjct: 203 MQGAFAVGDDQRASVAGRHLILVDDVLTSGATVDACARALLRAKAASVDVLVFARVV 259


>gi|239916683|ref|YP_002956241.1| hypoxanthine phosphoribosyltransferase [Micrococcus luteus NCTC
           2665]
 gi|281414859|ref|ZP_06246601.1| hypoxanthine phosphoribosyltransferase [Micrococcus luteus NCTC
           2665]
 gi|289706998|ref|ZP_06503333.1| hypoxanthine phosphoribosyltransferase [Micrococcus luteus SK58]
 gi|239837890|gb|ACS29687.1| hypoxanthine phosphoribosyltransferase [Micrococcus luteus NCTC
           2665]
 gi|289556323|gb|EFD49679.1| hypoxanthine phosphoribosyltransferase [Micrococcus luteus SK58]
          Length = 183

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 11/53 (20%), Positives = 23/53 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + +   + G  +L+++D+  +G T       L+  G  +V I T  R
Sbjct: 82  GVVRILKDLDADLTGRHVLIVEDIIDSGLTLSWLKANLESRGPASVEICTLLR 134


>gi|28897513|ref|NP_797118.1| ribose-phosphate pyrophosphokinase [Vibrio parahaemolyticus RIMD
           2210633]
 gi|32469691|sp|Q87RN8|KPRS_VIBPA RecName: Full=Ribose-phosphate pyrophosphokinase; Short=RPPK;
           AltName: Full=Phosphoribosyl pyrophosphate synthase;
           Short=P-Rib-PP synthase; Short=PRPP synthase
 gi|28805725|dbj|BAC59002.1| ribose-phosphate pyrophosphokinase [Vibrio parahaemolyticus RIMD
           2210633]
 gi|328473489|gb|EGF44337.1| ribose-phosphate pyrophosphokinase [Vibrio parahaemolyticus 10329]
          Length = 314

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 21/48 (43%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +   V G   +++DD+  TG T   AA ALK+ GA  V          
Sbjct: 207 LIGDVEGRDCVIVDDMIDTGGTLCKAAEALKERGAKRVFAYATHAVFS 254


>gi|332528606|ref|ZP_08404588.1| ribose-phosphate pyrophosphokinase [Hylemonella gracilis ATCC
           19624]
 gi|332041922|gb|EGI78266.1| ribose-phosphate pyrophosphokinase [Hylemonella gracilis ATCC
           19624]
          Length = 341

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 13/46 (28%), Positives = 20/46 (43%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
             + G   +++DD+  T  T   AA  LK+ GA +V        L 
Sbjct: 228 GDIEGRNCVIMDDMIDTAGTLVKAAEVLKERGAKSVYAYCTHPILS 273


>gi|319898711|ref|YP_004158804.1| amidophosphoribosyltransferase [Bartonella clarridgeiae 73]
 gi|319402675|emb|CBI76221.1| amidophosphoribosyltransferase [Bartonella clarridgeiae 73]
          Length = 497

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 15/52 (28%), Positives = 22/52 (42%), Gaps = 3/52 (5%)

Query: 4   AFNV---PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
           AF V          + G +++LIDD    G T+      L+ AGA  V +  
Sbjct: 349 AFGVKLKHSANRSIIEGKRVILIDDSIVRGTTSIKIVRMLRSAGAKEVHMRV 400


>gi|258616414|ref|ZP_05714184.1| amidophosphoribosyltransferase [Enterococcus faecium DO]
          Length = 380

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 25/49 (51%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            V   V G K++++DD    G T++     LK+AGA  V +   S  LK
Sbjct: 244 AVRGVVEGKKVIMVDDSIVRGTTSRRIVHLLKEAGAKEVHVRIASPPLK 292


>gi|255526142|ref|ZP_05393063.1| hypoxanthine phosphoribosyltransferase [Clostridium carboxidivorans
           P7]
 gi|296187153|ref|ZP_06855550.1| hypoxanthine phosphoribosyltransferase [Clostridium carboxidivorans
           P7]
 gi|255510191|gb|EET86510.1| hypoxanthine phosphoribosyltransferase [Clostridium carboxidivorans
           P7]
 gi|296048188|gb|EFG87625.1| hypoxanthine phosphoribosyltransferase [Clostridium carboxidivorans
           P7]
          Length = 173

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 20/51 (39%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               V   +   + G  +L++DD+  TG T       +K  GA +V     
Sbjct: 77  GCVKVVNDIQDDIKGCDVLIVDDIIDTGITMDFVIGHIKALGAASVKCCVL 127


>gi|188589501|ref|YP_001920333.1| hypoxanthine phosphoribosyltransferase [Clostridium botulinum E3
           str. Alaska E43]
 gi|188499782|gb|ACD52918.1| hypoxanthine phosphoribosyltransferase [Clostridium botulinum E3
           str. Alaska E43]
          Length = 173

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 21/51 (41%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               V   +  ++ G  +L++DD+  TG T       +K  GA +V     
Sbjct: 77  GKVKVINDIPDNIEGYDVLIVDDIIDTGITMNFVVDHVKNLGAASVKTCVL 127


>gi|152979410|ref|YP_001345039.1| ribose-phosphate pyrophosphokinase [Actinobacillus succinogenes
           130Z]
 gi|150841133|gb|ABR75104.1| ribose-phosphate pyrophosphokinase [Actinobacillus succinogenes
           130Z]
          Length = 315

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 207 HIIGDVAGRDCILVDDMIDTGGTLVKAAEALKERGAKRVFAYATHAVFS 255


>gi|319940219|ref|ZP_08014572.1| hypoxanthine phosphoribosyltransferase [Streptococcus anginosus
           1_2_62CV]
 gi|319810690|gb|EFW07020.1| hypoxanthine phosphoribosyltransferase [Streptococcus anginosus
           1_2_62CV]
          Length = 180

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 25/51 (49%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
              N+ + + + +AG  IL ++D+  TG T K      ++  A +V I T 
Sbjct: 78  GVINIIKDIDQDIAGRHILFVEDIIDTGKTLKSLCELFREKKAASVKIATL 128


>gi|319405473|emb|CBI79092.1| amidophosphoribosyltransferase [Bartonella sp. AR 15-3]
          Length = 497

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 15/52 (28%), Positives = 22/52 (42%), Gaps = 3/52 (5%)

Query: 4   AFNV---PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
           AF V          + G +++LIDD    G T+      L+ AGA  V +  
Sbjct: 349 AFGVKLKHSANRSIIEGKRVILIDDSIVRGTTSVKIVRMLRNAGAKEVHMRV 400


>gi|171743215|ref|ZP_02919022.1| hypothetical protein BIFDEN_02343 [Bifidobacterium dentium ATCC
           27678]
 gi|171278829|gb|EDT46490.1| hypothetical protein BIFDEN_02343 [Bifidobacterium dentium ATCC
           27678]
          Length = 252

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++    V   +   V G+ ++LIDD+ T+G T +     L++AGA  V++L  + +  
Sbjct: 183 LKGHVTVRSGI--DVRGVPVVLIDDIITSGTTMRRCVEVLQQAGATVVTVLALAYTPP 238


>gi|145550215|ref|XP_001460786.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124428617|emb|CAK93389.1| unnamed protein product [Paramecium tetraurelia]
          Length = 368

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 22/48 (45%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +   V G   L+IDD+  +G+T   AA  LK+ GA +V          
Sbjct: 255 LVGEVNGRNCLIIDDIVDSGSTLSRAADILKREGAKSVMAYATHPVFS 302


>gi|324991854|gb|EGC23777.1| hypoxanthine phosphoribosyltransferase [Streptococcus sanguinis
           SK405]
 gi|324996256|gb|EGC28166.1| hypoxanthine phosphoribosyltransferase [Streptococcus sanguinis
           SK678]
 gi|327458478|gb|EGF04828.1| hypoxanthine phosphoribosyltransferase [Streptococcus sanguinis
           SK1]
 gi|327463846|gb|EGF10162.1| hypoxanthine phosphoribosyltransferase [Streptococcus sanguinis
           SK1057]
 gi|327467726|gb|EGF13220.1| hypoxanthine phosphoribosyltransferase [Streptococcus sanguinis
           SK330]
 gi|327471620|gb|EGF17063.1| hypoxanthine phosphoribosyltransferase [Streptococcus sanguinis
           SK408]
 gi|327490350|gb|EGF22137.1| hypoxanthine phosphoribosyltransferase [Streptococcus sanguinis
           SK1058]
          Length = 184

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
              NV + + + + G  IL ++D+  TG T K      K+  A +V I T 
Sbjct: 82  GVINVIKDIDQDITGRDILFVEDIIDTGQTLKNLCNLFKERNAASVKIATL 132


>gi|163791044|ref|ZP_02185465.1| ribose-phosphate pyrophosphokinase [Carnobacterium sp. AT7]
 gi|159873689|gb|EDP67772.1| ribose-phosphate pyrophosphokinase [Carnobacterium sp. AT7]
          Length = 329

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 22/46 (47%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            +V G K +LIDD+  T  T   AA AL +AGA  V        L 
Sbjct: 217 GNVEGKKCILIDDMIDTAGTITLAAQALSEAGATEVYACCTHPVLS 262


>gi|15602109|ref|NP_245181.1| ribose-phosphate pyrophosphokinase [Pasteurella multocida subsp.
           multocida str. Pm70]
 gi|24418536|sp|Q9CP22|KPRS_PASMU RecName: Full=Ribose-phosphate pyrophosphokinase; Short=RPPK;
           AltName: Full=Phosphoribosyl pyrophosphate synthase;
           Short=P-Rib-PP synthase; Short=PRPP synthase
 gi|12720472|gb|AAK02328.1| PrsA [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 315

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 207 HIIGDVAGRDCILVDDMIDTGGTLCKAAEALKERGAKRVFAYATHAVFS 255


>gi|323496825|ref|ZP_08101862.1| ribose-phosphate pyrophosphokinase [Vibrio sinaloensis DSM 21326]
 gi|323318084|gb|EGA71058.1| ribose-phosphate pyrophosphokinase [Vibrio sinaloensis DSM 21326]
          Length = 314

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 21/48 (43%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +   V G   +++DD+  TG T   AA ALK+ GA  V          
Sbjct: 207 LIGDVEGRDCVIVDDMIDTGGTLCKAAEALKERGAKRVFAYATHAVFS 254


>gi|187777492|ref|ZP_02993965.1| hypothetical protein CLOSPO_01067 [Clostridium sporogenes ATCC
           15579]
 gi|187774420|gb|EDU38222.1| hypothetical protein CLOSPO_01067 [Clostridium sporogenes ATCC
           15579]
          Length = 181

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 9/51 (17%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   + G  IL+++D+  +G T K     L+     +++I   
Sbjct: 80  GVVRILKDLDFEIEGKDILIVEDIIDSGITLKYLLENLRARKPASINIACL 130


>gi|156973545|ref|YP_001444452.1| ribose-phosphate pyrophosphokinase [Vibrio harveyi ATCC BAA-1116]
 gi|156525139|gb|ABU70225.1| hypothetical protein VIBHAR_01246 [Vibrio harveyi ATCC BAA-1116]
          Length = 311

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 21/48 (43%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +   V G   +++DD+  TG T   AA ALK+ GA  V          
Sbjct: 204 LIGDVEGRDCVIVDDMIDTGGTLCKAAEALKERGAKRVFAYATHAVFS 251


>gi|254362231|ref|ZP_04978346.1| competence protein F [Mannheimia haemolytica PHL213]
 gi|261493069|ref|ZP_05989609.1| competence protein F [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261496357|ref|ZP_05992752.1| competence protein F [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|153093803|gb|EDN74742.1| competence protein F [Mannheimia haemolytica PHL213]
 gi|261308001|gb|EEY09309.1| competence protein F [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261311289|gb|EEY12452.1| competence protein F [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 225

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF          A  ++ ++DDV TTG+T       L KAG + + +   +R+
Sbjct: 174 LRGAFFYQPLK----AYKRVAIVDDVLTTGSTLNVICAELLKAGVVEIQVWVLARA 225


>gi|145590099|ref|YP_001156696.1| ribose-phosphate pyrophosphokinase [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
 gi|145048505|gb|ABP35132.1| ribose-phosphate pyrophosphokinase [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 321

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 24/49 (48%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +++DD+  TG T   AA ALK+ GA  V+       L 
Sbjct: 212 HLIGEVEGRHCVIMDDIIDTGGTLCKAAEALKERGAKGVTAYCTHAVLS 260


>gi|331703302|ref|YP_004399989.1| hypoxanthine phosphoribosyltransferase [Mycoplasma mycoides subsp.
           capri LC str. 95010]
 gi|328801857|emb|CBW54010.1| Hypoxanthine phosphoribosyltransferase [Mycoplasma mycoides subsp.
           capri LC str. 95010]
          Length = 190

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 23/48 (47%)

Query: 6   NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
            +   ++  V    IL+++D+  TG T K     L   GA +V ILT 
Sbjct: 88  KINLDLNTDVKDRDILIVEDIIDTGFTLKYVKEYLLNKGAKSVKILTM 135


>gi|226530643|ref|NP_001147566.1| bifunctional protein tilS/hprT [Zea mays]
 gi|224034179|gb|ACN36165.1| unknown [Zea mays]
          Length = 266

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 26/48 (54%)

Query: 6   NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
            +   +   VAG  +++++D+  TG T       L+K GA ++S+ TF
Sbjct: 158 RITADLKVDVAGKHVVVVEDIVDTGNTLSYLIAHLEKKGASSISVCTF 205


>gi|42560804|ref|NP_975255.1| hypoxanthine phosphoribosyltransferase [Mycoplasma mycoides subsp.
           mycoides SC str. PG1]
 gi|42492300|emb|CAE76897.1| hypoxanthine phosphoribosyltransferase [Mycoplasma mycoides subsp.
           mycoides SC str. PG1]
 gi|301321431|gb|ADK70074.1| hypoxanthine phosphoribosyltransferase [Mycoplasma mycoides subsp.
           mycoides SC str. Gladysdale]
          Length = 190

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 23/48 (47%)

Query: 6   NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
            +   ++  V    IL+++D+  TG T K     L   GA +V ILT 
Sbjct: 88  KINLDLNTDVKDRDILIVEDIIDTGFTLKYVKEYLLNKGAKSVKILTM 135


>gi|330975571|gb|EGH75637.1| ribose-phosphate pyrophosphokinase [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 313

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 22/49 (44%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +L+DD+  T  T   AA ALK+ GA  V        L 
Sbjct: 205 HIIGDVEGRTCILVDDMVDTAGTLCHAAKALKEHGAAKVFAYCTHPVLS 253


>gi|300811383|ref|ZP_07091879.1| hypoxanthine phosphoribosyltransferase [Lactobacillus delbrueckii
           subsp. bulgaricus PB2003/044-T3-4]
 gi|313123248|ref|YP_004033507.1| hypoxanthine phosphoribosyltransferase [Lactobacillus delbrueckii
           subsp. bulgaricus ND02]
 gi|300497618|gb|EFK32644.1| hypoxanthine phosphoribosyltransferase [Lactobacillus delbrueckii
           subsp. bulgaricus PB2003/044-T3-4]
 gi|312279811|gb|ADQ60530.1| Hypoxanthine phosphoribosyltransferase [Lactobacillus delbrueckii
           subsp. bulgaricus ND02]
 gi|325684577|gb|EGD26738.1| hypoxanthine phosphoribosyltransferase [Lactobacillus delbrueckii
           subsp. lactis DSM 20072]
          Length = 190

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 20/51 (39%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               V   +   V G  +L+++D+  TG T K     L   GA +V     
Sbjct: 80  GKITVTHDLEADVTGRDVLIVEDIVDTGLTLKFMKDELLSRGANSVKCCVL 130


>gi|227543695|ref|ZP_03973744.1| hypoxanthine phosphoribosyltransferase [Lactobacillus reuteri
           CF48-3A]
 gi|300908758|ref|ZP_07126221.1| hypoxanthine phosphoribosyltransferase [Lactobacillus reuteri
           SD2112]
 gi|227186324|gb|EEI66395.1| hypoxanthine phosphoribosyltransferase [Lactobacillus reuteri
           CF48-3A]
 gi|300894165|gb|EFK87523.1| hypoxanthine phosphoribosyltransferase [Lactobacillus reuteri
           SD2112]
          Length = 178

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + Q +S  + G  +++++D+  TG T K  A      GA ++ I + 
Sbjct: 77  GKVKLIQDLSHDIKGRPVIIMEDIIDTGHTLKYLAGLFADRGAKSIEICSL 127


>gi|320325685|gb|EFW81746.1| ribose-phosphate pyrophosphokinase [Pseudomonas syringae pv.
           glycinea str. B076]
          Length = 313

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 22/49 (44%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +L+DD+  T  T   AA ALK+ GA  V        L 
Sbjct: 205 HIIGDVEGRTCILVDDMVDTAGTLCHAAKALKEHGAAKVFAYCTHPVLS 253


>gi|289704903|ref|ZP_06501320.1| ribose-phosphate diphosphokinase [Micrococcus luteus SK58]
 gi|289558399|gb|EFD51673.1| ribose-phosphate diphosphokinase [Micrococcus luteus SK58]
          Length = 360

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 19/52 (36%), Positives = 22/52 (42%)

Query: 8   PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            + V   V G   +LIDD+  TG T   A   LK AGA  V I        D
Sbjct: 248 SKTVVGDVEGRVCVLIDDMIDTGGTIAGAVQILKDAGAKDVIIAATHAVFSD 299


>gi|257869881|ref|ZP_05649534.1| amidophosphoribosyl transferase [Enterococcus gallinarum EG2]
 gi|257804045|gb|EEV32867.1| amidophosphoribosyl transferase [Enterococcus gallinarum EG2]
          Length = 479

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 14/41 (34%), Positives = 22/41 (53%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
            V   V G K++++DD    G T++     LK+AGA  V +
Sbjct: 349 AVRGVVEGKKVIMVDDSIVRGTTSRRIVQLLKEAGAKEVHV 389


>gi|319940346|ref|ZP_08014696.1| amidophosphoribosyltransferase PurF [Streptococcus anginosus
           1_2_62CV]
 gi|319810402|gb|EFW06744.1| amidophosphoribosyltransferase PurF [Streptococcus anginosus
           1_2_62CV]
          Length = 487

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 13/42 (30%), Positives = 23/42 (54%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51
            VS  V G +++++DD    G T++     L++AGA  V + 
Sbjct: 343 AVSGVVKGKRVVMVDDSIVRGTTSRRIVRLLREAGATEVHVA 384


>gi|260774745|ref|ZP_05883648.1| predicted amidophosphoribosyltransferase [Vibrio coralliilyticus
           ATCC BAA-450]
 gi|260609307|gb|EEX35459.1| predicted amidophosphoribosyltransferase [Vibrio coralliilyticus
           ATCC BAA-450]
          Length = 234

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF++ + ++       + ++DDV TTG+T       L  AG  T+ I    R+
Sbjct: 177 VRQAFHLRKSINAE----HVAIVDDVLTTGSTVHQLCELLLDAGVKTIDIYCICRT 228


>gi|229542262|ref|ZP_04431322.1| hypoxanthine phosphoribosyltransferase [Bacillus coagulans 36D1]
 gi|229326682|gb|EEN92357.1| hypoxanthine phosphoribosyltransferase [Bacillus coagulans 36D1]
          Length = 182

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 10/51 (19%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V G  +L+I+D+  +G T        +   A ++ I+T 
Sbjct: 77  GEVKILKDLDTSVEGRDVLIIEDIIDSGMTLSYLVELFRYRKAKSIKIVTL 127


>gi|218708751|ref|YP_002416372.1| ribose-phosphate pyrophosphokinase [Vibrio splendidus LGP32]
 gi|218321770|emb|CAV17725.1| Ribose-phosphate pyrophosphokinase [Vibrio splendidus LGP32]
          Length = 314

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 21/48 (43%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +   V G   +++DD+  TG T   AA ALK+ GA  V          
Sbjct: 207 LIGDVEGRDCVIVDDMIDTGGTLCKAAEALKERGAKRVFAYATHAVFS 254


>gi|225463085|ref|XP_002263568.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|147785106|emb|CAN75448.1| hypothetical protein VITISV_030928 [Vitis vinifera]
 gi|297739372|emb|CBI29362.3| unnamed protein product [Vitis vinifera]
          Length = 185

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 26/51 (50%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
            A ++   +   + G  +++++D+  TG T  C    L+  GA +VS+  F
Sbjct: 79  GAPSISLDLKIDIKGKHVIVVEDIVDTGNTLFCLIAHLEAKGASSVSVCAF 129


>gi|329296260|ref|ZP_08253596.1| ribose-phosphate pyrophosphokinase [Plautia stali symbiont]
          Length = 315

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|319892066|ref|YP_004148941.1| Amidophosphoribosyltransferase [Staphylococcus pseudintermedius
           HKU10-03]
 gi|317161762|gb|ADV05305.1| Amidophosphoribosyltransferase [Staphylococcus pseudintermedius
           HKU10-03]
 gi|323464825|gb|ADX76978.1| amidophosphoribosyltransferase [Staphylococcus pseudintermedius
           ED99]
          Length = 473

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 26/52 (50%)

Query: 8   PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
              +   + G ++++IDD    G T+K    ALK AGA  V +   S  LKD
Sbjct: 340 HSPIRDVIEGKRVVVIDDSIVRGTTSKYIVKALKSAGAKEVHMGISSPPLKD 391


>gi|313765352|gb|EFS36716.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL013PA1]
 gi|313792875|gb|EFS40942.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL110PA1]
 gi|313802672|gb|EFS43894.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL110PA2]
 gi|313806685|gb|EFS45192.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL087PA2]
 gi|313810882|gb|EFS48596.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL083PA1]
 gi|313814607|gb|EFS52321.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL025PA1]
 gi|313815241|gb|EFS52955.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL059PA1]
 gi|313817228|gb|EFS54942.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL046PA2]
 gi|313821710|gb|EFS59424.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL036PA1]
 gi|313824399|gb|EFS62113.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL036PA2]
 gi|313826756|gb|EFS64470.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL063PA1]
 gi|313828546|gb|EFS66260.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL063PA2]
 gi|313832001|gb|EFS69715.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL007PA1]
 gi|313834459|gb|EFS72173.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL056PA1]
 gi|313840308|gb|EFS78022.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL086PA1]
 gi|314916005|gb|EFS79836.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL005PA4]
 gi|314916910|gb|EFS80741.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL050PA1]
 gi|314921551|gb|EFS85382.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL050PA3]
 gi|314922161|gb|EFS85992.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL001PA1]
 gi|314926815|gb|EFS90646.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL036PA3]
 gi|314931125|gb|EFS94956.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL067PA1]
 gi|314954818|gb|EFS99224.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL027PA1]
 gi|314958984|gb|EFT03086.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL002PA1]
 gi|314961279|gb|EFT05380.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL002PA2]
 gi|314964293|gb|EFT08393.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL082PA1]
 gi|314965244|gb|EFT09343.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL082PA2]
 gi|314969393|gb|EFT13491.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL037PA1]
 gi|314974461|gb|EFT18556.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL053PA1]
 gi|314977349|gb|EFT21444.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL045PA1]
 gi|314980495|gb|EFT24589.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL072PA2]
 gi|314982381|gb|EFT26474.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL110PA3]
 gi|314985552|gb|EFT29644.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL005PA1]
 gi|314987508|gb|EFT31599.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL005PA2]
 gi|314989026|gb|EFT33117.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL005PA3]
 gi|315078691|gb|EFT50722.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL053PA2]
 gi|315081849|gb|EFT53825.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL078PA1]
 gi|315082658|gb|EFT54634.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL027PA2]
 gi|315086367|gb|EFT58343.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL002PA3]
 gi|315087615|gb|EFT59591.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL072PA1]
 gi|315092578|gb|EFT64554.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL110PA4]
 gi|315094004|gb|EFT65980.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL060PA1]
 gi|315097530|gb|EFT69506.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL038PA1]
 gi|315099749|gb|EFT71725.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL059PA2]
 gi|315101946|gb|EFT73922.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL046PA1]
 gi|315104564|gb|EFT76540.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL050PA2]
 gi|315106547|gb|EFT78523.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL030PA1]
 gi|315110335|gb|EFT82311.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL030PA2]
 gi|327329534|gb|EGE71294.1| ribose-phosphate pyrophosphokinase [Propionibacterium acnes
           HL103PA1]
 gi|327331616|gb|EGE73355.1| ribose-phosphate pyrophosphokinase [Propionibacterium acnes
           HL096PA2]
 gi|327333599|gb|EGE75319.1| ribose-phosphate pyrophosphokinase [Propionibacterium acnes
           HL096PA3]
 gi|327335124|gb|EGE76835.1| ribose-phosphate pyrophosphokinase [Propionibacterium acnes
           HL097PA1]
 gi|327445373|gb|EGE92027.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL013PA2]
 gi|327446987|gb|EGE93641.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL043PA1]
 gi|327449976|gb|EGE96630.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL043PA2]
 gi|327454820|gb|EGF01475.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL087PA3]
 gi|327455677|gb|EGF02332.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL083PA2]
 gi|327456834|gb|EGF03489.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL092PA1]
 gi|328755876|gb|EGF69492.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL087PA1]
 gi|328756659|gb|EGF70275.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL025PA2]
 gi|328758620|gb|EGF72236.1| ribose-phosphate diphosphokinase [Propionibacterium acnes HL020PA1]
 gi|328761747|gb|EGF75262.1| ribose-phosphate pyrophosphokinase [Propionibacterium acnes
           HL099PA1]
          Length = 310

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 23/52 (44%)

Query: 8   PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
              V   V G   LL+DD+  T  T   AA+ALKK GA  V        L D
Sbjct: 201 THEVVGEVEGKTCLLVDDMVDTAGTMCQAALALKKHGAKRVIAAATHPILSD 252


>gi|312867007|ref|ZP_07727218.1| amidophosphoribosyltransferase [Streptococcus parasanguinis F0405]
 gi|311097489|gb|EFQ55722.1| amidophosphoribosyltransferase [Streptococcus parasanguinis F0405]
          Length = 479

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 26/48 (54%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
            VS  V G ++++IDD    G T++     LK+AGA  V +   S +L
Sbjct: 343 AVSGVVKGKRVVMIDDSIVRGTTSRRIVKLLKEAGATEVHVAIASPAL 390


>gi|300721922|ref|YP_003711200.1| hypoxanthine phosphoribosyltransferase [Xenorhabdus nematophila
           ATCC 19061]
 gi|297628417|emb|CBJ88982.1| hypoxanthine phosphoribosyltransferase [Xenorhabdus nematophila
           ATCC 19061]
          Length = 179

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 10/49 (20%), Positives = 25/49 (51%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
             + + + + + G  +L+++D+  +G T K     L+  G  +++I T 
Sbjct: 81  VKILKDLDEDIRGKNVLIVEDIIDSGNTLKKIREILELRGPNSLAICTL 129


>gi|290890664|ref|ZP_06553734.1| hypothetical protein AWRIB429_1124 [Oenococcus oeni AWRIB429]
 gi|290479639|gb|EFD88293.1| hypothetical protein AWRIB429_1124 [Oenococcus oeni AWRIB429]
          Length = 503

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            + + V G  I+L+DD    G T+      LK AGA  V +   S + K
Sbjct: 349 AIKEVVNGKSIVLVDDSIVRGTTSMYIIRMLKDAGAKEVHVRIASPAFK 397


>gi|261821681|ref|YP_003259787.1| ribose-phosphate pyrophosphokinase [Pectobacterium wasabiae WPP163]
 gi|261605694|gb|ACX88180.1| ribose-phosphate pyrophosphokinase [Pectobacterium wasabiae WPP163]
          Length = 315

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|227328861|ref|ZP_03832885.1| ribose-phosphate pyrophosphokinase [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 312

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 203 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 251


>gi|254431071|ref|ZP_05044774.1| conserved hypothetical protein [Cyanobium sp. PCC 7001]
 gi|197625524|gb|EDY38083.1| conserved hypothetical protein [Cyanobium sp. PCC 7001]
          Length = 214

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 2   RNAFNVPQYVSKHVAGLK-ILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + AF+          G + +LL+DD+ TTGATA  AA +L++AG  T+ +   +R+
Sbjct: 153 QGAFHCLVSARADSRGRRPVLLLDDILTTGATACNAAASLEEAGWRTLGMACLART 208


>gi|187778539|ref|ZP_02995012.1| hypothetical protein CLOSPO_02134 [Clostridium sporogenes ATCC
           15579]
 gi|187772164|gb|EDU35966.1| hypothetical protein CLOSPO_02134 [Clostridium sporogenes ATCC
           15579]
          Length = 477

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 1/56 (1%)

Query: 4   AFNVP-QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           A +V    +  +V G ++++IDD    G T+K     L+KAGA  V     S  +K
Sbjct: 347 AVSVKLNPLKINVEGKRVVIIDDSIVRGTTSKRLVQTLRKAGAKEVHFRVSSPVVK 402


>gi|85059858|ref|YP_455560.1| ribose-phosphate pyrophosphokinase [Sodalis glossinidius str.
           'morsitans']
 gi|84780378|dbj|BAE75155.1| ribose-phosphate pyrophosphokinase [Sodalis glossinidius str.
           'morsitans']
          Length = 315

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|298252657|ref|ZP_06976451.1| hypoxanthine-guanine phosphoribosyltransferase [Gardnerella
           vaginalis 5-1]
 gi|297533021|gb|EFH71905.1| hypoxanthine-guanine phosphoribosyltransferase [Gardnerella
           vaginalis 5-1]
          Length = 164

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               V + +S  V G  +L+++D+  +G T       LK  GA +V +   
Sbjct: 62  GQITVREDLSTDVRGRDVLIVEDIVDSGRTLAWLVDELKGRGAASVKVFAL 112


>gi|150014991|ref|YP_001307245.1| hypoxanthine phosphoribosyltransferase [Clostridium beijerinckii
           NCIMB 8052]
 gi|149901456|gb|ABR32289.1| hypoxanthine phosphoribosyltransferase [Clostridium beijerinckii
           NCIMB 8052]
          Length = 179

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   + G  IL+++D+  TG T       LK   A ++ I+  
Sbjct: 77  GVVRILKDLDNSIEGKDILVVEDIVDTGVTLTYLLKYLKARKANSIEIVAL 127


>gi|315222832|ref|ZP_07864717.1| hypoxanthine phosphoribosyltransferase [Streptococcus anginosus
           F0211]
 gi|315188068|gb|EFU21798.1| hypoxanthine phosphoribosyltransferase [Streptococcus anginosus
           F0211]
          Length = 180

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 25/51 (49%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
              N+ + + + +AG  IL ++D+  TG T K      ++  A +V I T 
Sbjct: 78  GVINIIKDIDQDIAGRHILFVEDIIDTGKTLKSLCELFREKKAASVKIATL 128


>gi|330951109|gb|EGH51369.1| ribose-phosphate pyrophosphokinase [Pseudomonas syringae Cit 7]
          Length = 313

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 22/49 (44%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +L+DD+  T  T   AA ALK+ GA  V        L 
Sbjct: 205 HIIGDVEGRTCILVDDMVDTAGTLCHAAKALKEHGAAKVFAYCTHPVLS 253


>gi|325689366|gb|EGD31372.1| hypoxanthine phosphoribosyltransferase [Streptococcus sanguinis
           SK115]
 gi|332363618|gb|EGJ41399.1| hypoxanthine phosphoribosyltransferase [Streptococcus sanguinis
           SK1059]
          Length = 184

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
              NV + + + + G  IL ++D+  TG T K      K+  A +V I T 
Sbjct: 82  GVINVIKDIDQDITGRDILFVEDIIDTGQTLKNLCNLFKERNAASVKIATL 132


>gi|283455804|ref|YP_003360368.1| hypothetical protein BDP_0890 [Bifidobacterium dentium Bd1]
 gi|283102438|gb|ADB09544.1| Conserved hypothetical protein [Bifidobacterium dentium Bd1]
          Length = 239

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++    V   +   V G+ ++LIDD+ T+G T +     L++AGA  V++L  + +  
Sbjct: 170 LKGHVTVRSGI--DVRGVPVVLIDDIITSGTTMRRCVEVLQQAGATVVTVLALAYTPP 225


>gi|73749136|ref|YP_308375.1| putative comF family protein [Dehalococcoides sp. CBDB1]
 gi|147669898|ref|YP_001214716.1| amidophosphoribosyltransferase-like protein [Dehalococcoides sp.
           BAV1]
 gi|289433110|ref|YP_003462983.1| phosphoribosyltransferase [Dehalococcoides sp. GT]
 gi|73660852|emb|CAI83459.1| putative comF family protein [Dehalococcoides sp. CBDB1]
 gi|146270846|gb|ABQ17838.1| amidophosphoribosyltransferase-like protein [Dehalococcoides sp.
           BAV1]
 gi|288946830|gb|ADC74527.1| phosphoribosyltransferase [Dehalococcoides sp. GT]
          Length = 233

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 27/37 (72%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++++IDDV TTGAT    A  LK+AGA++V  LT +R
Sbjct: 195 RVIIIDDVATTGATLNACAATLKEAGALSVWGLTIAR 231


>gi|119775702|ref|YP_928442.1| ribose-phosphate pyrophosphokinase [Shewanella amazonensis SB2B]
 gi|119768202|gb|ABM00773.1| Ribose-phosphate diphosphokinase [Shewanella amazonensis SB2B]
          Length = 315

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 22/49 (44%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +++DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVEGRDCIIVDDMIDTGGTLCKAAEALKEHGANRVFAYATHPVFS 254


>gi|325695772|gb|EGD37671.1| hypoxanthine phosphoribosyltransferase [Streptococcus sanguinis
           SK150]
          Length = 184

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
              NV + + + + G  IL ++D+  TG T K      K+  A +V I T 
Sbjct: 82  GVINVIKDIDQDITGRDILFVEDIIDTGQTLKNLCNLFKERNAASVKIATL 132


>gi|322807195|emb|CBZ04769.1| amidophosphoribosyltransferase [Clostridium botulinum H04402 065]
          Length = 482

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 1/56 (1%)

Query: 4   AFNVP-QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           A +V    +  +V G ++++IDD    G T+K     L+KAGA  V     S  +K
Sbjct: 352 AVSVKLNSLKINVEGKRVVIIDDSIVRGTTSKRLVQILRKAGAKEVHFRVSSPVVK 407


>gi|241895852|ref|ZP_04783148.1| amidophosphoribosyltransferase [Weissella paramesenteroides ATCC
           33313]
 gi|241870895|gb|EER74646.1| amidophosphoribosyltransferase [Weissella paramesenteroides ATCC
           33313]
          Length = 488

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 18/49 (36%), Positives = 26/49 (53%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            V   VAG +++L+DD    G T++     LK AGA  V +   S +LK
Sbjct: 342 AVKGVVAGKRVVLVDDSIVRGTTSRRIVKLLKDAGAAEVHLRIASPALK 390


>gi|254491833|ref|ZP_05105012.1| hypothetical protein MDMS009_2168 [Methylophaga thiooxidans DMS010]
 gi|224463311|gb|EEF79581.1| hypothetical protein MDMS009_2168 [Methylophaga thiooxydans DMS010]
          Length = 198

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           MRNAF              + +IDDV T+G T   AA  +K+ G   + + T +R++ 
Sbjct: 143 MRNAFACRTKQLP----KHVAIIDDVMTSGYTVGEAAKIVKRQGVEVIEVWTIARAIS 196


>gi|104773658|ref|YP_618638.1| hypoxanthine-guanine phosphoribosyltransferase [Lactobacillus
           delbrueckii subsp. bulgaricus ATCC 11842]
 gi|116513653|ref|YP_812559.1| hypoxanthine-guanine phosphoribosyltransferase [Lactobacillus
           delbrueckii subsp. bulgaricus ATCC BAA-365]
 gi|103422739|emb|CAI97369.1| hypoxanthine-guanine phosphoribosyltransferase [Lactobacillus
           delbrueckii subsp. bulgaricus ATCC 11842]
 gi|116092968|gb|ABJ58121.1| hypoxanthine phosphoribosyltransferase [Lactobacillus delbrueckii
           subsp. bulgaricus ATCC BAA-365]
 gi|325125304|gb|ADY84634.1| Hypothetical conserved protein [Lactobacillus delbrueckii subsp.
           bulgaricus 2038]
          Length = 189

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 20/51 (39%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               V   +   V G  +L+++D+  TG T K     L   GA +V     
Sbjct: 80  GKITVTHDLEADVTGRDVLIVEDIVDTGLTLKFMKDELLSRGANSVKCCVL 130


>gi|333031104|ref|ZP_08459165.1| ribose-phosphate pyrophosphokinase [Bacteroides coprosuis DSM
           18011]
 gi|332741701|gb|EGJ72183.1| ribose-phosphate pyrophosphokinase [Bacteroides coprosuis DSM
           18011]
          Length = 312

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 14/47 (29%), Positives = 23/47 (48%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
             V G  ++L+DD+  T  T   AA  + +AGA +V  +     + D
Sbjct: 209 GDVKGKNVILVDDIVDTAGTITKAANVMIEAGAKSVRAIASHCVMSD 255


>gi|238062582|ref|ZP_04607291.1| ribose-phosphate pyrophosphokinase [Micromonospora sp. ATCC 39149]
 gi|237884393|gb|EEP73221.1| ribose-phosphate pyrophosphokinase [Micromonospora sp. ATCC 39149]
          Length = 326

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 26/53 (49%)

Query: 7   VPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           V   V   V G   L++DD+  TG T   AA  L+++GA  + + +    L D
Sbjct: 213 VANRVVGEVEGRVCLIVDDMIDTGGTITKAADILRESGAAEIVVASTHALLSD 265


>gi|168183606|ref|ZP_02618270.1| hypoxanthine phosphoribosyltransferase [Clostridium botulinum Bf]
 gi|170760637|ref|YP_001788866.1| hypoxanthine phosphoribosyltransferase [Clostridium botulinum A3
           str. Loch Maree]
 gi|237796987|ref|YP_002864539.1| hypoxanthine phosphoribosyltransferase [Clostridium botulinum Ba4
           str. 657]
 gi|169407626|gb|ACA56037.1| hypoxanthine phosphoribosyltransferase [Clostridium botulinum A3
           str. Loch Maree]
 gi|182673164|gb|EDT85125.1| hypoxanthine phosphoribosyltransferase [Clostridium botulinum Bf]
 gi|229261453|gb|ACQ52486.1| hypoxanthine phosphoribosyltransferase [Clostridium botulinum Ba4
           str. 657]
          Length = 181

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 9/51 (17%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   + G  IL+++D+  +G T K     L+     +++I   
Sbjct: 80  GVVRILKDLDFEIEGKDILIVEDIIDSGITLKYLLENLRARKPASINIACL 130


>gi|152992638|ref|YP_001358359.1| ribose-phosphate pyrophosphokinase [Sulfurovum sp. NBC37-1]
 gi|151424499|dbj|BAF72002.1| ribose-phosphate pyrophosphokinase [Sulfurovum sp. NBC37-1]
          Length = 311

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 21/46 (45%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
             V G  ++LIDD+  T  T   AA ALK  GA +V        L 
Sbjct: 207 GDVEGKDVILIDDMVDTAGTMVKAAAALKNLGATSVMACCTHPVLS 252


>gi|319404036|emb|CBI77624.1| amidophosphoribosyltransferase [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 497

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 22/50 (44%), Gaps = 3/50 (6%)

Query: 4   AFNV---PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
           AF V          + G +++LIDD    G T+      L+ AGA  V +
Sbjct: 349 AFGVKLKHSANRSIIEGKRVILIDDSIVRGTTSVKIVRMLRNAGAKEVHM 398


>gi|262394976|ref|YP_003286830.1| ribose-phosphate pyrophosphokinase [Vibrio sp. Ex25]
 gi|262338570|gb|ACY52365.1| ribose-phosphate pyrophosphokinase [Vibrio sp. Ex25]
          Length = 314

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 21/48 (43%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +   V G   +++DD+  TG T   AA ALK+ GA  V          
Sbjct: 207 LIGDVEGRDCVIVDDMIDTGGTLCKAAEALKERGAKRVFAYATHAVFS 254


>gi|251777597|ref|ZP_04820517.1| hypoxanthine phosphoribosyltransferase [Clostridium botulinum E1
           str. 'BoNT E Beluga']
 gi|243081912|gb|EES47802.1| hypoxanthine phosphoribosyltransferase [Clostridium botulinum E1
           str. 'BoNT E Beluga']
          Length = 173

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 21/51 (41%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               V   +  ++ G  +L++DD+  TG T       +K  GA +V     
Sbjct: 77  GKVKVINDIPDNIEGYDVLIVDDIIDTGITMNFVVDHVKNLGAASVKTCVL 127


>gi|229588278|ref|YP_002870397.1| ribose-phosphate pyrophosphokinase [Pseudomonas fluorescens SBW25]
 gi|229360144|emb|CAY47001.1| ribose-phosphate pyrophosphokinase [Pseudomonas fluorescens SBW25]
 gi|323388153|gb|ADX60349.1| ribose-phosphate pyrophosphokinase [Pseudomonas fluorescens]
          Length = 313

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 22/49 (44%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +L+DD+  T  T   AA ALK+ GA  V        L 
Sbjct: 205 HIIGDVEGRTCILVDDMVDTAGTLCHAAKALKEHGAAKVFAYCTHPVLS 253


>gi|197302374|ref|ZP_03167431.1| hypothetical protein RUMLAC_01103 [Ruminococcus lactaris ATCC
           29176]
 gi|197298553|gb|EDY33096.1| hypothetical protein RUMLAC_01103 [Ruminococcus lactaris ATCC
           29176]
          Length = 175

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 7/51 (13%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + + + + G  +L+++D+  +G T       L++    ++ + T 
Sbjct: 76  GVVRIAKDLDESIEGKDVLIVEDIIDSGNTLYYLMDVLQRRKPASLHLCTL 126


>gi|28868319|ref|NP_790938.1| ribose-phosphate pyrophosphokinase [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|71733732|ref|YP_273263.1| ribose-phosphate pyrophosphokinase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|289627923|ref|ZP_06460877.1| ribose-phosphate pyrophosphokinase [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|298485676|ref|ZP_07003755.1| Ribose-phosphate pyrophosphokinase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|302134873|ref|ZP_07260863.1| ribose-phosphate pyrophosphokinase [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|32469694|sp|Q888C6|KPRS_PSESM RecName: Full=Ribose-phosphate pyrophosphokinase; Short=RPPK;
           AltName: Full=Phosphoribosyl pyrophosphate synthase;
           Short=P-Rib-PP synthase; Short=PRPP synthase
 gi|28851556|gb|AAO54633.1| ribose-phosphate pyrophosphokinase [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|71554285|gb|AAZ33496.1| Ribose-phosphate pyrophosphokinase (RPPK)
           (Phosphoribosylpyrophosphate synthetase) (P-Rib-PP
           synthetase) (PRPP synthetase) [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|298159702|gb|EFI00744.1| Ribose-phosphate pyrophosphokinase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320327396|gb|EFW83410.1| ribose-phosphate pyrophosphokinase [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330868893|gb|EGH03602.1| ribose-phosphate pyrophosphokinase [Pseudomonas syringae pv.
           aesculi str. 0893_23]
 gi|330873312|gb|EGH07461.1| ribose-phosphate pyrophosphokinase [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330881887|gb|EGH16036.1| ribose-phosphate pyrophosphokinase [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330887869|gb|EGH20530.1| ribose-phosphate pyrophosphokinase [Pseudomonas syringae pv. mori
           str. 301020]
 gi|330967421|gb|EGH67681.1| ribose-phosphate pyrophosphokinase [Pseudomonas syringae pv.
           actinidiae str. M302091]
 gi|330988610|gb|EGH86713.1| ribose-phosphate pyrophosphokinase [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331008862|gb|EGH88918.1| ribose-phosphate pyrophosphokinase [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|331018127|gb|EGH98183.1| ribose-phosphate pyrophosphokinase [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 313

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 22/49 (44%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +L+DD+  T  T   AA ALK+ GA  V        L 
Sbjct: 205 HIIGDVEGRTCILVDDMVDTAGTLCHAAKALKEHGAAKVFAYCTHPVLS 253


>gi|313884474|ref|ZP_07818235.1| hypoxanthine phosphoribosyltransferase [Eremococcus coleocola
           ACS-139-V-Col8]
 gi|312620258|gb|EFR31686.1| hypoxanthine phosphoribosyltransferase [Eremococcus coleocola
           ACS-139-V-Col8]
          Length = 180

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 10/51 (19%), Positives = 21/51 (41%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   + G  +L+++D+  TG T        K   A +V + T 
Sbjct: 78  GEVKIIKDLDTRLEGRHVLVVEDIIDTGRTLNYLVELFKYRKAASVKVCTL 128


>gi|212637910|ref|YP_002314430.1| Hypoxanthine-guanine phosphoribosyltransferase [Anoxybacillus
           flavithermus WK1]
 gi|212559390|gb|ACJ32445.1| Hypoxanthine-guanine phosphoribosyltransferase [Anoxybacillus
           flavithermus WK1]
          Length = 188

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + ++  V G  +L+I+D+  +G T    A   +   A ++ I+T 
Sbjct: 86  GEVKILKDLNTSVEGRDVLIIEDIIDSGLTLSYLADLFRYRKAKSIKIVTL 136


>gi|119473411|ref|ZP_01614955.1| ribose-phosphate pyrophosphokinase [Alteromonadales bacterium TW-7]
 gi|119444479|gb|EAW25805.1| ribose-phosphate pyrophosphokinase [Alteromonadales bacterium TW-7]
          Length = 304

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +++DD+  TG T   AA ALK+ GA  V        L 
Sbjct: 206 HIIGDVEGRDCIIVDDMIDTGGTLCKAAEALKEHGAKRVFAYATHPILS 254


>gi|56961887|ref|YP_173609.1| hypoxanthine-guanine phosphoribosyltransferase [Bacillus clausii
           KSM-K16]
 gi|56908121|dbj|BAD62648.1| hypoxanthine-guanine phosphoribosyltransferase [Bacillus clausii
           KSM-K16]
          Length = 179

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 10/51 (19%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V G  +L+++D+  +G T        K   A +V ++T 
Sbjct: 77  GEVKIVKDLDTKVEGRDVLIVEDIIDSGLTLSYLIELFKYRKAKSVKVVTL 127


>gi|188534019|ref|YP_001907816.1| ribose-phosphate pyrophosphokinase [Erwinia tasmaniensis Et1/99]
 gi|188029061|emb|CAO96929.1| Ribose-phosphate pyrophosphokinase [Erwinia tasmaniensis Et1/99]
          Length = 332

 Score = 60.3 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 223 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 271


>gi|184154696|ref|YP_001843036.1| hypoxanthine-guanine phosphoribosyltransferase [Lactobacillus
           fermentum IFO 3956]
 gi|227514336|ref|ZP_03944385.1| hypoxanthine phosphoribosyltransferase [Lactobacillus fermentum
           ATCC 14931]
 gi|183226040|dbj|BAG26556.1| hypoxanthine-guanine phosphoribosyltransferase [Lactobacillus
           fermentum IFO 3956]
 gi|227087308|gb|EEI22620.1| hypoxanthine phosphoribosyltransferase [Lactobacillus fermentum
           ATCC 14931]
          Length = 182

 Score = 60.3 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 25/51 (49%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               +   +   +AG  +++++D+  TG T K     L+  GA ++ + TF
Sbjct: 77  GTVKLLHDLKHSIAGKDVIIVEDIVDTGRTLKFLMELLEGRGATSIKVCTF 127


>gi|118587335|ref|ZP_01544761.1| phosphoribosylpyrophosphate amidotransferase [Oenococcus oeni ATCC
           BAA-1163]
 gi|118432159|gb|EAV38899.1| phosphoribosylpyrophosphate amidotransferase [Oenococcus oeni ATCC
           BAA-1163]
          Length = 503

 Score = 60.3 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            + + V G  I+L+DD    G T+      LK AGA  V +   S + K
Sbjct: 349 AIKEVVNGKSIVLVDDSIVRGTTSMYIIRMLKDAGAKEVHVRIASPAFK 397


>gi|66044197|ref|YP_234038.1| ribose-phosphate pyrophosphokinase [Pseudomonas syringae pv.
           syringae B728a]
 gi|331092950|ref|ZP_04588183.2| ribose-phosphate pyrophosphokinase [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|63254904|gb|AAY36000.1| Ribose-phosphate pyrophosphokinase [Pseudomonas syringae pv.
           syringae B728a]
 gi|330899760|gb|EGH31179.1| ribose-phosphate pyrophosphokinase [Pseudomonas syringae pv.
           japonica str. M301072PT]
 gi|330941707|gb|EGH44464.1| ribose-phosphate pyrophosphokinase [Pseudomonas syringae pv. pisi
           str. 1704B]
 gi|330961722|gb|EGH61982.1| ribose-phosphate pyrophosphokinase [Pseudomonas syringae pv.
           maculicola str. ES4326]
 gi|330972809|gb|EGH72875.1| ribose-phosphate pyrophosphokinase [Pseudomonas syringae pv. aceris
           str. M302273PT]
 gi|331022577|gb|EGI02634.1| ribose-phosphate pyrophosphokinase [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 313

 Score = 60.3 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 22/49 (44%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +L+DD+  T  T   AA ALK+ GA  V        L 
Sbjct: 205 HIIGDVEGRTCILVDDMVDTAGTLCHAAKALKEHGAAKVFAYCTHPVLS 253


>gi|308094559|ref|ZP_05890176.2| ComF family protein [Vibrio parahaemolyticus AN-5034]
 gi|308089775|gb|EFO39470.1| ComF family protein [Vibrio parahaemolyticus AN-5034]
          Length = 232

 Score = 60.3 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF + Q    +     + ++DDV TTG+T +     L + G  TV I    R+
Sbjct: 175 LKGAFTLNQPPKYN----HVAIVDDVVTTGSTVRQLCHLLLEVGVETVDIYCICRT 226


>gi|291617191|ref|YP_003519933.1| Prs [Pantoea ananatis LMG 20103]
 gi|291152221|gb|ADD76805.1| Prs [Pantoea ananatis LMG 20103]
 gi|327393646|dbj|BAK11068.1| ribose-phosphate pyrophosphokinase Prs [Pantoea ananatis AJ13355]
          Length = 315

 Score = 60.3 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|260772286|ref|ZP_05881202.1| ribose-phosphate pyrophosphokinase [Vibrio metschnikovii CIP 69.14]
 gi|260611425|gb|EEX36628.1| ribose-phosphate pyrophosphokinase [Vibrio metschnikovii CIP 69.14]
          Length = 314

 Score = 60.3 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 21/48 (43%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +   V G   +++DD+  TG T   AA ALK+ GA  V          
Sbjct: 207 LIGDVEGRDCVIVDDMIDTGGTLCKAAEALKERGAKRVFAYATHAVFS 254


>gi|226309709|ref|YP_002769603.1| hypoxanthine-guanine phosphoribosyltransferase [Brevibacillus
           brevis NBRC 100599]
 gi|226092657|dbj|BAH41099.1| hypoxanthine-guanine phosphoribosyltransferase [Brevibacillus
           brevis NBRC 100599]
          Length = 179

 Score = 60.3 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 9/51 (17%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V    +L+++D+  +G T       L+   A +V ++T 
Sbjct: 77  GMVKILKDLDTSVENRHVLVVEDIMDSGLTLSRLVELLRHREAASVKVVTL 127


>gi|119505551|ref|ZP_01627623.1| K+-dependent Na+/Ca+ exchanger related-protein [marine gamma
           proteobacterium HTCC2080]
 gi|119458660|gb|EAW39763.1| K+-dependent Na+/Ca+ exchanger related-protein [marine gamma
           proteobacterium HTCC2080]
          Length = 266

 Score = 60.3 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/39 (41%), Positives = 22/39 (56%)

Query: 18  LKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
             +L+IDDV TTG T +  A  L KAGA  +     +R+
Sbjct: 217 QSVLIIDDVVTTGNTLEAVAATLAKAGATRIDAWCLARA 255


>gi|28896921|ref|NP_796526.1| ComF-like protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|153837883|ref|ZP_01990550.1| competence protein F [Vibrio parahaemolyticus AQ3810]
 gi|260365892|ref|ZP_05778386.1| ComF family protein [Vibrio parahaemolyticus K5030]
 gi|260895530|ref|ZP_05904026.1| ComF family protein [Vibrio parahaemolyticus Peru-466]
 gi|308126565|ref|ZP_05910949.2| ComF family protein [Vibrio parahaemolyticus AQ4037]
 gi|28805129|dbj|BAC58410.1| ComF-related protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|149748746|gb|EDM59591.1| competence protein F [Vibrio parahaemolyticus AQ3810]
 gi|308088554|gb|EFO38249.1| ComF family protein [Vibrio parahaemolyticus Peru-466]
 gi|308109597|gb|EFO47137.1| ComF family protein [Vibrio parahaemolyticus AQ4037]
 gi|308113432|gb|EFO50972.1| ComF family protein [Vibrio parahaemolyticus K5030]
          Length = 241

 Score = 60.3 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF + Q    +     + ++DDV TTG+T +     L + G  TV I    R+
Sbjct: 184 LKGAFTLNQPPKYN----HVAIVDDVVTTGSTVRQLCHLLLEVGVETVDIYCICRT 235


>gi|332522762|ref|ZP_08399014.1| hypoxanthine phosphoribosyltransferase [Streptococcus porcinus str.
           Jelinkova 176]
 gi|332314026|gb|EGJ27011.1| hypoxanthine phosphoribosyltransferase [Streptococcus porcinus str.
           Jelinkova 176]
          Length = 180

 Score = 60.3 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + V  ++ G  IL ++D+  TG T K      K   A +V I T 
Sbjct: 78  GEVKILKDVDTNIEGRDILFVEDIIDTGRTLKYLRDMFKYRKANSVKIATL 128


>gi|295395570|ref|ZP_06805764.1| hypoxanthine phosphoribosyltransferase [Brevibacterium mcbrellneri
           ATCC 49030]
 gi|294971589|gb|EFG47470.1| hypoxanthine phosphoribosyltransferase [Brevibacterium mcbrellneri
           ATCC 49030]
          Length = 183

 Score = 60.3 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 12/53 (22%), Positives = 23/53 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + +   +    +L+++D+  +G T       LK  GA +V I T  R
Sbjct: 82  GVVRILKDLDTDLKDQHVLIVEDIIDSGLTLSWLLSNLKSRGAASVEICTMLR 134


>gi|320548074|ref|ZP_08042354.1| amidophosphoribosyltransferase [Streptococcus equinus ATCC 9812]
 gi|320447316|gb|EFW88079.1| amidophosphoribosyltransferase [Streptococcus equinus ATCC 9812]
          Length = 487

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 13/42 (30%), Positives = 23/42 (54%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51
            VS  V G +++++DD    G T++     L++AGA  V + 
Sbjct: 343 AVSGVVKGKRVVMVDDSIVRGTTSRRIVRLLREAGATEVHVA 384


>gi|292488084|ref|YP_003530961.1| phosphoribosylpyrophosphate synthetase [Erwinia amylovora CFBP1430]
 gi|292899295|ref|YP_003538664.1| ribose-phosphate pyrophosphokinase [Erwinia amylovora ATCC 49946]
 gi|291199143|emb|CBJ46257.1| ribose-phosphate pyrophosphokinase [Erwinia amylovora ATCC 49946]
 gi|291553508|emb|CBA20553.1| Phosphoribosylpyrophosphate synthetase [Erwinia amylovora CFBP1430]
 gi|312172215|emb|CBX80472.1| Phosphoribosylpyrophosphate synthetase [Erwinia amylovora ATCC
           BAA-2158]
          Length = 341

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 232 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 280


>gi|262281631|ref|ZP_06059400.1| hypoxanthine phosphoribosyltransferase [Streptococcus sp.
           2_1_36FAA]
 gi|262262085|gb|EEY80782.1| hypoxanthine phosphoribosyltransferase [Streptococcus sp.
           2_1_36FAA]
          Length = 180

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
              N+ + V + VAG  IL I+D+  TG T K      K   A +V I T 
Sbjct: 78  GVINIKKDVDQDVAGRDILFIEDIIDTGKTLKSLCEMFKDRNAASVKIATL 128


>gi|268592704|ref|ZP_06126925.1| ribose-phosphate pyrophosphokinase [Providencia rettgeri DSM 1131]
 gi|291311847|gb|EFE52300.1| ribose-phosphate pyrophosphokinase [Providencia rettgeri DSM 1131]
          Length = 312

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V+G   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 203 HIIGDVSGRDCILVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 251


>gi|195977169|ref|YP_002122413.1| hypoxanthine-guanine phosphoribosyltransferase protein Hpt
           [Streptococcus equi subsp. zooepidemicus MGCS10565]
 gi|225867631|ref|YP_002743579.1| hypoxanthine-guanine phosphoribosyltransferase [Streptococcus equi
           subsp. zooepidemicus]
 gi|225869501|ref|YP_002745448.1| hypoxanthine-guanine phosphoribosyltransferase [Streptococcus equi
           subsp. equi 4047]
 gi|195973874|gb|ACG61400.1| hypoxanthine-guanine phosphoribosyltransferase protein Hpt
           [Streptococcus equi subsp. zooepidemicus MGCS10565]
 gi|225698905|emb|CAW91897.1| hypoxanthine-guanine phosphoribosyltransferase [Streptococcus equi
           subsp. equi 4047]
 gi|225700907|emb|CAW97576.1| hypoxanthine-guanine phosphoribosyltransferase [Streptococcus equi
           subsp. zooepidemicus]
          Length = 180

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + V  ++ G  ++ ++D+  TG T K      K   A +V I+T 
Sbjct: 78  GEVKILKDVDTNIEGRDVIFVEDIIDTGRTLKYLRDMFKYRKANSVKIITL 128


>gi|153216762|ref|ZP_01950602.1| hypoxanthine phosphoribosyltransferase [Vibrio cholerae 1587]
 gi|124114150|gb|EAY32970.1| hypoxanthine phosphoribosyltransferase [Vibrio cholerae 1587]
          Length = 177

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 10/49 (20%), Positives = 20/49 (40%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
             + + +   + G  +LL++D+  TG T       L      ++ I T 
Sbjct: 79  VRILKDLDDDIKGKDVLLVEDIIDTGNTLNKVKEILALREPKSIRICTL 127


>gi|37679110|ref|NP_933719.1| ribose-phosphate pyrophosphokinase [Vibrio vulnificus YJ016]
 gi|320157143|ref|YP_004189522.1| ribose-phosphate pyrophosphokinase [Vibrio vulnificus MO6-24/O]
 gi|326423675|ref|NP_759266.2| ribose-phosphate pyrophosphokinase [Vibrio vulnificus CMCP6]
 gi|32469718|sp|Q8DFF5|KPRS_VIBVU RecName: Full=Ribose-phosphate pyrophosphokinase; Short=RPPK;
           AltName: Full=Phosphoribosyl pyrophosphate synthase;
           Short=P-Rib-PP synthase; Short=PRPP synthase
 gi|46396298|sp|Q7MMZ1|KPRS_VIBVY RecName: Full=Ribose-phosphate pyrophosphokinase; Short=RPPK;
           AltName: Full=Phosphoribosyl pyrophosphate synthase;
           Short=P-Rib-PP synthase; Short=PRPP synthase
 gi|37197852|dbj|BAC93690.1| phosphoribosylpyrophosphate synthetase [Vibrio vulnificus YJ016]
 gi|319932455|gb|ADV87319.1| ribose-phosphate pyrophosphokinase [Vibrio vulnificus MO6-24/O]
 gi|319999030|gb|AAO08793.2| Ribose-phosphate pyrophosphokinase [Vibrio vulnificus CMCP6]
          Length = 314

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 21/48 (43%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +   V G   +++DD+  TG T   AA ALK+ GA  V          
Sbjct: 207 LIGDVEGRDCVIVDDMIDTGGTLCKAAEALKERGAKRVFAYATHAVFS 254


>gi|329948199|ref|ZP_08295071.1| hypoxanthine phosphoribosyltransferase [Actinomyces sp. oral taxon
           170 str. F0386]
 gi|328522932|gb|EGF50037.1| hypoxanthine phosphoribosyltransferase [Actinomyces sp. oral taxon
           170 str. F0386]
          Length = 190

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/53 (26%), Positives = 23/53 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + +   V G  IL+++D+  +G T       L   GA +V I T  R
Sbjct: 88  GVVRILKDLDTDVTGRDILIVEDIIDSGLTLSWLLGNLSSRGAASVEIATLLR 140


>gi|320155382|ref|YP_004187761.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio vulnificus
           MO6-24/O]
 gi|319930694|gb|ADV85558.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio vulnificus
           MO6-24/O]
          Length = 169

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 9/49 (18%), Positives = 20/49 (40%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
             + + +   + G  +L+++D+  TG T       L      ++ I T 
Sbjct: 72  VRILKDLDDDIKGKDVLIVEDIIDTGNTLNKIKEILSLREPKSIEICTL 120


>gi|296131679|ref|YP_003638926.1| ribose-phosphate pyrophosphokinase [Thermincola sp. JR]
 gi|296030257|gb|ADG81025.1| ribose-phosphate pyrophosphokinase [Thermincola potens JR]
          Length = 315

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 13/46 (28%), Positives = 18/46 (39%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
             V G  +++IDD+  T  T    A AL   GA  +        L 
Sbjct: 211 GDVKGKTVIMIDDIIDTAGTITQGAQALLDRGAKEIYCCCTHPVLS 256


>gi|227514243|ref|ZP_03944292.1| amidophosphoribosyltransferase [Lactobacillus fermentum ATCC 14931]
 gi|260663772|ref|ZP_05864659.1| amidophosphoribosyltransferase [Lactobacillus fermentum 28-3-CHN]
 gi|227087407|gb|EEI22719.1| amidophosphoribosyltransferase [Lactobacillus fermentum ATCC 14931]
 gi|260551721|gb|EEX24838.1| amidophosphoribosyltransferase [Lactobacillus fermentum 28-3-CHN]
          Length = 487

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 23/42 (54%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51
            V   V G +++++DD    G T+K     L++AGA  V +L
Sbjct: 343 AVRGVVEGKRVIVVDDSIVRGTTSKQIVQMLRRAGAKEVHLL 384


>gi|224826043|ref|ZP_03699146.1| competence protein F [Lutiella nitroferrum 2002]
 gi|224601680|gb|EEG07860.1| competence protein F [Lutiella nitroferrum 2002]
          Length = 236

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++AF V + +     GL I ++DDV T+GAT    A  LKK GA  V     +R++ 
Sbjct: 181 KHAFGVKRCLD----GLCIAIVDDVATSGATLSALAATLKKQGAKRVEAWVLARAIS 233


>gi|213962444|ref|ZP_03390706.1| ribose-phosphate pyrophosphokinase [Capnocytophaga sputigena Capno]
 gi|213954770|gb|EEB66090.1| ribose-phosphate pyrophosphokinase [Capnocytophaga sputigena Capno]
          Length = 314

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            +   V G  ++L+DD+  T  T   AA  +K  GA++V  +     L 
Sbjct: 208 ELIGDVEGKNVVLVDDMVDTAGTLVKAAQLMKDRGAVSVRAVATHPILS 256


>gi|156972937|ref|YP_001443844.1| amidophosphoribosyltransferase [Vibrio harveyi ATCC BAA-1116]
 gi|156524531|gb|ABU69617.1| hypothetical protein VIBHAR_00615 [Vibrio harveyi ATCC BAA-1116]
          Length = 185

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/56 (25%), Positives = 26/56 (46%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF +       V    + ++DDV TTG+T +     L + G  ++ I    R+
Sbjct: 128 LQGAFAL----QGEVDFSHVAIVDDVVTTGSTVRQLCHLLLEVGVESIDIYCICRT 179


>gi|153833895|ref|ZP_01986562.1| competence protein F [Vibrio harveyi HY01]
 gi|148869733|gb|EDL68710.1| competence protein F [Vibrio harveyi HY01]
          Length = 241

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/56 (25%), Positives = 26/56 (46%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF +       V    + ++DDV TTG+T +     L + G  ++ I    R+
Sbjct: 184 LQGAFAL----QGEVDFSHVAIVDDVVTTGSTVRQLCHLLLEVGVESIDIYCICRT 235


>gi|119944672|ref|YP_942352.1| ribose-phosphate pyrophosphokinase [Psychromonas ingrahamii 37]
 gi|119863276|gb|ABM02753.1| ribose-phosphate pyrophosphokinase [Psychromonas ingrahamii 37]
          Length = 314

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 24/49 (48%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +++DD+  TG T   AA+ALK+ GA +V          
Sbjct: 206 HLIGDVEGRNCIIVDDMIDTGGTLCQAALALKERGASSVYAYATHAVFS 254


>gi|156933672|ref|YP_001437588.1| ribose-phosphate pyrophosphokinase [Cronobacter sakazakii ATCC
           BAA-894]
 gi|156531926|gb|ABU76752.1| hypothetical protein ESA_01494 [Cronobacter sakazakii ATCC BAA-894]
          Length = 321

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 212 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 260


>gi|159036390|ref|YP_001535643.1| ribose-phosphate pyrophosphokinase [Salinispora arenicola CNS-205]
 gi|157915225|gb|ABV96652.1| ribose-phosphate pyrophosphokinase [Salinispora arenicola CNS-205]
          Length = 326

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 25/53 (47%)

Query: 7   VPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           V   V   V G   L++DD+  TG T   AA  LK++GA  + + +      D
Sbjct: 213 VANRVVGEVEGRVCLIVDDMIDTGGTITKAADILKESGAAEIIVASTHALFSD 265


>gi|187731868|ref|YP_001879990.1| ribose-phosphate pyrophosphokinase [Shigella boydii CDC 3083-94]
 gi|86516946|gb|ABC98165.1| PrsA [Shigella boydii]
 gi|86516948|gb|ABC98166.1| PrsA [Shigella boydii]
 gi|86516968|gb|ABC98176.1| PrsA [Shigella boydii]
 gi|86516972|gb|ABC98178.1| PrsA [Shigella boydii]
 gi|86516976|gb|ABC98180.1| PrsA [Shigella boydii]
 gi|86516994|gb|ABC98189.1| PrsA [Shigella dysenteriae]
 gi|187428860|gb|ACD08134.1| ribose-phosphate pyrophosphokinase [Shigella boydii CDC 3083-94]
          Length = 315

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|28209971|ref|NP_780915.1| hypoxanthine-guanine phosphoribosyltransferase [Clostridium tetani
           E88]
 gi|28202406|gb|AAO34852.1| hypoxanthine-guanine phosphoribosyltransferase [Clostridium tetani
           E88]
          Length = 181

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 7/51 (13%), Positives = 21/51 (41%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   +    +L+++D+  +G T +     LK     ++ I+  
Sbjct: 80  GVVRILKDLDFEIENRDVLIVEDIVDSGVTLRYLVDYLKGRKPASIEIVCL 130


>gi|28211841|ref|NP_782785.1| hypoxanthine-guanine phosphoribosyltransferase [Clostridium tetani
           E88]
 gi|28204283|gb|AAO36722.1| hypoxanthine-guanine phosphoribosyltransferase [Clostridium tetani
           E88]
          Length = 178

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 21/51 (41%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               V   +   + G+ +L++DD+  TG T       +K  GA +V     
Sbjct: 81  GKVKVVNDIPDDIKGMDVLIVDDIVDTGITMDFVKNHVKSLGANSVKSCVL 131


>gi|14590171|ref|NP_142236.1| amidophosphoribosyltransferase [Pyrococcus horikoshii OT3]
 gi|6647708|sp|O57979|PUR1_PYRHO RecName: Full=Amidophosphoribosyltransferase; Short=ATase; AltName:
           Full=Glutamine phosphoribosylpyrophosphate
           amidotransferase; Short=GPATase; Flags: Precursor
 gi|3256629|dbj|BAA29312.1| 449aa long hypothetical amidophosphoribosyltransferase [Pyrococcus
           horikoshii OT3]
          Length = 449

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/41 (34%), Positives = 21/41 (51%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
            V + + G +I+L+DD    G T K     L+ AGA  V +
Sbjct: 332 PVKEVIKGRRIVLVDDSIVRGTTMKNIVKMLRDAGAREVHV 372


>gi|67920504|ref|ZP_00514024.1| conserved hypothetical protein [Crocosphaera watsonii WH 8501]
 gi|67857988|gb|EAM53227.1| conserved hypothetical protein [Crocosphaera watsonii WH 8501]
          Length = 219

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 30/53 (56%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           ++ AF + + + KH     +LL+DD+YTTG T K AA  L+  G   + ++  
Sbjct: 161 IKGAFKLGKTLEKHSLSRPVLLVDDIYTTGTTFKEAAKILRDNGIKVLGVVAV 213


>gi|325917189|ref|ZP_08179416.1| putative amidophosphoribosyltransferase [Xanthomonas vesicatoria
           ATCC 35937]
 gi|325536579|gb|EGD08348.1| putative amidophosphoribosyltransferase [Xanthomonas vesicatoria
           ATCC 35937]
          Length = 241

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 5/56 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R+AF     +        + L+DDV TTGAT   AA AL++AG   V     +R 
Sbjct: 190 LRDAFIARGALPA-----HVALVDDVMTTGATLHAAAQALRRAGVQRVDAWVCARV 240


>gi|15642182|ref|NP_231814.1| ribose-phosphate pyrophosphokinase [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|147673671|ref|YP_001217699.1| ribose-phosphate pyrophosphokinase [Vibrio cholerae O395]
 gi|227082308|ref|YP_002810859.1| ribose-phosphate pyrophosphokinase [Vibrio cholerae M66-2]
 gi|229507739|ref|ZP_04397244.1| ribose-phosphate pyrophosphokinase [Vibrio cholerae BX 330286]
 gi|229512025|ref|ZP_04401504.1| ribose-phosphate pyrophosphokinase [Vibrio cholerae B33]
 gi|229513829|ref|ZP_04403291.1| ribose-phosphate pyrophosphokinase [Vibrio cholerae TMA 21]
 gi|229519161|ref|ZP_04408604.1| ribose-phosphate pyrophosphokinase [Vibrio cholerae RC9]
 gi|229522134|ref|ZP_04411551.1| ribose-phosphate pyrophosphokinase [Vibrio cholerae TM 11079-80]
 gi|229524179|ref|ZP_04413584.1| ribose-phosphate pyrophosphokinase [Vibrio cholerae bv. albensis
           VL426]
 gi|229528810|ref|ZP_04418200.1| ribose-phosphate pyrophosphokinase [Vibrio cholerae 12129(1)]
 gi|229607284|ref|YP_002877932.1| ribose-phosphate pyrophosphokinase [Vibrio cholerae MJ-1236]
 gi|254291414|ref|ZP_04962207.1| ribose-phosphate pyrophosphokinase [Vibrio cholerae AM-19226]
 gi|254849262|ref|ZP_05238612.1| ribose-phosphate pyrophosphokinase [Vibrio cholerae MO10]
 gi|255745088|ref|ZP_05419037.1| ribose-phosphate pyrophosphokinase [Vibrio cholera CIRS 101]
 gi|261209910|ref|ZP_05924211.1| ribose-phosphate pyrophosphokinase [Vibrio sp. RC341]
 gi|262404528|ref|ZP_06081083.1| ribose-phosphate pyrophosphokinase [Vibrio sp. RC586]
 gi|297582076|ref|ZP_06943995.1| ribose-phosphate pyrophosphokinase [Vibrio cholerae RC385]
 gi|24418545|sp|Q9KQ22|KPRS_VIBCH RecName: Full=Ribose-phosphate pyrophosphokinase; Short=RPPK;
           AltName: Full=Phosphoribosyl pyrophosphate synthase;
           Short=P-Rib-PP synthase; Short=PRPP synthase
 gi|9656737|gb|AAF95328.1| ribose-phosphate pyrophosphokinase [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|146315554|gb|ABQ20093.1| ribose-phosphate pyrophosphokinase [Vibrio cholerae O395]
 gi|150422744|gb|EDN14698.1| ribose-phosphate pyrophosphokinase [Vibrio cholerae AM-19226]
 gi|227010196|gb|ACP06408.1| ribose-phosphate pyrophosphokinase [Vibrio cholerae M66-2]
 gi|227014079|gb|ACP10289.1| ribose-phosphate pyrophosphokinase [Vibrio cholerae O395]
 gi|229332584|gb|EEN98070.1| ribose-phosphate pyrophosphokinase [Vibrio cholerae 12129(1)]
 gi|229337760|gb|EEO02777.1| ribose-phosphate pyrophosphokinase [Vibrio cholerae bv. albensis
           VL426]
 gi|229341059|gb|EEO06064.1| ribose-phosphate pyrophosphokinase [Vibrio cholerae TM 11079-80]
 gi|229343850|gb|EEO08825.1| ribose-phosphate pyrophosphokinase [Vibrio cholerae RC9]
 gi|229349010|gb|EEO13967.1| ribose-phosphate pyrophosphokinase [Vibrio cholerae TMA 21]
 gi|229351990|gb|EEO16931.1| ribose-phosphate pyrophosphokinase [Vibrio cholerae B33]
 gi|229355244|gb|EEO20165.1| ribose-phosphate pyrophosphokinase [Vibrio cholerae BX 330286]
 gi|229369939|gb|ACQ60362.1| ribose-phosphate pyrophosphokinase [Vibrio cholerae MJ-1236]
 gi|254844967|gb|EET23381.1| ribose-phosphate pyrophosphokinase [Vibrio cholerae MO10]
 gi|255736918|gb|EET92314.1| ribose-phosphate pyrophosphokinase [Vibrio cholera CIRS 101]
 gi|260841096|gb|EEX67621.1| ribose-phosphate pyrophosphokinase [Vibrio sp. RC341]
 gi|262349560|gb|EEY98698.1| ribose-phosphate pyrophosphokinase [Vibrio sp. RC586]
 gi|297533771|gb|EFH72613.1| ribose-phosphate pyrophosphokinase [Vibrio cholerae RC385]
 gi|327484705|gb|AEA79112.1| Ribose-phosphate pyrophosphokinase [Vibrio cholerae LMA3894-4]
          Length = 314

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 21/48 (43%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +   V G   +++DD+  TG T   AA ALK+ GA  V          
Sbjct: 207 LIGDVEGRDCVIVDDMIDTGGTLCKAAEALKERGAKRVFAYATHAVFS 254


>gi|257871135|ref|ZP_05650788.1| ribose-phosphate pyrophosphokinase [Enterococcus gallinarum EG2]
 gi|257805299|gb|EEV34121.1| ribose-phosphate pyrophosphokinase [Enterococcus gallinarum EG2]
          Length = 324

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 23/46 (50%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            HV G   +LIDD+  T  T   AA ALK+AGA +V        L 
Sbjct: 215 GHVEGKTCVLIDDMIDTAGTITLAANALKQAGAKSVYASCTHPVLS 260


>gi|325510260|gb|ADZ21896.1| amidophosphoribosyltransferase [Clostridium acetobutylicum EA 2018]
          Length = 226

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 27/45 (60%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
            + +    +LLIDDV+TTGATA   +  L   GA  V +LT ++S
Sbjct: 180 QEKIKDKVVLLIDDVFTTGATAFFCSKELINNGAKKVIVLTVAKS 224


>gi|282599873|ref|ZP_05972178.2| competence protein F [Providencia rustigianii DSM 4541]
 gi|282567448|gb|EFB72983.1| competence protein F [Providencia rustigianii DSM 4541]
          Length = 125

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 25/57 (43%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +  AF +       V GL I +IDDV TTGAT   AA  L  AGA TV   +  R+L
Sbjct: 73  LNQAFTL----ETSVYGLHIAIIDDVITTGATMNAAAQLLICAGAHTVDAWSLCRTL 125


>gi|125716900|ref|YP_001034033.1| hypoxanthine guanine phosphoribosyltransferase [Streptococcus
           sanguinis SK36]
 gi|323350841|ref|ZP_08086500.1| hypoxanthine phosphoribosyltransferase [Streptococcus sanguinis
           VMC66]
 gi|125496817|gb|ABN43483.1| Hypoxanthine guanine phosphoribosyltransferase, putative
           [Streptococcus sanguinis SK36]
 gi|322123015|gb|EFX94718.1| hypoxanthine phosphoribosyltransferase [Streptococcus sanguinis
           VMC66]
 gi|325686489|gb|EGD28518.1| hypoxanthine phosphoribosyltransferase [Streptococcus sanguinis
           SK72]
          Length = 184

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
              NV + + + + G  IL ++D+  TG T K      K+  A +V I T 
Sbjct: 82  GVINVIKDIDQDITGRDILFVEDIIDTGQTLKNLCNLFKERNAASVKIATL 132


>gi|121601755|ref|YP_988801.1| amidophosphoribosyltransferase [Bartonella bacilliformis KC583]
 gi|120613932|gb|ABM44533.1| amidophosphoribosyltransferase [Bartonella bacilliformis KC583]
          Length = 496

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 22/50 (44%), Gaps = 3/50 (6%)

Query: 4   AFNV---PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
           AF V          + G +++LIDD    G T+      L+ AGA  V +
Sbjct: 348 AFGVKLKHSANRSVIRGKRVILIDDSIVRGTTSVKIVQMLRDAGAKEVHM 397


>gi|108805005|ref|YP_644942.1| hypoxanthine phosphoribosyltransferase [Rubrobacter xylanophilus
           DSM 9941]
 gi|108766248|gb|ABG05130.1| hypoxanthine phosphoribosyltransferase [Rubrobacter xylanophilus
           DSM 9941]
          Length = 189

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 8/51 (15%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + + + ++G  +L+++D+  TG T      +L      ++ I   
Sbjct: 84  GVVRILKDLEEDISGRHVLIVEDIIDTGLTLSYLRRSLLARKPASLEICAL 134


>gi|294787116|ref|ZP_06752370.1| amidophosphoribosyltransferase [Parascardovia denticolens F0305]
 gi|315226770|ref|ZP_07868558.1| amidophosphoribosyltransferase [Parascardovia denticolens DSM
           10105]
 gi|294485949|gb|EFG33583.1| amidophosphoribosyltransferase [Parascardovia denticolens F0305]
 gi|315120902|gb|EFT84034.1| amidophosphoribosyltransferase [Parascardovia denticolens DSM
           10105]
          Length = 512

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 25/49 (51%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            V   V G +++++DD    G T+K     L++AGA  V +   S  LK
Sbjct: 346 AVRGVVEGKRVIVVDDSIVRGTTSKRIVRLLREAGAREVHMRIASPPLK 394


>gi|260913885|ref|ZP_05920359.1| ribose-phosphate pyrophosphokinase [Pasteurella dagmatis ATCC
           43325]
 gi|260631972|gb|EEX50149.1| ribose-phosphate pyrophosphokinase [Pasteurella dagmatis ATCC
           43325]
          Length = 315

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V+G   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 207 HIIGDVSGRDCILVDDMIDTGGTLCKAAEALKERGAKRVFAYATHAVFS 255


>gi|296140878|ref|YP_003648121.1| ribose-phosphate pyrophosphokinase [Tsukamurella paurometabola DSM
           20162]
 gi|296029012|gb|ADG79782.1| ribose-phosphate pyrophosphokinase [Tsukamurella paurometabola DSM
           20162]
          Length = 325

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 24/52 (46%)

Query: 8   PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
              V   VAG   +LIDD+  TG T   A   LK+AGA  V I T      +
Sbjct: 213 SNRVVGDVAGRTCVLIDDMIDTGGTIAGAVGVLKEAGAKDVIIATTHGVFSE 264


>gi|300362074|ref|ZP_07058251.1| hypoxanthine phosphoribosyltransferase [Lactobacillus gasseri
           JV-V03]
 gi|300354693|gb|EFJ70564.1| hypoxanthine phosphoribosyltransferase [Lactobacillus gasseri
           JV-V03]
          Length = 189

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 20/51 (39%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               +   V   V    +LL++D+  TG T K     L K GA +V     
Sbjct: 83  GKVRLDIDVQADVKDRDVLLVEDIVDTGHTLKFMKDLLTKRGAKSVKCCAL 133


>gi|27262336|gb|AAN87449.1| Amidophosphoribosyltransferase [Heliobacillus mobilis]
          Length = 482

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 4   AFNVP-QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
           A  +    V+K V G ++++IDD    G T+      L++AGA  V +L 
Sbjct: 341 AVRLKLNAVAKAVEGKRVIMIDDSIVRGTTSGKIVQMLRQAGAKEVHMLV 390


>gi|15640606|ref|NP_230235.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|121591030|ref|ZP_01678346.1| hypoxanthine phosphoribosyltransferase [Vibrio cholerae 2740-80]
 gi|121730073|ref|ZP_01682479.1| hypoxanthine phosphoribosyltransferase [Vibrio cholerae V52]
 gi|147674548|ref|YP_001216082.1| hypoxanthine phosphoribosyltransferase [Vibrio cholerae O395]
 gi|153803189|ref|ZP_01957775.1| hypoxanthine phosphoribosyltransferase [Vibrio cholerae MZO-3]
 gi|153820163|ref|ZP_01972830.1| hypoxanthine phosphoribosyltransferase [Vibrio cholerae NCTC 8457]
 gi|153823609|ref|ZP_01976276.1| hypoxanthine phosphoribosyltransferase [Vibrio cholerae B33]
 gi|153827390|ref|ZP_01980057.1| hypoxanthine phosphoribosyltransferase [Vibrio cholerae MZO-2]
 gi|153830221|ref|ZP_01982888.1| hypoxanthine phosphoribosyltransferase [Vibrio cholerae 623-39]
 gi|227080768|ref|YP_002809319.1| hypoxanthine phosphoribosyltransferase [Vibrio cholerae M66-2]
 gi|229507193|ref|ZP_04396699.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio cholerae BX
           330286]
 gi|229509178|ref|ZP_04398663.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio cholerae
           B33]
 gi|229512851|ref|ZP_04402318.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio cholerae TMA
           21]
 gi|229519612|ref|ZP_04409055.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio cholerae
           RC9]
 gi|229520878|ref|ZP_04410300.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio cholerae TM
           11079-80]
 gi|229525242|ref|ZP_04414647.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio cholerae bv.
           albensis VL426]
 gi|229530395|ref|ZP_04419783.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio cholerae
           12129(1)]
 gi|229606129|ref|YP_002876777.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio cholerae
           MJ-1236]
 gi|254226866|ref|ZP_04920436.1| hypoxanthine phosphoribosyltransferase [Vibrio cholerae V51]
 gi|254291274|ref|ZP_04962069.1| hypoxanthine phosphoribosyltransferase [Vibrio cholerae AM-19226]
 gi|254850820|ref|ZP_05240170.1| hypoxanthine phosphoribosyltransferase [Vibrio cholerae MO10]
 gi|255744193|ref|ZP_05418146.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio cholera CIRS
           101]
 gi|262155765|ref|ZP_06028889.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio cholerae
           INDRE 91/1]
 gi|262169891|ref|ZP_06037581.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio cholerae
           RC27]
 gi|262190668|ref|ZP_06048901.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio cholerae CT
           5369-93]
 gi|298500706|ref|ZP_07010509.1| hypoxanthine phosphoribosyltransferase [Vibrio cholerae MAK 757]
 gi|305677892|pdb|3OHP|A Chain A, Crystal Structure Of Hgprt From Vibrio Cholerae
 gi|305677893|pdb|3OHP|B Chain B, Crystal Structure Of Hgprt From Vibrio Cholerae
 gi|305677894|pdb|3OHP|C Chain C, Crystal Structure Of Hgprt From Vibrio Cholerae
 gi|305677895|pdb|3OHP|D Chain D, Crystal Structure Of Hgprt From Vibrio Cholerae
 gi|9655015|gb|AAF93752.1| hypoxanthine phosphoribosyltransferase [Vibrio cholerae O1 biovar
           El Tor str. N16961]
 gi|121547101|gb|EAX57234.1| hypoxanthine phosphoribosyltransferase [Vibrio cholerae 2740-80]
 gi|121628176|gb|EAX60702.1| hypoxanthine phosphoribosyltransferase [Vibrio cholerae V52]
 gi|124121292|gb|EAY40035.1| hypoxanthine phosphoribosyltransferase [Vibrio cholerae MZO-3]
 gi|125620617|gb|EAZ48981.1| hypoxanthine phosphoribosyltransferase [Vibrio cholerae V51]
 gi|126509292|gb|EAZ71886.1| hypoxanthine phosphoribosyltransferase [Vibrio cholerae NCTC 8457]
 gi|126518873|gb|EAZ76096.1| hypoxanthine phosphoribosyltransferase [Vibrio cholerae B33]
 gi|146316431|gb|ABQ20970.1| hypoxanthine phosphoribosyltransferase [Vibrio cholerae O395]
 gi|148874281|gb|EDL72416.1| hypoxanthine phosphoribosyltransferase [Vibrio cholerae 623-39]
 gi|149738693|gb|EDM53035.1| hypoxanthine phosphoribosyltransferase [Vibrio cholerae MZO-2]
 gi|150422838|gb|EDN14790.1| hypoxanthine phosphoribosyltransferase [Vibrio cholerae AM-19226]
 gi|227008656|gb|ACP04868.1| hypoxanthine phosphoribosyltransferase [Vibrio cholerae M66-2]
 gi|227012411|gb|ACP08621.1| hypoxanthine phosphoribosyltransferase [Vibrio cholerae O395]
 gi|229332168|gb|EEN97656.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio cholerae
           12129(1)]
 gi|229338823|gb|EEO03840.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio cholerae bv.
           albensis VL426]
 gi|229342111|gb|EEO07107.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio cholerae TM
           11079-80]
 gi|229344301|gb|EEO09276.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio cholerae
           RC9]
 gi|229350100|gb|EEO15053.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio cholerae TMA
           21]
 gi|229353750|gb|EEO18686.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio cholerae
           B33]
 gi|229355938|gb|EEO20858.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio cholerae BX
           330286]
 gi|229368784|gb|ACQ59207.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio cholerae
           MJ-1236]
 gi|254846525|gb|EET24939.1| hypoxanthine phosphoribosyltransferase [Vibrio cholerae MO10]
 gi|255738133|gb|EET93525.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio cholera CIRS
           101]
 gi|262021625|gb|EEY40336.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio cholerae
           RC27]
 gi|262030476|gb|EEY49116.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio cholerae
           INDRE 91/1]
 gi|262033452|gb|EEY51957.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio cholerae CT
           5369-93]
 gi|297540487|gb|EFH76545.1| hypoxanthine phosphoribosyltransferase [Vibrio cholerae MAK 757]
 gi|327483393|gb|AEA77800.1| Hypoxanthine-guanine phosphoribosyltransferase [Vibrio cholerae
           LMA3894-4]
          Length = 177

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 10/49 (20%), Positives = 20/49 (40%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
             + + +   + G  +LL++D+  TG T       L      ++ I T 
Sbjct: 79  VRILKDLDDDIKGKDVLLVEDIIDTGNTLNKVKEILALREPKSIRICTL 127


>gi|260598219|ref|YP_003210790.1| ribose-phosphate pyrophosphokinase [Cronobacter turicensis z3032]
 gi|260217396|emb|CBA31457.1| Ribose-phosphate pyrophosphokinase [Cronobacter turicensis z3032]
          Length = 334

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 225 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 273


>gi|282599699|ref|ZP_05971558.2| ribose-phosphate pyrophosphokinase [Providencia rustigianii DSM
           4541]
 gi|282568299|gb|EFB73834.1| ribose-phosphate pyrophosphokinase [Providencia rustigianii DSM
           4541]
          Length = 312

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V+G   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 203 HIIGDVSGRDCILVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 251


>gi|70726888|ref|YP_253802.1| amidophosphoribosyltransferase [Staphylococcus haemolyticus
           JCSC1435]
 gi|68447612|dbj|BAE05196.1| phosphoribosylpyrophosphate amidotransferase [Staphylococcus
           haemolyticus JCSC1435]
          Length = 494

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/41 (36%), Positives = 21/41 (51%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
            V   V G +I+L+DD    G T+K     LK +GA  V +
Sbjct: 342 AVKDIVEGKRIVLVDDSIVRGTTSKRIVRMLKDSGAKEVHV 382


>gi|313889503|ref|ZP_07823149.1| hypoxanthine phosphoribosyltransferase [Streptococcus
           pseudoporcinus SPIN 20026]
 gi|313122115|gb|EFR45208.1| hypoxanthine phosphoribosyltransferase [Streptococcus
           pseudoporcinus SPIN 20026]
          Length = 180

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + V  ++ G  IL ++D+  TG T K      K   A +V I T 
Sbjct: 78  GEVKILKDVDTNIEGRDILFVEDIIDTGRTLKYLRDMFKYRKANSVKIATL 128


>gi|288926892|ref|ZP_06420792.1| competence protein ComF [Prevotella buccae D17]
 gi|288336331|gb|EFC74712.1| competence protein ComF [Prevotella buccae D17]
          Length = 235

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           +   F + +   + V G  +LLIDDV TTGAT     + +KKAG + +S+LT 
Sbjct: 180 VEGVFRLLK--PEAVHGRHVLLIDDVCTTGATLSSCGMEIKKAGNVRISVLTL 230


>gi|269965459|ref|ZP_06179578.1| Ribose-phosphate pyrophosphokinase [Vibrio alginolyticus 40B]
 gi|269829938|gb|EEZ84168.1| Ribose-phosphate pyrophosphokinase [Vibrio alginolyticus 40B]
          Length = 311

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 21/48 (43%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +   V G   +++DD+  TG T   AA ALK+ GA  V          
Sbjct: 204 LIGDVEGRDCVIVDDMIDTGGTLCKAAEALKERGAKRVFAYATHAVFS 251


>gi|262166270|ref|ZP_06034007.1| ribose-phosphate pyrophosphokinase [Vibrio mimicus VM223]
 gi|262170838|ref|ZP_06038516.1| ribose-phosphate pyrophosphokinase [Vibrio mimicus MB-451]
 gi|261891914|gb|EEY37900.1| ribose-phosphate pyrophosphokinase [Vibrio mimicus MB-451]
 gi|262025986|gb|EEY44654.1| ribose-phosphate pyrophosphokinase [Vibrio mimicus VM223]
          Length = 314

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 21/48 (43%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +   V G   +++DD+  TG T   AA ALK+ GA  V          
Sbjct: 207 LIGDVEGRDCVIVDDMIDTGGTLCKAAEALKERGAKRVFAYATHAVFS 254


>gi|257452466|ref|ZP_05617765.1| hypoxanthine-guanine phosphoribosyltransferase [Fusobacterium sp.
           3_1_5R]
 gi|317059007|ref|ZP_07923492.1| hypoxanthine-guanine phosphoribosyltransferase [Fusobacterium sp.
           3_1_5R]
 gi|313684683|gb|EFS21518.1| hypoxanthine-guanine phosphoribosyltransferase [Fusobacterium sp.
           3_1_5R]
          Length = 178

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 21/51 (41%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + +     + G  +L+++D+  TG T K     L   GA  + I T 
Sbjct: 78  GVVKILKDTDFDMKGKNLLIVEDIIDTGLTLKYVKEFLYAKGAAEIKICTL 128


>gi|324989590|gb|EGC21536.1| hypoxanthine phosphoribosyltransferase [Streptococcus sanguinis
           SK353]
 gi|328945186|gb|EGG39341.1| hypoxanthine phosphoribosyltransferase [Streptococcus sanguinis
           SK1087]
          Length = 184

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
              NV + + + + G  IL ++D+  TG T K      K+  A +V I T 
Sbjct: 82  GVINVIKDIDQDITGRDILFVEDIIDTGQTLKNLCNLFKERNAASVKIATL 132


>gi|307544761|ref|YP_003897240.1| competence protein F [Halomonas elongata DSM 2581]
 gi|307216785|emb|CBV42055.1| competence protein F [Halomonas elongata DSM 2581]
          Length = 267

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 5/56 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R AF V   +   VA     L+DDV TTGAT    A A  +AGA  V     +R+
Sbjct: 214 LRAAFRVETALPPEVA-----LLDDVMTTGATLDALARACHQAGAERVEAWAVART 264


>gi|291542481|emb|CBL15591.1| hypoxanthine phosphoribosyltransferase [Ruminococcus bromii L2-63]
          Length = 178

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 25/51 (49%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
              N+ + +S+ V G  IL+++D+  +G T       LK   A +V + T 
Sbjct: 77  GRVNIQKDISQSVEGKDILIVEDIIDSGNTLDFITKYLKAKKAKSVKLCTL 127


>gi|237737100|ref|ZP_04567581.1| hypoxanthine-guanine phosphoribosyltransferase [Fusobacterium
           mortiferum ATCC 9817]
 gi|229420962|gb|EEO36009.1| hypoxanthine-guanine phosphoribosyltransferase [Fusobacterium
           mortiferum ATCC 9817]
          Length = 173

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
              NV +     V    +L+++D+  TG T       L+  GA ++ I T 
Sbjct: 75  GVINVLKDTDISVKDKDVLIVEDIIDTGLTLSHVKKLLEDRGAKSLKICTL 125


>gi|184154604|ref|YP_001842944.1| amidophosphoribosyltransferase [Lactobacillus fermentum IFO 3956]
 gi|183225948|dbj|BAG26464.1| amidophosphoribosyltransferase [Lactobacillus fermentum IFO 3956]
          Length = 487

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 23/42 (54%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51
            V   V G +++++DD    G T+K     L++AGA  V +L
Sbjct: 343 AVRGVVEGKRVIVVDDSIVRGTTSKQIVQMLRRAGAKEVHLL 384


>gi|86516982|gb|ABC98183.1| PrsA [Shigella dysenteriae]
 gi|86516984|gb|ABC98184.1| PrsA [Shigella dysenteriae]
 gi|86516986|gb|ABC98185.1| PrsA [Shigella dysenteriae]
 gi|86516990|gb|ABC98187.1| PrsA [Shigella dysenteriae]
 gi|86516992|gb|ABC98188.1| PrsA [Shigella dysenteriae]
 gi|86516996|gb|ABC98190.1| PrsA [Shigella dysenteriae]
 gi|86517002|gb|ABC98193.1| PrsA [Shigella dysenteriae]
 gi|320174897|gb|EFW50016.1| Ribose-phosphate pyrophosphokinase [Shigella dysenteriae CDC
           74-1112]
          Length = 315

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|28377430|ref|NP_784322.1| hypoxanthine-guanine phosphoribosyltransferase [Lactobacillus
           plantarum WCFS1]
 gi|254555613|ref|YP_003062030.1| hypoxanthine-guanine phosphoribosyltransferase [Lactobacillus
           plantarum JDM1]
 gi|300768963|ref|ZP_07078854.1| hypoxanthine phosphoribosyltransferase [Lactobacillus plantarum
           subsp. plantarum ATCC 14917]
 gi|308179643|ref|YP_003923771.1| hypoxanthine-guanine phosphoribosyltransferase [Lactobacillus
           plantarum subsp. plantarum ST-III]
 gi|28270262|emb|CAD63163.1| hypoxanthine-guanine phosphoribosyltransferase [Lactobacillus
           plantarum WCFS1]
 gi|254044540|gb|ACT61333.1| hypoxanthine-guanine phosphoribosyltransferase [Lactobacillus
           plantarum JDM1]
 gi|300493484|gb|EFK28661.1| hypoxanthine phosphoribosyltransferase [Lactobacillus plantarum
           subsp. plantarum ATCC 14917]
 gi|308045134|gb|ADN97677.1| hypoxanthine-guanine phosphoribosyltransferase [Lactobacillus
           plantarum subsp. plantarum ST-III]
          Length = 180

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V G  +L+I+D+  TG T K     LK+    +V + T 
Sbjct: 77  GEVQLTKDLDADVTGRDVLVIEDIIDTGRTLKFLIDLLKRRDVNSVKVCTL 127


>gi|320538904|ref|ZP_08038580.1| putative phosphoribosylpyrophosphate synthase [Serratia symbiotica
           str. Tucson]
 gi|320031064|gb|EFW13067.1| putative phosphoribosylpyrophosphate synthase [Serratia symbiotica
           str. Tucson]
          Length = 315

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|213865553|ref|ZP_03387672.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
          enterica serovar Typhi str. M223]
          Length = 72

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1  MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
          ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 20 LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 72


>gi|191168534|ref|ZP_03030320.1| ribose-phosphate pyrophosphokinase [Escherichia coli B7A]
 gi|190901432|gb|EDV61195.1| ribose-phosphate pyrophosphokinase [Escherichia coli B7A]
          Length = 315

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|188026295|ref|ZP_02961601.2| hypothetical protein PROSTU_03641 [Providencia stuartii ATCC 25827]
 gi|188022394|gb|EDU60434.1| hypothetical protein PROSTU_03641 [Providencia stuartii ATCC 25827]
          Length = 171

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 8/49 (16%), Positives = 22/49 (44%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
             + + + + +    +L+++D+  +G T        +  G  +V+I T 
Sbjct: 73  VKIVKDLDEDIRDKHVLIVEDIIDSGNTLNKVREIFELRGPKSVAICTL 121


>gi|86516964|gb|ABC98174.1| PrsA [Shigella boydii]
          Length = 315

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|78484737|ref|YP_390662.1| ribose-phosphate pyrophosphokinase [Thiomicrospira crunogena XCL-2]
 gi|78363023|gb|ABB40988.1| ribose-phosphate pyrophosphokinase [Thiomicrospira crunogena XCL-2]
          Length = 321

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 23/46 (50%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
             V+G   +L+DD+  T  T   AA ALK+ GA +V+       L 
Sbjct: 214 GDVSGRDCILVDDMVDTAGTLCKAAEALKEHGANSVTAYVVHAVLS 259


>gi|258623049|ref|ZP_05718062.1| Hypoxanthine phosphoribosyltransferase [Vibrio mimicus VM573]
 gi|258627258|ref|ZP_05722044.1| Hypoxanthine phosphoribosyltransferase [Vibrio mimicus VM603]
 gi|262172334|ref|ZP_06040012.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio mimicus
           MB-451]
 gi|258580441|gb|EEW05404.1| Hypoxanthine phosphoribosyltransferase [Vibrio mimicus VM603]
 gi|258584662|gb|EEW09398.1| Hypoxanthine phosphoribosyltransferase [Vibrio mimicus VM573]
 gi|261893410|gb|EEY39396.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio mimicus
           MB-451]
          Length = 177

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 10/49 (20%), Positives = 20/49 (40%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
             + + +   + G  +LL++D+  TG T       L      ++ I T 
Sbjct: 79  VRILKDLDDDIKGKDVLLVEDIIDTGNTLNKVKEILALREPKSIRICTL 127


>gi|257466333|ref|ZP_05630644.1| hypoxanthine-guanine phosphoribosyltransferase [Fusobacterium
           gonidiaformans ATCC 25563]
 gi|315917490|ref|ZP_07913730.1| hypoxanthine-guanine phosphoribosyltransferase [Fusobacterium
           gonidiaformans ATCC 25563]
 gi|313691365|gb|EFS28200.1| hypoxanthine-guanine phosphoribosyltransferase [Fusobacterium
           gonidiaformans ATCC 25563]
          Length = 178

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 21/51 (41%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + +     + G  +L+++D+  TG T K     L   GA  + I T 
Sbjct: 78  GVVKILKDTDFDMKGKNLLIVEDIIDTGLTLKYVKEFLYAKGAAEIKICTL 128


>gi|259908622|ref|YP_002648978.1| ribose-phosphate pyrophosphokinase [Erwinia pyrifoliae Ep1/96]
 gi|224964244|emb|CAX55751.1| Ribose-phosphate pyrophosphokinase [Erwinia pyrifoliae Ep1/96]
          Length = 341

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 232 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 280


>gi|213967229|ref|ZP_03395378.1| ribose-phosphate pyrophosphokinase [Pseudomonas syringae pv. tomato
           T1]
 gi|257482002|ref|ZP_05636043.1| ribose-phosphate pyrophosphokinase [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|289647282|ref|ZP_06478625.1| ribose-phosphate pyrophosphokinase [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|301381035|ref|ZP_07229453.1| ribose-phosphate pyrophosphokinase [Pseudomonas syringae pv. tomato
           Max13]
 gi|302060383|ref|ZP_07251924.1| ribose-phosphate pyrophosphokinase [Pseudomonas syringae pv. tomato
           K40]
 gi|213928071|gb|EEB61617.1| ribose-phosphate pyrophosphokinase [Pseudomonas syringae pv. tomato
           T1]
          Length = 309

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 22/49 (44%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +L+DD+  T  T   AA ALK+ GA  V        L 
Sbjct: 201 HIIGDVEGRTCILVDDMVDTAGTLCHAAKALKEHGAAKVFAYCTHPVLS 249


>gi|307151741|ref|YP_003887125.1| amidophosphoribosyltransferase [Cyanothece sp. PCC 7822]
 gi|306981969|gb|ADN13850.1| amidophosphoribosyltransferase [Cyanothece sp. PCC 7822]
          Length = 494

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 12/41 (29%), Positives = 22/41 (53%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
            +   + G +I+++DD    G T++    AL+ AGA  V +
Sbjct: 366 PLKDVLQGKRIIIVDDSIVRGTTSRKIVKALRDAGAKEVHM 406


>gi|304397554|ref|ZP_07379431.1| ribose-phosphate pyrophosphokinase [Pantoea sp. aB]
 gi|304354726|gb|EFM19096.1| ribose-phosphate pyrophosphokinase [Pantoea sp. aB]
          Length = 315

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|282851106|ref|ZP_06260480.1| hypoxanthine phosphoribosyltransferase [Lactobacillus gasseri
           224-1]
 gi|282558058|gb|EFB63646.1| hypoxanthine phosphoribosyltransferase [Lactobacillus gasseri
           224-1]
          Length = 178

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 10/51 (19%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + Q +   V    ++ ++D+  TG T +  +  +K  GA +V ++  
Sbjct: 76  GEVKITQDIKSDVKDRPVIFMEDIIDTGRTLQALSEVMKGRGAKSVEVVAM 126


>gi|188587550|ref|YP_001919595.1| ribose-phosphate diphosphokinase [Clostridium botulinum E3 str.
           Alaska E43]
 gi|188497831|gb|ACD50967.1| ribose-phosphate diphosphokinase [Clostridium botulinum E3 str.
           Alaska E43]
          Length = 319

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 21/46 (45%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
             V G + +LIDD+  T  T   AA ALK+ GA  V        L 
Sbjct: 214 GDVEGKRCILIDDMIDTAGTISNAANALKELGAKNVYACCTHGVLS 259


>gi|313673556|ref|YP_004051667.1| phosphoribosyltransferase [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312940312|gb|ADR19504.1| phosphoribosyltransferase [Calditerrivibrio nitroreducens DSM
           19672]
          Length = 221

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/44 (47%), Positives = 25/44 (56%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
            K +  LKILL+DD+ TTGAT    A  LK AGA  V     S+
Sbjct: 175 KKELFDLKILLVDDIITTGATLNECAKMLKGAGARKVDCYVLSK 218


>gi|149182713|ref|ZP_01861179.1| amidophosphoribosyltransferase [Bacillus sp. SG-1]
 gi|148849573|gb|EDL63757.1| amidophosphoribosyltransferase [Bacillus sp. SG-1]
          Length = 473

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 27/50 (54%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            V   V G +++++DD    G T++     LK+AGA  V ++  S  +K+
Sbjct: 341 PVRGVVEGKRVVMVDDSIVRGTTSRRIVTMLKEAGATEVHVVISSPPIKN 390


>gi|86517026|gb|ABC98205.1| PrsA [Escherichia coli]
          Length = 315

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|21672452|ref|NP_660519.1| ribose-phosphate pyrophosphokinase [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
 gi|25008680|sp|Q8K9X2|KPRS_BUCAP RecName: Full=Ribose-phosphate pyrophosphokinase; Short=RPPK;
           AltName: Full=Phosphoribosyl pyrophosphate synthase;
           Short=P-Rib-PP synthase; Short=PRPP synthase
 gi|21623066|gb|AAM67730.1| ribose-phosphate pyrophosphokinase [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
          Length = 315

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 22/49 (44%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VA    +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVANRDCILVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|83746861|ref|ZP_00943908.1| Amidophosphoribosyltransferase family protein [Ralstonia
           solanacearum UW551]
 gi|207742204|ref|YP_002258596.1| competence protein f-related protein [Ralstonia solanacearum
           IPO1609]
 gi|83726446|gb|EAP73577.1| Amidophosphoribosyltransferase family protein [Ralstonia
           solanacearum UW551]
 gi|206593592|emb|CAQ60519.1| competence protein f-related protein [Ralstonia solanacearum
           IPO1609]
          Length = 245

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++  F+VP      VAG  + ++DDV TTGAT    A  LK+AGA  V+     R+
Sbjct: 191 LQGTFDVPDPAC--VAGRHVGVVDDVMTTGATLSEVATQLKRAGAARVTNCVALRT 244


>gi|332878586|ref|ZP_08446306.1| ribose-phosphate diphosphokinase [Capnocytophaga sp. oral taxon 329
           str. F0087]
 gi|332683487|gb|EGJ56364.1| ribose-phosphate diphosphokinase [Capnocytophaga sp. oral taxon 329
           str. F0087]
          Length = 315

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 24/49 (48%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            +   V G  ++L+DD+  T  T   AA  +K+ GA++V  +     L 
Sbjct: 209 ELIGDVEGRNVVLVDDMVDTAGTLVKAAQLMKERGAVSVRAVATHPILS 257


>gi|300716402|ref|YP_003741205.1| ribose-phosphate pyrophosphokinase [Erwinia billingiae Eb661]
 gi|283478595|emb|CAY74511.1| prsA [Erwinia pyrifoliae DSM 12163]
 gi|299062238|emb|CAX59355.1| Ribose-phosphate pyrophosphokinase [Erwinia billingiae Eb661]
 gi|310767478|gb|ADP12428.1| hypothetical protein EJP617_27470 [Erwinia sp. Ejp617]
          Length = 315

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|302186449|ref|ZP_07263122.1| ribose-phosphate pyrophosphokinase [Pseudomonas syringae pv.
           syringae 642]
          Length = 309

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 22/49 (44%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +L+DD+  T  T   AA ALK+ GA  V        L 
Sbjct: 201 HIIGDVEGRTCILVDDMVDTAGTLCHAAKALKEHGAAKVFAYCTHPVLS 249


>gi|270308613|ref|YP_003330671.1| ComF [Dehalococcoides sp. VS]
 gi|270154505|gb|ACZ62343.1| ComF [Dehalococcoides sp. VS]
          Length = 233

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 27/37 (72%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++++IDDV TTGAT    A  LK+AGA++V  LT +R
Sbjct: 195 RVIIIDDVATTGATLNACAATLKEAGALSVWGLTIAR 231


>gi|119173273|ref|XP_001239118.1| hypothetical protein CIMG_10140 [Coccidioides immitis RS]
          Length = 573

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 12/56 (21%), Positives = 24/56 (42%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +        +     G  +LL+DD    G T++      ++AGA TV   + + ++
Sbjct: 353 KGVRRKLNAMKSEFKGRNVLLVDDSIVRGTTSREIVTMAREAGAKTVHFASCAPAI 408


>gi|330813695|ref|YP_004357934.1| ribose-phosphate pyrophosphokinase [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486790|gb|AEA81195.1| ribose-phosphate pyrophosphokinase [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 309

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 20/46 (43%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
             V G   ++IDD+  +G T   AA AL + GA  V        L 
Sbjct: 205 GEVKGKTCIIIDDLVDSGGTICNAAAALMEKGAKEVYAYVVHAVLS 250


>gi|298292753|ref|YP_003694692.1| phosphoribosyltransferase [Starkeya novella DSM 506]
 gi|296929264|gb|ADH90073.1| phosphoribosyltransferase [Starkeya novella DSM 506]
          Length = 273

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 29/44 (65%)

Query: 14  HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
            + G +++L+DDV TTGAT    A AL +AGA  V +L F+R +
Sbjct: 222 ELRGRRVVLVDDVLTTGATIDACAKALTRAGAGRVDVLVFARVV 265


>gi|312138699|ref|YP_004006035.1| ribose-phosphate diphosphokinase prsa [Rhodococcus equi 103S]
 gi|325676612|ref|ZP_08156290.1| phosphoribosyl pyrophosphate synthetase [Rhodococcus equi ATCC
           33707]
 gi|311888038|emb|CBH47350.1| ribose-phosphate diphosphokinase PrsA [Rhodococcus equi 103S]
 gi|325552790|gb|EGD22474.1| phosphoribosyl pyrophosphate synthetase [Rhodococcus equi ATCC
           33707]
          Length = 326

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 23/52 (44%)

Query: 8   PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
              V   V+G   +LIDD+  TG T   A   LK AGA  V I T      D
Sbjct: 214 SNRVVGDVSGRTCVLIDDMIDTGGTIAGAVEVLKNAGAGDVIIATTHGVFSD 265


>gi|270001212|gb|EEZ97659.1| hypothetical protein TcasGA2_TC016203 [Tribolium castaneum]
          Length = 523

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 22/48 (45%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
            +S  V G +++LIDD    G T       L+ AGA  V I   S  L
Sbjct: 406 ALSGSVKGKRVILIDDSIVRGNTIGPIIKLLRNAGATEVHIRVASPPL 453


>gi|269120717|ref|YP_003308894.1| amidophosphoribosyltransferase [Sebaldella termitidis ATCC 33386]
 gi|268614595|gb|ACZ08963.1| amidophosphoribosyltransferase [Sebaldella termitidis ATCC 33386]
          Length = 475

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 27/50 (54%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            + K V G ++++IDD    G T+K     L++AGA  V   + S  +K+
Sbjct: 350 AIKKVVEGKRVVVIDDSLVRGTTSKKLVKMLREAGAKEVHFRSASPVVKN 399


>gi|227431276|ref|ZP_03913330.1| competence protein FC [Leuconostoc mesenteroides subsp. cremoris
           ATCC 19254]
 gi|227353038|gb|EEJ43210.1| competence protein FC [Leuconostoc mesenteroides subsp. cremoris
           ATCC 19254]
          Length = 158

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 26/41 (63%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           + G  ILL+DDVYTTG+T   AA  L   GA +V  ++ +R
Sbjct: 118 IEGQSILLVDDVYTTGSTLHHAADLLLAHGADSVKSISLAR 158


>gi|254520518|ref|ZP_05132574.1| ribose-phosphate pyrophosphokinase [Clostridium sp. 7_2_43FAA]
 gi|226914267|gb|EEH99468.1| ribose-phosphate pyrophosphokinase [Clostridium sp. 7_2_43FAA]
          Length = 319

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 20/46 (43%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
             V G K +LIDD+  T  T   AA ALK  GA  V        L 
Sbjct: 214 GDVEGKKCILIDDMIDTAGTIANAANALKDLGAKNVYACCTHGVLS 259


>gi|225012237|ref|ZP_03702674.1| ribose-phosphate pyrophosphokinase [Flavobacteria bacterium
           MS024-2A]
 gi|225003792|gb|EEG41765.1| ribose-phosphate pyrophosphokinase [Flavobacteria bacterium
           MS024-2A]
          Length = 310

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 13/49 (26%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            +   V G  ++L+DD+  T  T   AA  + + GA++V  +     L 
Sbjct: 204 ELIGDVEGKNVILVDDMVDTAGTLTKAADLMMERGAISVRAICTHALLS 252


>gi|213612532|ref|ZP_03370358.1| gluconate periplasmic binding protein [Salmonella enterica subsp.
          enterica serovar Typhi str. E98-2068]
          Length = 60

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 1  MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
          ++NAF +       V GL ++++DDV TTG+T    A  L + GA TV +    R+L
Sbjct: 8  LKNAFRL----ELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL 60


>gi|212711983|ref|ZP_03320111.1| hypothetical protein PROVALCAL_03059 [Providencia alcalifaciens DSM
           30120]
 gi|212685505|gb|EEB45033.1| hypothetical protein PROVALCAL_03059 [Providencia alcalifaciens DSM
           30120]
          Length = 312

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V+G   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 203 HIIGDVSGRDCILVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 251


>gi|184154807|ref|YP_001843147.1| hypothetical protein LAF_0331 [Lactobacillus fermentum IFO 3956]
 gi|260663165|ref|ZP_05864057.1| competence protein [Lactobacillus fermentum 28-3-CHN]
 gi|183226151|dbj|BAG26667.1| conserved hypothetical protein [Lactobacillus fermentum IFO 3956]
 gi|260552357|gb|EEX25408.1| competence protein [Lactobacillus fermentum 28-3-CHN]
          Length = 224

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/43 (39%), Positives = 26/43 (60%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
            K V G  ++L+DDV+TTG T   AA  ++ AG  T+  +T +
Sbjct: 181 RKRVRGKTVVLVDDVFTTGRTMYHAAQLMRAAGCKTICGVTLA 223


>gi|91092280|ref|XP_968163.1| PREDICTED: similar to amidophosphoribosyltransferase [Tribolium
           castaneum]
          Length = 534

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 22/48 (45%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
            +S  V G +++LIDD    G T       L+ AGA  V I   S  L
Sbjct: 406 ALSGSVKGKRVILIDDSIVRGNTIGPIIKLLRNAGATEVHIRVASPPL 453


>gi|15830966|ref|NP_309739.1| ribose-phosphate pyrophosphokinase [Escherichia coli O157:H7 str.
           Sakai]
 gi|16129170|ref|NP_415725.1| phosphoribosylpyrophosphate synthase [Escherichia coli str. K-12
           substr. MG1655]
 gi|74312453|ref|YP_310872.1| ribose-phosphate pyrophosphokinase [Shigella sonnei Ss046]
 gi|82544339|ref|YP_408286.1| ribose-phosphate pyrophosphokinase [Shigella boydii Sb227]
 gi|82776547|ref|YP_402896.1| ribose-phosphate pyrophosphokinase [Shigella dysenteriae Sd197]
 gi|89108052|ref|AP_001832.1| phosphoribosylpyrophosphate synthase [Escherichia coli str. K-12
           substr. W3110]
 gi|110641437|ref|YP_669167.1| ribose-phosphate pyrophosphokinase [Escherichia coli 536]
 gi|157156694|ref|YP_001462460.1| ribose-phosphate pyrophosphokinase [Escherichia coli E24377A]
 gi|157160712|ref|YP_001458030.1| ribose-phosphate pyrophosphokinase [Escherichia coli HS]
 gi|170020426|ref|YP_001725380.1| ribose-phosphate pyrophosphokinase [Escherichia coli ATCC 8739]
 gi|170080835|ref|YP_001730155.1| phosphoribosylpyrophosphate synthase [Escherichia coli str. K-12
           substr. DH10B]
 gi|170768206|ref|ZP_02902659.1| ribose-phosphate pyrophosphokinase [Escherichia albertii TW07627]
 gi|188496130|ref|ZP_03003400.1| ribose-phosphate pyrophosphokinase [Escherichia coli 53638]
 gi|189010484|ref|ZP_02807569.2| ribose-phosphate pyrophosphokinase [Escherichia coli O157:H7 str.
           EC4076]
 gi|189402307|ref|ZP_02781576.2| ribose-phosphate pyrophosphokinase [Escherichia coli O157:H7 str.
           EC4401]
 gi|189403552|ref|ZP_02796102.2| ribose-phosphate pyrophosphokinase [Escherichia coli O157:H7 str.
           EC4486]
 gi|189404434|ref|ZP_02789423.2| ribose-phosphate pyrophosphokinase [Escherichia coli O157:H7 str.
           EC4501]
 gi|189405020|ref|ZP_02812717.2| ribose-phosphate pyrophosphokinase [Escherichia coli O157:H7 str.
           EC869]
 gi|189406226|ref|ZP_02827117.2| ribose-phosphate pyrophosphokinase [Escherichia coli O157:H7 str.
           EC508]
 gi|191171030|ref|ZP_03032581.1| ribose-phosphate pyrophosphokinase [Escherichia coli F11]
 gi|193071174|ref|ZP_03052097.1| ribose-phosphate pyrophosphokinase [Escherichia coli E110019]
 gi|194425970|ref|ZP_03058526.1| ribose-phosphate pyrophosphokinase [Escherichia coli B171]
 gi|194436927|ref|ZP_03069026.1| ribose-phosphate pyrophosphokinase [Escherichia coli 101-1]
 gi|208806473|ref|ZP_03248810.1| ribose-phosphate pyrophosphokinase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208815978|ref|ZP_03257157.1| ribose-phosphate pyrophosphokinase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208822417|ref|ZP_03262736.1| ribose-phosphate pyrophosphokinase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209398206|ref|YP_002270141.1| ribose-phosphate pyrophosphokinase [Escherichia coli O157:H7 str.
           EC4115]
 gi|209918448|ref|YP_002292532.1| ribose-phosphate pyrophosphokinase [Escherichia coli SE11]
 gi|215486439|ref|YP_002328870.1| ribose-phosphate pyrophosphokinase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217328136|ref|ZP_03444218.1| ribose-phosphate pyrophosphokinase [Escherichia coli O157:H7 str.
           TW14588]
 gi|218549102|ref|YP_002382893.1| ribose-phosphate pyrophosphokinase [Escherichia fergusonii ATCC
           35469]
 gi|218553761|ref|YP_002386674.1| ribose-phosphate pyrophosphokinase [Escherichia coli IAI1]
 gi|218558136|ref|YP_002391049.1| ribose-phosphate pyrophosphokinase [Escherichia coli S88]
 gi|218689154|ref|YP_002397366.1| ribose-phosphate pyrophosphokinase [Escherichia coli ED1a]
 gi|218694721|ref|YP_002402388.1| ribose-phosphate pyrophosphokinase [Escherichia coli 55989]
 gi|218699914|ref|YP_002407543.1| ribose-phosphate pyrophosphokinase [Escherichia coli IAI39]
 gi|218704729|ref|YP_002412248.1| ribose-phosphate pyrophosphokinase [Escherichia coli UMN026]
 gi|238900438|ref|YP_002926234.1| phosphoribosylpyrophosphate synthase [Escherichia coli BW2952]
 gi|254161289|ref|YP_003044397.1| ribose-phosphate pyrophosphokinase [Escherichia coli B str. REL606]
 gi|254792677|ref|YP_003077514.1| ribose-phosphate pyrophosphokinase [Escherichia coli O157:H7 str.
           TW14359]
 gi|260843499|ref|YP_003221277.1| phosphoribosylpyrophosphate synthase [Escherichia coli O103:H2 str.
           12009]
 gi|260854868|ref|YP_003228759.1| phosphoribosylpyrophosphate synthase [Escherichia coli O26:H11 str.
           11368]
 gi|260867612|ref|YP_003234014.1| phosphoribosylpyrophosphate synthase [Escherichia coli O111:H- str.
           11128]
 gi|291282232|ref|YP_003499050.1| Ribose-phosphate pyrophosphokinase [Escherichia coli O55:H7 str.
           CB9615]
 gi|293414484|ref|ZP_06657133.1| ribose-phosphate pyrophosphokinase [Escherichia coli B185]
 gi|301029491|ref|ZP_07192572.1| ribose-phosphate diphosphokinase [Escherichia coli MS 196-1]
 gi|312966447|ref|ZP_07780669.1| ribose-phosphate pyrophosphokinase [Escherichia coli 2362-75]
 gi|331667591|ref|ZP_08368455.1| ribose-phosphate pyrophosphokinase (RPPK)
           (Phosphoribosylpyrophosphate synthetase) (P-Rib-PP
           synthetase) (PRPP synthetase) [Escherichia coli TA271]
 gi|67466690|sp|P0A717|KPRS_ECOLI RecName: Full=Ribose-phosphate pyrophosphokinase; Short=RPPK;
           AltName: Full=Phosphoribosyl pyrophosphate synthase;
           Short=P-Rib-PP synthase; Short=PRPP synthase
 gi|67466691|sp|P0A718|KPRS_ECOL6 RecName: Full=Ribose-phosphate pyrophosphokinase; Short=RPPK;
           AltName: Full=Phosphoribosyl pyrophosphate synthase;
           Short=P-Rib-PP synthase; Short=PRPP synthase
 gi|67466692|sp|P0A719|KPRS_ECO57 RecName: Full=Ribose-phosphate pyrophosphokinase; Short=RPPK;
           AltName: Full=Phosphoribosyl pyrophosphate synthase;
           Short=P-Rib-PP synthase; Short=PRPP synthase
 gi|1787458|gb|AAC74291.1| phosphoribosylpyrophosphate synthase [Escherichia coli str. K-12
           substr. MG1655]
 gi|4062790|dbj|BAA36065.1| phosphoribosylpyrophosphate synthase [Escherichia coli str. K12
           substr. W3110]
 gi|13361177|dbj|BAB35135.1| phosphoribosylpyrophosphate synthetase [Escherichia coli O157:H7
           str. Sakai]
 gi|73855930|gb|AAZ88637.1| phosphoribosylpyrophosphate synthetase [Shigella sonnei Ss046]
 gi|81240695|gb|ABB61405.1| phosphoribosylpyrophosphate synthetase [Shigella dysenteriae Sd197]
 gi|81245750|gb|ABB66458.1| phosphoribosylpyrophosphate synthetase [Shigella boydii Sb227]
 gi|86516954|gb|ABC98169.1| PrsA [Shigella boydii]
 gi|86516958|gb|ABC98171.1| PrsA [Shigella boydii]
 gi|86516960|gb|ABC98172.1| PrsA [Shigella boydii]
 gi|86516962|gb|ABC98173.1| PrsA [Shigella boydii]
 gi|86516966|gb|ABC98175.1| PrsA [Shigella boydii]
 gi|86516970|gb|ABC98177.1| PrsA [Shigella boydii]
 gi|86516974|gb|ABC98179.1| PrsA [Shigella boydii]
 gi|86516978|gb|ABC98181.1| PrsA [Shigella boydii]
 gi|86516988|gb|ABC98186.1| PrsA [Shigella dysenteriae]
 gi|86516998|gb|ABC98191.1| PrsA [Shigella dysenteriae]
 gi|86517000|gb|ABC98192.1| PrsA [Shigella dysenteriae]
 gi|86517018|gb|ABC98201.1| PrsA [Shigella flexneri]
 gi|86517024|gb|ABC98204.1| PrsA [Escherichia coli]
 gi|86517028|gb|ABC98206.1| PrsA [Escherichia coli]
 gi|110343029|gb|ABG69266.1| ribose-phosphate pyrophosphokinase [Escherichia coli 536]
 gi|157066392|gb|ABV05647.1| ribose-phosphate pyrophosphokinase [Escherichia coli HS]
 gi|157078724|gb|ABV18432.1| ribose-phosphate pyrophosphokinase [Escherichia coli E24377A]
 gi|169755354|gb|ACA78053.1| ribose-phosphate pyrophosphokinase [Escherichia coli ATCC 8739]
 gi|169888670|gb|ACB02377.1| phosphoribosylpyrophosphate synthase [Escherichia coli str. K-12
           substr. DH10B]
 gi|170122972|gb|EDS91903.1| ribose-phosphate pyrophosphokinase [Escherichia albertii TW07627]
 gi|188491329|gb|EDU66432.1| ribose-phosphate pyrophosphokinase [Escherichia coli 53638]
 gi|188999991|gb|EDU68977.1| ribose-phosphate pyrophosphokinase [Escherichia coli O157:H7 str.
           EC4076]
 gi|189356371|gb|EDU74790.1| ribose-phosphate pyrophosphokinase [Escherichia coli O157:H7 str.
           EC4401]
 gi|189360096|gb|EDU78515.1| ribose-phosphate pyrophosphokinase [Escherichia coli O157:H7 str.
           EC4486]
 gi|189365591|gb|EDU84007.1| ribose-phosphate pyrophosphokinase [Escherichia coli O157:H7 str.
           EC4501]
 gi|189372542|gb|EDU90958.1| ribose-phosphate pyrophosphokinase [Escherichia coli O157:H7 str.
           EC869]
 gi|189375871|gb|EDU94287.1| ribose-phosphate pyrophosphokinase [Escherichia coli O157:H7 str.
           EC508]
 gi|190908762|gb|EDV68350.1| ribose-phosphate pyrophosphokinase [Escherichia coli F11]
 gi|192955506|gb|EDV85986.1| ribose-phosphate pyrophosphokinase [Escherichia coli E110019]
 gi|194416025|gb|EDX32291.1| ribose-phosphate pyrophosphokinase [Escherichia coli B171]
 gi|194423910|gb|EDX39898.1| ribose-phosphate pyrophosphokinase [Escherichia coli 101-1]
 gi|208726274|gb|EDZ75875.1| ribose-phosphate pyrophosphokinase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208732626|gb|EDZ81314.1| ribose-phosphate pyrophosphokinase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208737902|gb|EDZ85585.1| ribose-phosphate pyrophosphokinase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209159606|gb|ACI37039.1| ribose-phosphate pyrophosphokinase [Escherichia coli O157:H7 str.
           EC4115]
 gi|209772568|gb|ACI84596.1| phosphoribosylpyrophosphate synthetase [Escherichia coli]
 gi|209772570|gb|ACI84597.1| phosphoribosylpyrophosphate synthetase [Escherichia coli]
 gi|209772572|gb|ACI84598.1| phosphoribosylpyrophosphate synthetase [Escherichia coli]
 gi|209772574|gb|ACI84599.1| phosphoribosylpyrophosphate synthetase [Escherichia coli]
 gi|209772576|gb|ACI84600.1| phosphoribosylpyrophosphate synthetase [Escherichia coli]
 gi|209911707|dbj|BAG76781.1| phosphoribosylpyrophosphate synthase [Escherichia coli SE11]
 gi|215264511|emb|CAS08878.1| phosphoribosylpyrophosphate synthase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217318563|gb|EEC26989.1| ribose-phosphate pyrophosphokinase [Escherichia coli O157:H7 str.
           TW14588]
 gi|218351453|emb|CAU97161.1| phosphoribosylpyrophosphate synthase [Escherichia coli 55989]
 gi|218356643|emb|CAQ89269.1| phosphoribosylpyrophosphate synthase [Escherichia fergusonii ATCC
           35469]
 gi|218360529|emb|CAQ98087.1| phosphoribosylpyrophosphate synthase [Escherichia coli IAI1]
 gi|218364905|emb|CAR02601.1| phosphoribosylpyrophosphate synthase [Escherichia coli S88]
 gi|218369900|emb|CAR17675.1| phosphoribosylpyrophosphate synthase [Escherichia coli IAI39]
 gi|218426718|emb|CAR07555.1| phosphoribosylpyrophosphate synthase [Escherichia coli ED1a]
 gi|218431826|emb|CAR12711.1| phosphoribosylpyrophosphate synthase [Escherichia coli UMN026]
 gi|222033006|emb|CAP75746.1| ribose-phosphate pyrophosphokinase [Escherichia coli LF82]
 gi|238862064|gb|ACR64062.1| phosphoribosylpyrophosphate synthase [Escherichia coli BW2952]
 gi|242376986|emb|CAQ31709.1| ribose-phosphate diphosphokinase [Escherichia coli BL21(DE3)]
 gi|253973190|gb|ACT38861.1| ribose-phosphate pyrophosphokinase [Escherichia coli B str. REL606]
 gi|253977404|gb|ACT43074.1| ribose-phosphate pyrophosphokinase [Escherichia coli BL21(DE3)]
 gi|254592077|gb|ACT71438.1| phosphoribosylpyrophosphate synthase [Escherichia coli O157:H7 str.
           TW14359]
 gi|257753517|dbj|BAI25019.1| phosphoribosylpyrophosphate synthase [Escherichia coli O26:H11 str.
           11368]
 gi|257758646|dbj|BAI30143.1| phosphoribosylpyrophosphate synthase [Escherichia coli O103:H2 str.
           12009]
 gi|257763968|dbj|BAI35463.1| phosphoribosylpyrophosphate synthase [Escherichia coli O111:H- str.
           11128]
 gi|281178393|dbj|BAI54723.1| phosphoribosylpyrophosphate synthetase [Escherichia coli SE15]
 gi|284921019|emb|CBG34084.1| ribose-phosphate pyrophosphokinase [Escherichia coli 042]
 gi|290762105|gb|ADD56066.1| Ribose-phosphate pyrophosphokinase [Escherichia coli O55:H7 str.
           CB9615]
 gi|291434542|gb|EFF07515.1| ribose-phosphate pyrophosphokinase [Escherichia coli B185]
 gi|294494090|gb|ADE92846.1| ribose-phosphate pyrophosphokinase [Escherichia coli IHE3034]
 gi|299877599|gb|EFI85810.1| ribose-phosphate diphosphokinase [Escherichia coli MS 196-1]
 gi|307553262|gb|ADN46037.1| ribose-phosphate pyrophosphokinase [Escherichia coli ABU 83972]
 gi|309701506|emb|CBJ00813.1| ribose-phosphate pyrophosphokinase [Escherichia coli ETEC H10407]
 gi|312288900|gb|EFR16798.1| ribose-phosphate pyrophosphokinase [Escherichia coli 2362-75]
 gi|320181786|gb|EFW56696.1| Ribose-phosphate pyrophosphokinase [Shigella boydii ATCC 9905]
 gi|320185610|gb|EFW60372.1| Ribose-phosphate pyrophosphokinase [Shigella flexneri CDC 796-83]
 gi|320187999|gb|EFW62666.1| Ribose-phosphate pyrophosphokinase [Escherichia coli O157:H7 str.
           EC1212]
 gi|320199246|gb|EFW73837.1| Ribose-phosphate pyrophosphokinase [Escherichia coli EC4100B]
 gi|323153194|gb|EFZ39456.1| ribose-phosphate pyrophosphokinase [Escherichia coli EPECa14]
 gi|323179278|gb|EFZ64848.1| ribose-phosphate pyrophosphokinase [Escherichia coli 1180]
 gi|323378978|gb|ADX51246.1| ribose-phosphate pyrophosphokinase [Escherichia coli KO11]
 gi|323937928|gb|EGB34192.1| ribose-phosphate diphosphokinase [Escherichia coli E1520]
 gi|323942486|gb|EGB38654.1| ribose-phosphate diphosphokinase [Escherichia coli E482]
 gi|323947510|gb|EGB43514.1| ribose-phosphate diphosphokinase [Escherichia coli H120]
 gi|323949676|gb|EGB45562.1| ribose-phosphate diphosphokinase [Escherichia coli H252]
 gi|323962785|gb|EGB58363.1| ribose-phosphate diphosphokinase [Escherichia coli H489]
 gi|323973395|gb|EGB68582.1| ribose-phosphate diphosphokinase [Escherichia coli TA007]
 gi|323977222|gb|EGB72309.1| ribose-phosphate diphosphokinase [Escherichia coli TW10509]
 gi|324113966|gb|EGC07940.1| ribose-phosphate diphosphokinase [Escherichia fergusonii B253]
 gi|324117245|gb|EGC11152.1| ribose-phosphate diphosphokinase [Escherichia coli E1167]
 gi|325497518|gb|EGC95377.1| ribose-phosphate pyrophosphokinase [Escherichia fergusonii ECD227]
 gi|326342755|gb|EGD66525.1| Ribose-phosphate pyrophosphokinase [Escherichia coli O157:H7 str.
           1044]
 gi|326346392|gb|EGD70129.1| Ribose-phosphate pyrophosphokinase [Escherichia coli O157:H7 str.
           1125]
 gi|327253897|gb|EGE65526.1| ribose-phosphate pyrophosphokinase [Escherichia coli STEC_7v]
 gi|330911074|gb|EGH39584.1| ribose-phosphate pyrophosphokinase [Escherichia coli AA86]
 gi|331065176|gb|EGI37071.1| ribose-phosphate pyrophosphokinase (RPPK)
           (Phosphoribosylpyrophosphate synthetase) (P-Rib-PP
           synthetase) (PRPP synthetase) [Escherichia coli TA271]
 gi|332092247|gb|EGI97324.1| ribose-phosphate pyrophosphokinase [Shigella boydii 5216-82]
 gi|332094744|gb|EGI99788.1| ribose-phosphate pyrophosphokinase [Shigella boydii 3594-74]
 gi|332098369|gb|EGJ03342.1| ribose-phosphate pyrophosphokinase [Shigella dysenteriae 155-74]
 gi|332342789|gb|AEE56123.1| ribose-phosphate pyrophosphokinase [Escherichia coli UMNK88]
          Length = 315

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|269959405|ref|ZP_06173788.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269835842|gb|EEZ89918.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 241

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/56 (25%), Positives = 26/56 (46%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF +       V    + ++DDV TTG+T +     L + G  ++ I    R+
Sbjct: 184 LKGAFTL----QGEVNFSHVAIVDDVVTTGSTVRQLCHLLLEVGVESIDIYCICRT 235


>gi|330718603|ref|ZP_08313203.1| amidophosphoribosyltransferase [Leuconostoc fallax KCTC 3537]
          Length = 542

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 1/56 (1%)

Query: 4   AFNVPQYVSKHV-AGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           A  +   V   V  G  I+LIDD    G T+      LK+AGA +V +   S   K
Sbjct: 360 AVRMKLSVVDDVVRGKNIVLIDDSIVRGTTSMYIVRMLKEAGAKSVHVRIASPVFK 415


>gi|227886371|ref|ZP_04004176.1| ribose-phosphate pyrophosphokinase [Escherichia coli 83972]
 gi|300816898|ref|ZP_07097118.1| ribose-phosphate diphosphokinase [Escherichia coli MS 107-1]
 gi|300821023|ref|ZP_07101172.1| ribose-phosphate diphosphokinase [Escherichia coli MS 119-7]
 gi|300896595|ref|ZP_07115114.1| ribose-phosphate diphosphokinase [Escherichia coli MS 198-1]
 gi|300906886|ref|ZP_07124560.1| ribose-phosphate diphosphokinase [Escherichia coli MS 84-1]
 gi|300920405|ref|ZP_07136839.1| ribose-phosphate diphosphokinase [Escherichia coli MS 115-1]
 gi|300921827|ref|ZP_07137984.1| ribose-phosphate diphosphokinase [Escherichia coli MS 182-1]
 gi|300928247|ref|ZP_07143784.1| ribose-phosphate diphosphokinase [Escherichia coli MS 187-1]
 gi|300939557|ref|ZP_07154214.1| ribose-phosphate diphosphokinase [Escherichia coli MS 21-1]
 gi|300951674|ref|ZP_07165498.1| ribose-phosphate diphosphokinase [Escherichia coli MS 116-1]
 gi|300955607|ref|ZP_07167964.1| ribose-phosphate diphosphokinase [Escherichia coli MS 175-1]
 gi|300971924|ref|ZP_07171712.1| ribose-phosphate diphosphokinase [Escherichia coli MS 45-1]
 gi|300995970|ref|ZP_07181332.1| ribose-phosphate diphosphokinase [Escherichia coli MS 200-1]
 gi|301017239|ref|ZP_07182020.1| ribose-phosphate diphosphokinase [Escherichia coli MS 69-1]
 gi|301305577|ref|ZP_07211668.1| ribose-phosphate diphosphokinase [Escherichia coli MS 124-1]
 gi|301327077|ref|ZP_07220359.1| ribose-phosphate diphosphokinase [Escherichia coli MS 78-1]
 gi|301648140|ref|ZP_07247893.1| ribose-phosphate diphosphokinase [Escherichia coli MS 146-1]
 gi|309794298|ref|ZP_07688722.1| ribose-phosphate diphosphokinase [Escherichia coli MS 145-7]
 gi|227836575|gb|EEJ47041.1| ribose-phosphate pyrophosphokinase [Escherichia coli 83972]
 gi|300304667|gb|EFJ59187.1| ribose-phosphate diphosphokinase [Escherichia coli MS 200-1]
 gi|300317500|gb|EFJ67284.1| ribose-phosphate diphosphokinase [Escherichia coli MS 175-1]
 gi|300359538|gb|EFJ75408.1| ribose-phosphate diphosphokinase [Escherichia coli MS 198-1]
 gi|300400370|gb|EFJ83908.1| ribose-phosphate diphosphokinase [Escherichia coli MS 69-1]
 gi|300401319|gb|EFJ84857.1| ribose-phosphate diphosphokinase [Escherichia coli MS 84-1]
 gi|300411049|gb|EFJ94587.1| ribose-phosphate diphosphokinase [Escherichia coli MS 45-1]
 gi|300412538|gb|EFJ95848.1| ribose-phosphate diphosphokinase [Escherichia coli MS 115-1]
 gi|300421753|gb|EFK05064.1| ribose-phosphate diphosphokinase [Escherichia coli MS 182-1]
 gi|300449120|gb|EFK12740.1| ribose-phosphate diphosphokinase [Escherichia coli MS 116-1]
 gi|300455561|gb|EFK19054.1| ribose-phosphate diphosphokinase [Escherichia coli MS 21-1]
 gi|300463716|gb|EFK27209.1| ribose-phosphate diphosphokinase [Escherichia coli MS 187-1]
 gi|300526322|gb|EFK47391.1| ribose-phosphate diphosphokinase [Escherichia coli MS 119-7]
 gi|300530672|gb|EFK51734.1| ribose-phosphate diphosphokinase [Escherichia coli MS 107-1]
 gi|300839166|gb|EFK66926.1| ribose-phosphate diphosphokinase [Escherichia coli MS 124-1]
 gi|300846330|gb|EFK74090.1| ribose-phosphate diphosphokinase [Escherichia coli MS 78-1]
 gi|301073726|gb|EFK88532.1| ribose-phosphate diphosphokinase [Escherichia coli MS 146-1]
 gi|308122203|gb|EFO59465.1| ribose-phosphate diphosphokinase [Escherichia coli MS 145-7]
 gi|315254834|gb|EFU34802.1| ribose-phosphate diphosphokinase [Escherichia coli MS 85-1]
 gi|315288572|gb|EFU47970.1| ribose-phosphate diphosphokinase [Escherichia coli MS 110-3]
 gi|315290785|gb|EFU50157.1| ribose-phosphate diphosphokinase [Escherichia coli MS 153-1]
 gi|315297341|gb|EFU56621.1| ribose-phosphate diphosphokinase [Escherichia coli MS 16-3]
 gi|324006004|gb|EGB75223.1| ribose-phosphate diphosphokinase [Escherichia coli MS 57-2]
 gi|324015643|gb|EGB84862.1| ribose-phosphate diphosphokinase [Escherichia coli MS 60-1]
 gi|324017543|gb|EGB86762.1| ribose-phosphate diphosphokinase [Escherichia coli MS 117-3]
          Length = 321

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 212 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 260


>gi|239917082|ref|YP_002956640.1| ribose-phosphate pyrophosphokinase [Micrococcus luteus NCTC 2665]
 gi|281414456|ref|ZP_06246198.1| ribose-phosphate pyrophosphokinase [Micrococcus luteus NCTC 2665]
 gi|239838289|gb|ACS30086.1| ribose-phosphate pyrophosphokinase [Micrococcus luteus NCTC 2665]
          Length = 326

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 22/52 (42%)

Query: 8   PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            + V   V G   +LIDD+  TG T   A   LK AGA  V I        +
Sbjct: 214 SKTVVGDVEGRVCVLIDDMIDTGGTIAGAVRILKDAGAKDVIIAATHAVFSE 265


>gi|90406880|ref|ZP_01215072.1| hypoxanthine-guanine phosphoribosyltransferase [Psychromonas sp.
           CNPT3]
 gi|90312117|gb|EAS40210.1| hypoxanthine-guanine phosphoribosyltransferase [Psychromonas sp.
           CNPT3]
          Length = 175

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 8/53 (15%), Positives = 22/53 (41%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           +     + + + + +    +L+++D+  TG T +     L      +V+I   
Sbjct: 74  VAGEVKILKELDEEIRDKDVLIVEDIIDTGNTLEKIKEMLLLRDPKSVTICAL 126


>gi|259503235|ref|ZP_05746137.1| hypoxanthine phosphoribosyltransferase [Lactobacillus antri DSM
           16041]
 gi|259168796|gb|EEW53291.1| hypoxanthine phosphoribosyltransferase [Lactobacillus antri DSM
           16041]
          Length = 196

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +S  V G  +L+I+D+  TG T +  A      GA ++   + 
Sbjct: 94  GRVRLLRDLSHDVDGRPVLIIEDIVDTGHTLQFLAKLFASRGAKSIETCSL 144


>gi|255994797|ref|ZP_05427932.1| ribose-phosphate pyrophosphokinase [Eubacterium saphenum ATCC
           49989]
 gi|255993510|gb|EEU03599.1| ribose-phosphate pyrophosphokinase [Eubacterium saphenum ATCC
           49989]
          Length = 313

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 20/46 (43%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
             VAG   +LIDD+  T  T   A  AL++ G   V +      L 
Sbjct: 209 GDVAGKDCILIDDMIDTAGTIVSAIDALREKGCKKVYVCATHPVLS 254


>gi|221632326|ref|YP_002521547.1| putative bifunctional protein tilS/hprT [Thermomicrobium roseum DSM
           5159]
 gi|221156484|gb|ACM05611.1| putative bifunctional protein tilS/hprT [Thermomicrobium roseum DSM
           5159]
          Length = 695

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 9/56 (16%), Positives = 26/56 (46%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
               + + + + + G  +LL++D+  +G T +     L++    ++ ++   R  K
Sbjct: 594 GVVRIIKDLDRPIEGRDVLLVEDIIDSGLTLQYLLDVLQRRNPRSLRVVVLLRKQK 649


>gi|315160784|gb|EFU04801.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX0645]
          Length = 181

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +  +V G  IL+++D+  +G T        +   A +V I+T 
Sbjct: 78  GEVKIVKDLDTNVEGRHILIVEDIIDSGRTLAYLVDLFRYRKAASVKIVTL 128


>gi|308175887|ref|YP_003915293.1| hypoxanthine phosphoribosyltransferase [Arthrobacter arilaitensis
           Re117]
 gi|307743350|emb|CBT74322.1| hypoxanthine phosphoribosyltransferase [Arthrobacter arilaitensis
           Re117]
          Length = 183

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 10/53 (18%), Positives = 22/53 (41%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + +   + G  +L+++D+  +G T       L+  G  +V I    R
Sbjct: 82  GVVRILKDLDSDLMGKHVLIVEDIIDSGLTLSWLKSNLESRGPASVEICALLR 134


>gi|213163407|ref|ZP_03349117.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
          Length = 175

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 66  HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 114


>gi|187934669|ref|YP_001885202.1| hypoxanthine phosphoribosyltransferase [Clostridium botulinum B
           str. Eklund 17B]
 gi|187722822|gb|ACD24043.1| hypoxanthine phosphoribosyltransferase [Clostridium botulinum B
           str. Eklund 17B]
          Length = 173

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 21/51 (41%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               V   +  ++ G  +L++DD+  TG T       +K  GA +V     
Sbjct: 77  GKVKVINDIPDNIEGYDVLIVDDIIDTGITMNFVVNHVKSLGAASVKTCVL 127


>gi|183219661|ref|YP_001837657.1| ribose-phosphate pyrophosphokinase [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
 gi|189909798|ref|YP_001961353.1| ribose-phosphate pyrophosphokinase [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Ames)']
 gi|167774474|gb|ABZ92775.1| Ribose-phosphate diphosphokinase [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167778083|gb|ABZ96381.1| Ribose-phosphate pyrophosphokinase (Phosphoribosyl pyrophosphate
           synthetase) [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
          Length = 313

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 24/53 (45%)

Query: 6   NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +V  +V   +     LL+DD+  TG T   AA AL + GA +V        L 
Sbjct: 202 SVVMHVIGDIKDKNCLLLDDMIDTGGTIAKAATALYENGAKSVLCCASHGVLS 254


>gi|147379|gb|AAA24431.1| phosphoribosylpyrophosphate synthetase (gtg start codon; EC
           2.7.6.1) [Escherichia coli]
          Length = 315

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|73667912|ref|YP_303927.1| ribose-phosphate pyrophosphokinase [Methanosarcina barkeri str.
           Fusaro]
 gi|72395074|gb|AAZ69347.1| ribose-phosphate pyrophosphokinase [Methanosarcina barkeri str.
           Fusaro]
          Length = 283

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 24/57 (42%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +     V +  +  V G  ++L+DD+  TG T   +   L+  GA  V I      L
Sbjct: 185 LSGDTVVIKTKNLDVTGRNVVLVDDMIATGGTMAESIKMLRSQGAADVYIACVHPVL 241


>gi|312135429|ref|YP_004002767.1| phosphoribosyltransferase [Caldicellulosiruptor owensensis OL]
 gi|311775480|gb|ADQ04967.1| phosphoribosyltransferase [Caldicellulosiruptor owensensis OL]
          Length = 231

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/40 (37%), Positives = 24/40 (60%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           + G KI+L+DD++TTGAT    +  L + GA  V +   +
Sbjct: 186 IKGKKIILVDDIFTTGATTNECSKVLLENGAKCVFVSVLA 225


>gi|303324185|ref|XP_003072080.1| amidophosphoribosyltransferase, putative [Coccidioides posadasii
           C735 delta SOWgp]
 gi|240111790|gb|EER29935.1| amidophosphoribosyltransferase, putative [Coccidioides posadasii
           C735 delta SOWgp]
 gi|320037074|gb|EFW19012.1| amidophosphoribosyltransferase [Coccidioides posadasii str.
           Silveira]
          Length = 580

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 12/56 (21%), Positives = 24/56 (42%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +        +     G  +LL+DD    G T++      ++AGA TV   + + ++
Sbjct: 353 KGVRRKLNAMKSEFKGRNVLLVDDSIVRGTTSREIVTMAREAGAKTVHFASCAPAI 408


>gi|299820646|ref|ZP_07052535.1| hypoxanthine phosphoribosyltransferase [Listeria grayi DSM 20601]
 gi|299817667|gb|EFI84902.1| hypoxanthine phosphoribosyltransferase [Listeria grayi DSM 20601]
          Length = 646

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + ++  V G  +L+I+D+  +G T       +K   A +V ++T 
Sbjct: 544 GEVKIIKDLNTSVEGRDVLIIEDIIDSGRTLSYLVDLIKYRKAKSVKLVTL 594


>gi|167751929|ref|ZP_02424056.1| hypothetical protein ALIPUT_00171 [Alistipes putredinis DSM 17216]
 gi|167660170|gb|EDS04300.1| hypothetical protein ALIPUT_00171 [Alistipes putredinis DSM 17216]
          Length = 313

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 13/46 (28%), Positives = 20/46 (43%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
             V G  ++++DD+  T  T   AA  L + GA +V        L 
Sbjct: 208 GDVKGRNVIIVDDMIDTAGTICMAADMLMEKGAKSVRAAITHPILS 253


>gi|37680953|ref|NP_935562.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio vulnificus
           YJ016]
 gi|326423861|ref|NP_760527.2| hypoxanthine phosphoribosyltransferase [Vibrio vulnificus CMCP6]
 gi|37199703|dbj|BAC95533.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio vulnificus
           YJ016]
 gi|319999233|gb|AAO10054.2| hypoxanthine phosphoribosyltransferase [Vibrio vulnificus CMCP6]
          Length = 176

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 9/49 (18%), Positives = 20/49 (40%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
             + + +   + G  +L+++D+  TG T       L      ++ I T 
Sbjct: 79  VRILKDLDDDIKGKDVLIVEDIIDTGNTLNKIKEILSLREPKSIEICTL 127


>gi|89101008|ref|ZP_01173851.1| amidophosphoribosyltransferase [Bacillus sp. NRRL B-14911]
 gi|89084269|gb|EAR63427.1| amidophosphoribosyltransferase [Bacillus sp. NRRL B-14911]
          Length = 470

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 27/50 (54%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            V   V G +++++DD    G T++     L++AGA  V ++  S  +K+
Sbjct: 341 PVRGVVEGKRVIMVDDSIVRGTTSRRIVTMLREAGATEVHVVISSPPIKN 390


>gi|329577261|gb|EGG58725.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX1467]
          Length = 193

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +  +V G  IL+++D+  +G T        +   A +V I+T 
Sbjct: 78  GEVKIVKDLDTNVEGRHILIVEDIIDSGRTLAYLVDLFRYRKAASVKIVTL 128


>gi|299782767|gb|ADJ40765.1| Amidophosphoribosyltransferase [Lactobacillus fermentum CECT 5716]
          Length = 423

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 23/42 (54%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51
            V   V G +++++DD    G T+K     L++AGA  V +L
Sbjct: 279 AVRGVVEGKRVIVVDDSIVRGTTSKQIVQMLRRAGAKEVHLL 320


>gi|258621061|ref|ZP_05716095.1| Ribose-phosphate pyrophosphokinase [Vibrio mimicus VM573]
 gi|258626133|ref|ZP_05720981.1| Ribose-phosphate pyrophosphokinase [Vibrio mimicus VM603]
 gi|258581488|gb|EEW06389.1| Ribose-phosphate pyrophosphokinase [Vibrio mimicus VM603]
 gi|258586449|gb|EEW11164.1| Ribose-phosphate pyrophosphokinase [Vibrio mimicus VM573]
          Length = 311

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 21/48 (43%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +   V G   +++DD+  TG T   AA ALK+ GA  V          
Sbjct: 204 LIGDVEGRDCVIVDDMIDTGGTLCKAAEALKERGAKRVFAYATHAVFS 251


>gi|146311987|ref|YP_001177061.1| ribose-phosphate pyrophosphokinase [Enterobacter sp. 638]
 gi|145318863|gb|ABP61010.1| ribose-phosphate pyrophosphokinase [Enterobacter sp. 638]
          Length = 315

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|91224983|ref|ZP_01260242.1| ComF-related protein [Vibrio alginolyticus 12G01]
 gi|91190229|gb|EAS76499.1| ComF-related protein [Vibrio alginolyticus 12G01]
          Length = 180

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 13/56 (23%), Positives = 26/56 (46%), Gaps = 4/56 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           ++ AF + +          + ++DDV TTG+T +     L + G  ++ I    R+
Sbjct: 123 LKGAFILNKQPHSS----HVAIVDDVVTTGSTVRQLCHLLLEVGVESIDIYCICRT 174


>gi|314936738|ref|ZP_07844085.1| amidophosphoribosyltransferase [Staphylococcus hominis subsp.
           hominis C80]
 gi|313655357|gb|EFS19102.1| amidophosphoribosyltransferase [Staphylococcus hominis subsp.
           hominis C80]
          Length = 494

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/41 (36%), Positives = 20/41 (48%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
            V   V G  I+L+DD    G T+K     LK AGA  + +
Sbjct: 342 AVKDIVEGKDIILVDDSIVRGTTSKRIVRMLKDAGANKIHV 382


>gi|308186581|ref|YP_003930712.1| phosphoribosylpyrophosphate synthetase [Pantoea vagans C9-1]
 gi|308057091|gb|ADO09263.1| Phosphoribosylpyrophosphate synthetase [Pantoea vagans C9-1]
          Length = 337

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 228 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 276


>gi|227522409|ref|ZP_03952458.1| hypoxanthine phosphoribosyltransferase [Lactobacillus hilgardii
           ATCC 8290]
 gi|227090467|gb|EEI25779.1| hypoxanthine phosphoribosyltransferase [Lactobacillus hilgardii
           ATCC 8290]
          Length = 180

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 26/51 (50%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
              ++   +S  V+G  +L+I+D+  TG T K     L K GA ++ + T 
Sbjct: 77  GKVDLVTDISTDVSGRDVLIIEDIVDTGRTLKFLMDNLTKRGARSIKVCTL 127


>gi|157736743|ref|YP_001489426.1| ribose-phosphate pyrophosphokinase [Arcobacter butzleri RM4018]
 gi|315635919|ref|ZP_07891181.1| phosphoribosyl pyrophosphate synthetase [Arcobacter butzleri JV22]
 gi|157698597|gb|ABV66757.1| ribose-phosphate pyrophosphokinase [Arcobacter butzleri RM4018]
 gi|315479898|gb|EFU70569.1| phosphoribosyl pyrophosphate synthetase [Arcobacter butzleri JV22]
          Length = 310

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 21/46 (45%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
             V G  ++L+DD+  T  T   AA  LKK GA +V        L 
Sbjct: 207 GEVKGKDVILVDDMVDTAGTLVKAAEVLKKRGATSVMACCTHGVLS 252


>gi|91077334|ref|XP_974850.1| PREDICTED: similar to AGAP000179-PA [Tribolium castaneum]
 gi|270001665|gb|EEZ98112.1| hypothetical protein TcasGA2_TC000530 [Tribolium castaneum]
          Length = 502

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/49 (36%), Positives = 24/49 (48%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            +S +V G +I+LIDD    G T       L++ GA  V I   S  LK
Sbjct: 377 PISTNVKGKRIILIDDSIVRGNTIGPIIKLLRRVGAKEVHIRVASPPLK 425


>gi|86516950|gb|ABC98167.1| PrsA [Shigella boydii]
          Length = 315

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|70734363|ref|YP_262243.1| ribose-phosphate pyrophosphokinase [Pseudomonas fluorescens Pf-5]
 gi|312958845|ref|ZP_07773364.1| ribose-phosphate pyrophosphokinase [Pseudomonas fluorescens WH6]
 gi|68348662|gb|AAY96268.1| ribose-phosphate pyrophosphokinase [Pseudomonas fluorescens Pf-5]
 gi|311286615|gb|EFQ65177.1| ribose-phosphate pyrophosphokinase [Pseudomonas fluorescens WH6]
          Length = 313

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 22/49 (44%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +L+DD+  T  T   AA ALK+ GA  V        L 
Sbjct: 205 HIIGDVEGRTCILVDDMVDTAGTLCHAAKALKEHGAAKVFAYCTHPVLS 253


>gi|330811724|ref|YP_004356186.1| ribose-phosphate diphosphokinase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327379832|gb|AEA71182.1| Ribose-phosphate diphosphokinase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 313

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 22/49 (44%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +L+DD+  T  T   AA ALK+ GA  V        L 
Sbjct: 205 HIIGDVEGRTCILVDDMVDTAGTLCHAAKALKEHGAAKVFAYCTHPVLS 253


>gi|317129004|ref|YP_004095286.1| ribose-phosphate pyrophosphokinase [Bacillus cellulosilyticus DSM
           2522]
 gi|315473952|gb|ADU30555.1| ribose-phosphate pyrophosphokinase [Bacillus cellulosilyticus DSM
           2522]
          Length = 317

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 22/50 (44%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            +   V+G   ++IDD+  T  T   A+ AL + GA  V        L +
Sbjct: 210 EIMGDVSGKTAIIIDDMVDTARTVTTASNALIERGAKEVYACCTHPVLSE 259


>gi|238922946|ref|YP_002936459.1| hypoxanthine phosphoribosyltransferase [Eubacterium rectale ATCC
           33656]
 gi|238874618|gb|ACR74325.1| hypoxanthine phosphoribosyltransferase [Eubacterium rectale ATCC
           33656]
 gi|291523832|emb|CBK89419.1| hypoxanthine phosphoribosyltransferase [Eubacterium rectale DSM
           17629]
 gi|291528700|emb|CBK94286.1| hypoxanthine phosphoribosyltransferase [Eubacterium rectale M104/1]
          Length = 181

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 9/51 (17%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   + G  +++I+D+  +G T    +  L K    +++I T 
Sbjct: 80  GDVKIKKDLEHSIEGENVIIIEDIIDSGNTLSRLSKLLAKRNPKSLTICTL 130


>gi|237785154|ref|YP_002905859.1| ribose-phosphate pyrophosphokinase [Corynebacterium kroppenstedtii
           DSM 44385]
 gi|237758066|gb|ACR17316.1| ribose-phosphate pyrophosphokinase [Corynebacterium kroppenstedtii
           DSM 44385]
          Length = 330

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 24/52 (46%)

Query: 8   PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
              V   V+G   +L+DD+  TG T   A   L++AGA  V I T      D
Sbjct: 222 SNRVVGDVSGRTCVLLDDMIDTGGTIAGAVKVLREAGANDVIIATTHGVFSD 273


>gi|195612222|gb|ACG27941.1| bifunctional protein tilS/hprT [Zea mays]
          Length = 193

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 26/48 (54%)

Query: 6   NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
            +   +   VAG  +++++D+  TG T       L+K GA ++S+ TF
Sbjct: 85  RITADLKVDVAGKHVVVVEDIVDTGNTLSYLIAHLEKKGASSISVCTF 132


>gi|205375046|ref|ZP_03227837.1| late competence protein [Bacillus coahuilensis m4-4]
          Length = 226

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/43 (37%), Positives = 27/43 (62%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           + +   ++LL+DD+YTTG T   A+  L + GA +V++ T  R
Sbjct: 183 EEIKQQRVLLVDDIYTTGVTVHSASEVLYRHGAKSVAVFTLVR 225


>gi|297580715|ref|ZP_06942641.1| hypoxanthine phosphoribosyltransferase [Vibrio cholerae RC385]
 gi|297535131|gb|EFH73966.1| hypoxanthine phosphoribosyltransferase [Vibrio cholerae RC385]
          Length = 177

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 10/49 (20%), Positives = 20/49 (40%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
             + + +   + G  +LL++D+  TG T       L      ++ I T 
Sbjct: 79  VRILKDLDDDIKGKDVLLVEDIIDTGNTLNKVKEILALREPKSICICTL 127


>gi|332297305|ref|YP_004439227.1| amidophosphoribosyltransferase [Treponema brennaborense DSM 12168]
 gi|332180408|gb|AEE16096.1| amidophosphoribosyltransferase [Treponema brennaborense DSM 12168]
          Length = 483

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 25/55 (45%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            F     +   VAG ++++IDD    G T +     L+KAGA  V     S  +K
Sbjct: 351 VFVKLNAMKSDVAGKRVVIIDDSIVRGTTCRRLIQILRKAGAKEVHFRVSSPPVK 405


>gi|300723049|ref|YP_003712347.1| phosphoribosylpyrophosphate synthetase [Xenorhabdus nematophila
           ATCC 19061]
 gi|297629564|emb|CBJ90167.1| phosphoribosylpyrophosphate synthetase [Xenorhabdus nematophila
           ATCC 19061]
          Length = 315

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|317048560|ref|YP_004116208.1| ribose-phosphate pyrophosphokinase [Pantoea sp. At-9b]
 gi|316950177|gb|ADU69652.1| ribose-phosphate pyrophosphokinase [Pantoea sp. At-9b]
          Length = 315

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|57233732|ref|YP_182161.1| comF family protein, putative [Dehalococcoides ethenogenes 195]
 gi|57224180|gb|AAW39237.1| comF family protein, putative [Dehalococcoides ethenogenes 195]
          Length = 233

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 27/37 (72%)

Query: 19  KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++++IDDV TTGAT    A  LK+AGA++V  LT +R
Sbjct: 195 RVIIIDDVATTGATLNACAATLKEAGALSVWGLTIAR 231


>gi|22127774|ref|NP_671197.1| gluconate periplasmic binding protein [Yersinia pestis KIM 10]
 gi|45439991|ref|NP_991530.1| gluconate periplasmic binding protein [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51598062|ref|YP_072253.1| gluconate periplasmic binding protein [Yersinia pseudotuberculosis
           IP 32953]
 gi|108809332|ref|YP_653248.1| gluconate periplasmic binding protein [Yersinia pestis Antiqua]
 gi|108814097|ref|YP_649864.1| gluconate periplasmic binding protein [Yersinia pestis Nepal516]
 gi|145597378|ref|YP_001161453.1| gluconate periplasmic binding protein [Yersinia pestis Pestoides F]
 gi|150260810|ref|ZP_01917538.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system [Yersinia
           pestis CA88-4125]
 gi|153950702|ref|YP_001402937.1| gluconate periplasmic binding protein [Yersinia pseudotuberculosis
           IP 31758]
 gi|162418117|ref|YP_001608064.1| gluconate periplasmic binding protein [Yersinia pestis Angola]
 gi|165928029|ref|ZP_02223861.1| protein GntX [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165936172|ref|ZP_02224741.1| protein GntX [Yersinia pestis biovar Orientalis str. IP275]
 gi|166010516|ref|ZP_02231414.1| protein GntX [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166214583|ref|ZP_02240618.1| protein GntX [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167398382|ref|ZP_02303906.1| protein GntX [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167419085|ref|ZP_02310838.1| protein GntX [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167426498|ref|ZP_02318251.1| protein GntX [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|170022425|ref|YP_001718930.1| gluconate periplasmic binding protein [Yersinia pseudotuberculosis
           YPIII]
 gi|186897262|ref|YP_001874374.1| gluconate periplasmic binding protein [Yersinia pseudotuberculosis
           PB1/+]
 gi|218927339|ref|YP_002345214.1| gluconate periplasmic binding protein [Yersinia pestis CO92]
 gi|229836392|ref|ZP_04456559.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system [Yersinia
           pestis Pestoides A]
 gi|229839983|ref|ZP_04460142.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system [Yersinia
           pestis biovar Orientalis str. PEXU2]
 gi|229842064|ref|ZP_04462219.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system [Yersinia
           pestis biovar Orientalis str. India 195]
 gi|229904635|ref|ZP_04519746.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system [Yersinia
           pestis Nepal516]
 gi|270488150|ref|ZP_06205224.1| ComF family protein [Yersinia pestis KIM D27]
 gi|294502221|ref|YP_003566283.1| hypothetical protein YPZ3_0111 [Yersinia pestis Z176003]
 gi|21960902|gb|AAM87448.1|AE013995_3 hypothetical protein y3906 [Yersinia pestis KIM 10]
 gi|45434846|gb|AAS60407.1| Predicted amidophosphoribosyltransferases [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51591344|emb|CAH23010.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP
           32953]
 gi|108777745|gb|ABG20264.1| hypothetical protein YPN_3937 [Yersinia pestis Nepal516]
 gi|108781245|gb|ABG15303.1| hypothetical protein YPA_3341 [Yersinia pestis Antiqua]
 gi|115345950|emb|CAL18814.1| conserved hypothetical protein [Yersinia pestis CO92]
 gi|145209074|gb|ABP38481.1| hypothetical protein YPDSF_0055 [Yersinia pestis Pestoides F]
 gi|149290218|gb|EDM40295.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system [Yersinia
           pestis CA88-4125]
 gi|152962197|gb|ABS49658.1| protein GntX [Yersinia pseudotuberculosis IP 31758]
 gi|162350932|gb|ABX84880.1| protein GntX [Yersinia pestis Angola]
 gi|165915786|gb|EDR34394.1| protein GntX [Yersinia pestis biovar Orientalis str. IP275]
 gi|165919978|gb|EDR37279.1| protein GntX [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165990606|gb|EDR42907.1| protein GntX [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166204238|gb|EDR48718.1| protein GntX [Yersinia pestis biovar Antiqua str. B42003004]
 gi|166963079|gb|EDR59100.1| protein GntX [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167050886|gb|EDR62294.1| protein GntX [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167054486|gb|EDR64294.1| protein GntX [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|169748959|gb|ACA66477.1| protein GntX [Yersinia pseudotuberculosis YPIII]
 gi|186700288|gb|ACC90917.1| conserved hypothetical protein [Yersinia pseudotuberculosis PB1/+]
 gi|229678753|gb|EEO74858.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system [Yersinia
           pestis Nepal516]
 gi|229690374|gb|EEO82428.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system [Yersinia
           pestis biovar Orientalis str. India 195]
 gi|229696349|gb|EEO86396.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system [Yersinia
           pestis biovar Orientalis str. PEXU2]
 gi|229706460|gb|EEO92467.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system [Yersinia
           pestis Pestoides A]
 gi|262360300|gb|ACY57021.1| hypothetical protein YPD4_0112 [Yersinia pestis D106004]
 gi|262364250|gb|ACY60807.1| hypothetical protein YPD8_0117 [Yersinia pestis D182038]
 gi|270336654|gb|EFA47431.1| ComF family protein [Yersinia pestis KIM D27]
 gi|294352680|gb|ADE63021.1| hypothetical protein YPZ3_0111 [Yersinia pestis Z176003]
 gi|320013263|gb|ADV96834.1| gluconate periplasmic binding protein with
           phosphoribosyltransferase domain, GNT I system [Yersinia
           pestis biovar Medievalis str. Harbin 35]
          Length = 233

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 4/57 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +R  F   +     V G  I L+DDV TTG+T    A  L   G  ++ I +  R+L
Sbjct: 181 VRGIFRCAE----SVRGQHIALLDDVVTTGSTLNEIAHLLWAQGIASLQIWSVCRTL 233


>gi|29374905|ref|NP_814058.1| hypoxanthine-guanine phosphoribosyltransferase [Enterococcus
           faecalis V583]
 gi|227520049|ref|ZP_03950098.1| hypoxanthine-guanine phosphoribosyltransferase [Enterococcus
           faecalis TX0104]
 gi|227555910|ref|ZP_03985957.1| hypoxanthine-guanine phosphoribosyltransferase [Enterococcus
           faecalis HH22]
 gi|255971764|ref|ZP_05422350.1| hypoxanthine-guanine phosphoribosyltransferase [Enterococcus
           faecalis T1]
 gi|255974764|ref|ZP_05425350.1| hypoxanthine-guanine phosphoribosyltransferase [Enterococcus
           faecalis T2]
 gi|256762059|ref|ZP_05502639.1| hypoxanthine-guanine phosphoribosyltransferase [Enterococcus
           faecalis T3]
 gi|256960613|ref|ZP_05564784.1| hypoxanthine-guanine phosphoribosyltransferase [Enterococcus
           faecalis Merz96]
 gi|256964187|ref|ZP_05568358.1| hypoxanthine-guanine phosphoribosyltransferase [Enterococcus
           faecalis HIP11704]
 gi|257078477|ref|ZP_05572838.1| hypoxanthine-guanine phosphoribosyltransferase [Enterococcus
           faecalis JH1]
 gi|257421553|ref|ZP_05598543.1| hypoxanthine-guanine phosphoribosyltransferase [Enterococcus
           faecalis X98]
 gi|293382700|ref|ZP_06628625.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis R712]
 gi|293388118|ref|ZP_06632645.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis S613]
 gi|294779310|ref|ZP_06744713.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           PC1.1]
 gi|300862031|ref|ZP_07108111.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis TUSoD
           Ef11]
 gi|307268517|ref|ZP_07549892.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX4248]
 gi|307274228|ref|ZP_07555436.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX0855]
 gi|307276453|ref|ZP_07557576.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX2134]
 gi|307278663|ref|ZP_07559733.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX0860]
 gi|307286957|ref|ZP_07567032.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX0109]
 gi|312901064|ref|ZP_07760353.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX0470]
 gi|312904627|ref|ZP_07763782.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX0635]
 gi|312908596|ref|ZP_07767538.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis DAPTO
           512]
 gi|312909256|ref|ZP_07768113.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis DAPTO
           516]
 gi|312952664|ref|ZP_07771528.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX0102]
 gi|76363194|sp|Q839B2|HPRT_ENTFA RecName: Full=Hypoxanthine-guanine phosphoribosyltransferase;
           Short=HGPRT; Short=HGPRTase
 gi|29342363|gb|AAO80129.1| hypoxanthine-guanine phosphoribosyltransferase [Enterococcus
           faecalis V583]
 gi|227072597|gb|EEI10560.1| hypoxanthine-guanine phosphoribosyltransferase [Enterococcus
           faecalis TX0104]
 gi|227174967|gb|EEI55939.1| hypoxanthine-guanine phosphoribosyltransferase [Enterococcus
           faecalis HH22]
 gi|255962782|gb|EET95258.1| hypoxanthine-guanine phosphoribosyltransferase [Enterococcus
           faecalis T1]
 gi|255967636|gb|EET98258.1| hypoxanthine-guanine phosphoribosyltransferase [Enterococcus
           faecalis T2]
 gi|256683310|gb|EEU23005.1| hypoxanthine-guanine phosphoribosyltransferase [Enterococcus
           faecalis T3]
 gi|256951109|gb|EEU67741.1| hypoxanthine-guanine phosphoribosyltransferase [Enterococcus
           faecalis Merz96]
 gi|256954683|gb|EEU71315.1| hypoxanthine-guanine phosphoribosyltransferase [Enterococcus
           faecalis HIP11704]
 gi|256986507|gb|EEU73809.1| hypoxanthine-guanine phosphoribosyltransferase [Enterococcus
           faecalis JH1]
 gi|257163377|gb|EEU93337.1| hypoxanthine-guanine phosphoribosyltransferase [Enterococcus
           faecalis X98]
 gi|291079860|gb|EFE17224.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis R712]
 gi|291082494|gb|EFE19457.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis S613]
 gi|294453596|gb|EFG21995.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           PC1.1]
 gi|295112549|emb|CBL31186.1| hypoxanthine phosphoribosyltransferase [Enterococcus sp. 7L76]
 gi|300848556|gb|EFK76313.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis TUSoD
           Ef11]
 gi|306501903|gb|EFM71192.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX0109]
 gi|306504723|gb|EFM73923.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX0860]
 gi|306506933|gb|EFM76080.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX2134]
 gi|306509190|gb|EFM78252.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX0855]
 gi|306515178|gb|EFM83718.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX4248]
 gi|310625383|gb|EFQ08666.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis DAPTO
           512]
 gi|310629452|gb|EFQ12735.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX0102]
 gi|310631979|gb|EFQ15262.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX0635]
 gi|311290498|gb|EFQ69054.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis DAPTO
           516]
 gi|311291810|gb|EFQ70366.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX0470]
 gi|315026778|gb|EFT38710.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX2137]
 gi|315032984|gb|EFT44916.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX0017]
 gi|315036603|gb|EFT48535.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX0027]
 gi|315145394|gb|EFT89410.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX2141]
 gi|315147114|gb|EFT91130.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX4244]
 gi|315151133|gb|EFT95149.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX0012]
 gi|315153552|gb|EFT97568.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX0031]
 gi|315156268|gb|EFU00285.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX0043]
 gi|315158587|gb|EFU02604.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX0312]
 gi|315165844|gb|EFU09861.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX1302]
 gi|315168157|gb|EFU12174.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX1341]
 gi|315171403|gb|EFU15420.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX1342]
 gi|315172636|gb|EFU16653.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX1346]
 gi|315573572|gb|EFU85763.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX0309B]
 gi|315579383|gb|EFU91574.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX0630]
 gi|315582080|gb|EFU94271.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX0309A]
 gi|323479477|gb|ADX78916.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis 62]
 gi|327534061|gb|AEA92895.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           OG1RF]
          Length = 181

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +  +V G  IL+++D+  +G T        +   A +V I+T 
Sbjct: 78  GEVKIVKDLDTNVEGRHILIVEDIIDSGRTLAYLVDLFRYRKAASVKIVTL 128


>gi|110639861|ref|YP_680071.1| amidophosphoribosyltransferase [Cytophaga hutchinsonii ATCC 33406]
 gi|110282542|gb|ABG60728.1| amidophosphoribosyltransferase [Cytophaga hutchinsonii ATCC 33406]
          Length = 236

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/44 (47%), Positives = 27/44 (61%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           + VAG  ILL+DDV TTGAT +   + LK AGA  VS+   +  
Sbjct: 191 EKVAGKHILLVDDVLTTGATLEACGLLLKNAGAAKVSVALLAMV 234


>gi|255023442|ref|ZP_05295428.1| amidophosphoribosyltransferase [Listeria monocytogenes FSL
          J1-208]
          Length = 181

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/41 (34%), Positives = 22/41 (53%)

Query: 10 YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
           V   V G ++++IDD    G T+K     L++AGA  V +
Sbjct: 47 AVRGVVEGKRVVMIDDSIVRGTTSKRIVQLLREAGAAEVHV 87


>gi|223700287|gb|ACN20207.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700291|gb|ACN20210.1| amidophoshoribosyltransferase [Listeria monocytogenes]
          Length = 152

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/41 (34%), Positives = 22/41 (53%)

Query: 10 YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
           V   V G ++++IDD    G T+K     L++AGA  V +
Sbjct: 18 AVRGVVEGKRVVMIDDSIVRGTTSKRIVQLLREAGAAEVHV 58


>gi|223699995|gb|ACN19988.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223699999|gb|ACN19991.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700003|gb|ACN19994.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700007|gb|ACN19997.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700011|gb|ACN20000.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700015|gb|ACN20003.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700019|gb|ACN20006.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700023|gb|ACN20009.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700027|gb|ACN20012.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700031|gb|ACN20015.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700035|gb|ACN20018.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700039|gb|ACN20021.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700043|gb|ACN20024.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700047|gb|ACN20027.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700051|gb|ACN20030.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700055|gb|ACN20033.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700059|gb|ACN20036.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700063|gb|ACN20039.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700067|gb|ACN20042.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700071|gb|ACN20045.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700075|gb|ACN20048.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700079|gb|ACN20051.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700083|gb|ACN20054.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700087|gb|ACN20057.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700091|gb|ACN20060.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700095|gb|ACN20063.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700099|gb|ACN20066.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700103|gb|ACN20069.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700107|gb|ACN20072.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700111|gb|ACN20075.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700115|gb|ACN20078.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700119|gb|ACN20081.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700123|gb|ACN20084.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700127|gb|ACN20087.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700131|gb|ACN20090.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700135|gb|ACN20093.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700139|gb|ACN20096.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700143|gb|ACN20099.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700147|gb|ACN20102.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700151|gb|ACN20105.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700155|gb|ACN20108.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700159|gb|ACN20111.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700163|gb|ACN20114.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700167|gb|ACN20117.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700171|gb|ACN20120.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700175|gb|ACN20123.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700179|gb|ACN20126.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700183|gb|ACN20129.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700187|gb|ACN20132.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700191|gb|ACN20135.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700195|gb|ACN20138.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700199|gb|ACN20141.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700203|gb|ACN20144.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700207|gb|ACN20147.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700211|gb|ACN20150.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700215|gb|ACN20153.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700219|gb|ACN20156.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700223|gb|ACN20159.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700227|gb|ACN20162.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700231|gb|ACN20165.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700235|gb|ACN20168.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700239|gb|ACN20171.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700243|gb|ACN20174.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700247|gb|ACN20177.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700251|gb|ACN20180.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700255|gb|ACN20183.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700259|gb|ACN20186.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700263|gb|ACN20189.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700267|gb|ACN20192.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700271|gb|ACN20195.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700275|gb|ACN20198.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700279|gb|ACN20201.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700283|gb|ACN20204.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700295|gb|ACN20213.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700299|gb|ACN20216.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700303|gb|ACN20219.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700307|gb|ACN20222.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700311|gb|ACN20225.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700315|gb|ACN20228.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700319|gb|ACN20231.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700323|gb|ACN20234.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700327|gb|ACN20237.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700331|gb|ACN20240.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700335|gb|ACN20243.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700339|gb|ACN20246.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700343|gb|ACN20249.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700347|gb|ACN20252.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700351|gb|ACN20255.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700355|gb|ACN20258.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700359|gb|ACN20261.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700363|gb|ACN20264.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700367|gb|ACN20267.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700371|gb|ACN20270.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700375|gb|ACN20273.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700379|gb|ACN20276.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700383|gb|ACN20279.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700387|gb|ACN20282.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700391|gb|ACN20285.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700395|gb|ACN20288.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700399|gb|ACN20291.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700403|gb|ACN20294.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700407|gb|ACN20297.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700411|gb|ACN20300.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700415|gb|ACN20303.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700419|gb|ACN20306.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700423|gb|ACN20309.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700427|gb|ACN20312.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700431|gb|ACN20315.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700435|gb|ACN20318.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700439|gb|ACN20321.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700443|gb|ACN20324.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700447|gb|ACN20327.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700451|gb|ACN20330.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700455|gb|ACN20333.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700459|gb|ACN20336.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700463|gb|ACN20339.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700467|gb|ACN20342.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700471|gb|ACN20345.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700475|gb|ACN20348.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700479|gb|ACN20351.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700483|gb|ACN20354.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700487|gb|ACN20357.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700491|gb|ACN20360.1| amidophoshoribosyltransferase [Listeria monocytogenes]
 gi|223700495|gb|ACN20363.1| amidophoshoribosyltransferase [Listeria monocytogenes]
          Length = 152

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/41 (34%), Positives = 22/41 (53%)

Query: 10 YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
           V   V G ++++IDD    G T+K     L++AGA  V +
Sbjct: 18 AVRGVVEGKRVVMIDDSIVRGTTSKRIVQLLREAGAAEVHV 58


>gi|149369578|ref|ZP_01889430.1| ribose-phosphate pyrophosphokinase [unidentified eubacterium SCB49]
 gi|149357005|gb|EDM45560.1| ribose-phosphate pyrophosphokinase [unidentified eubacterium SCB49]
          Length = 312

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 13/49 (26%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            +   V G  ++L+DD+  T  T   AA  + + GA++V  +     L 
Sbjct: 206 ELIGDVKGKNVVLVDDMVDTAGTLTKAADLMMERGALSVRAICTHPILS 254


>gi|326383817|ref|ZP_08205502.1| ribose-phosphate pyrophosphokinase [Gordonia neofelifaecis NRRL
           B-59395]
 gi|326197581|gb|EGD54770.1| ribose-phosphate pyrophosphokinase [Gordonia neofelifaecis NRRL
           B-59395]
          Length = 325

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 23/52 (44%)

Query: 8   PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
              V   VAG   +LIDD+  TG T   A   LK AGA  V I T      D
Sbjct: 213 SNRVVGDVAGKTCVLIDDMIDTGGTIAGAVSVLKDAGAGDVIIATTHGVFSD 264


>gi|228474346|ref|ZP_04059081.1| amidophosphoribosyltransferase [Staphylococcus hominis SK119]
 gi|228271705|gb|EEK13052.1| amidophosphoribosyltransferase [Staphylococcus hominis SK119]
          Length = 494

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/41 (36%), Positives = 20/41 (48%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
            V   V G  I+L+DD    G T+K     LK AGA  + +
Sbjct: 342 AVKDIVEGKDIILVDDSIVRGTTSKRIVRMLKDAGANKIHV 382


>gi|149277499|ref|ZP_01883640.1| putative amidophosphoribosyl-transferase [Pedobacter sp. BAL39]
 gi|149231732|gb|EDM37110.1| putative amidophosphoribosyl-transferase [Pedobacter sp. BAL39]
          Length = 232

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           M++ F V       +    ILL+DDV TTGAT +  A+ L + G   +SI   +
Sbjct: 178 MKSVFAVCD--ETALKDKHILLVDDVITTGATIEACALELHRCGIRKLSIFALA 229


>gi|110803175|ref|YP_699238.1| hypoxanthine phosphoribosyltransferase [Clostridium perfringens
           SM101]
 gi|110683676|gb|ABG87046.1| hypoxanthine phosphoribosyltransferase [Clostridium perfringens
           SM101]
          Length = 174

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               V   +  ++ GL +L++DD+  +G T       +K  GA +V   T 
Sbjct: 77  GIVKVVNDIPDNIEGLDVLIVDDIIDSGITMDFVINHVKSLGAKSVKTCTL 127


>gi|301046856|ref|ZP_07193973.1| ribose-phosphate diphosphokinase [Escherichia coli MS 185-1]
 gi|300301224|gb|EFJ57609.1| ribose-phosphate diphosphokinase [Escherichia coli MS 185-1]
          Length = 321

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 212 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 260


>gi|283954477|ref|ZP_06371997.1| ribose-phosphate pyrophosphokinase [Campylobacter jejuni subsp.
           jejuni 414]
 gi|283794094|gb|EFC32843.1| ribose-phosphate pyrophosphokinase [Campylobacter jejuni subsp.
           jejuni 414]
          Length = 308

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 22/46 (47%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
             V   +++L+DD+  T  T   AA ALK+ GA +V        L 
Sbjct: 207 GDVKDKEVILVDDIIDTAGTMVKAAEALKEKGAKSVMACCTHAVLS 252


>gi|123442671|ref|YP_001006648.1| ribose-phosphate pyrophosphokinase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|238751557|ref|ZP_04613048.1| Ribose-phosphate pyrophosphokinase [Yersinia rohdei ATCC 43380]
 gi|238756931|ref|ZP_04618119.1| Ribose-phosphate pyrophosphokinase [Yersinia aldovae ATCC 35236]
 gi|238763005|ref|ZP_04623972.1| Ribose-phosphate pyrophosphokinase [Yersinia kristensenii ATCC
           33638]
 gi|238783266|ref|ZP_04627291.1| Ribose-phosphate pyrophosphokinase [Yersinia bercovieri ATCC 43970]
 gi|238792547|ref|ZP_04636180.1| Ribose-phosphate pyrophosphokinase [Yersinia intermedia ATCC 29909]
 gi|238797826|ref|ZP_04641319.1| Ribose-phosphate pyrophosphokinase [Yersinia mollaretii ATCC 43969]
 gi|332161447|ref|YP_004298024.1| ribose-phosphate pyrophosphokinase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|122089632|emb|CAL12482.1| ribose-phosphate pyrophosphokinase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|238698763|gb|EEP91513.1| Ribose-phosphate pyrophosphokinase [Yersinia kristensenii ATCC
           33638]
 gi|238704761|gb|EEP97290.1| Ribose-phosphate pyrophosphokinase [Yersinia aldovae ATCC 35236]
 gi|238710275|gb|EEQ02502.1| Ribose-phosphate pyrophosphokinase [Yersinia rohdei ATCC 43380]
 gi|238715859|gb|EEQ07846.1| Ribose-phosphate pyrophosphokinase [Yersinia bercovieri ATCC 43970]
 gi|238718354|gb|EEQ10177.1| Ribose-phosphate pyrophosphokinase [Yersinia mollaretii ATCC 43969]
 gi|238728182|gb|EEQ19703.1| Ribose-phosphate pyrophosphokinase [Yersinia intermedia ATCC 29909]
 gi|318605424|emb|CBY26922.1| ribose-phosphate pyrophosphokinase [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325665677|gb|ADZ42321.1| ribose-phosphate pyrophosphokinase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
          Length = 315

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|23011405|ref|ZP_00051772.1| COG0462: Phosphoribosylpyrophosphate synthetase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 191

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 23/54 (42%)

Query: 6   NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            V   V   V G   +L+DD+  TG T   A   +  AGA +V +      L D
Sbjct: 77  AVANRVVGDVEGRDCVLVDDLIDTGGTIAEAVRVILAAGARSVIVAATHGVLSD 130


>gi|327481912|gb|AEA85222.1| ribose-phosphate pyrophosphokinase [Pseudomonas stutzeri DSM 4166]
          Length = 329

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 21/49 (42%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   + G   +L+DD+  T  T   AA ALK  GA  V        L 
Sbjct: 221 HIIGDIEGRTCILVDDMVDTAGTLCHAAKALKDHGAAKVYAYCTHPILS 269


>gi|317491748|ref|ZP_07950183.1| ribose-phosphate diphosphokinase [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316920182|gb|EFV41506.1| ribose-phosphate diphosphokinase [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 315

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|293376994|ref|ZP_06623205.1| amidophosphoribosyltransferase [Enterococcus faecium PC4.1]
 gi|292644363|gb|EFF62462.1| amidophosphoribosyltransferase [Enterococcus faecium PC4.1]
          Length = 398

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 25/49 (51%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            V   V G K++++DD    G T++     LK+AGA  V +   S  LK
Sbjct: 343 AVRGVVEGKKVIMVDDSIVRGTTSRRIVHLLKEAGAKEVHVRIASPPLK 391


>gi|218901266|ref|YP_002449100.1| hypoxanthine phosphoribosyltransferase [Bacillus cereus AH820]
 gi|300119159|ref|ZP_07056860.1| hypoxanthine phosphoribosyltransferase [Bacillus cereus SJ1]
 gi|218539957|gb|ACK92355.1| hypoxanthine phosphoribosyltransferase [Bacillus cereus AH820]
 gi|298723481|gb|EFI64222.1| hypoxanthine phosphoribosyltransferase [Bacillus cereus SJ1]
          Length = 180

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V G  IL+++D+  +G T        K   A +V I+T 
Sbjct: 78  GEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTL 128


>gi|313206314|ref|YP_004045491.1| phosphoribosyltransferase [Riemerella anatipestifer DSM 15868]
 gi|312445630|gb|ADQ81985.1| phosphoribosyltransferase [Riemerella anatipestifer DSM 15868]
 gi|315023180|gb|EFT36191.1| competence protein [Riemerella anatipestifer RA-YM]
 gi|325336241|gb|ADZ12515.1| phosphoribosyltransferase [Riemerella anatipestifer RA-GD]
          Length = 217

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 23/54 (42%), Positives = 29/54 (53%), Gaps = 4/54 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54
           M+N F+V     + + G  ILLIDDVYTTG T   A   L K     VS+L  +
Sbjct: 165 MQNIFSV----DEKIEGKHILLIDDVYTTGNTMSKAVWELLKGNGNQVSVLVLA 214


>gi|257868113|ref|ZP_05647766.1| ribose-phosphate pyrophosphokinase [Enterococcus casseliflavus
           EC30]
 gi|257874612|ref|ZP_05654265.1| ribose-phosphate pyrophosphokinase [Enterococcus casseliflavus
           EC10]
 gi|257877722|ref|ZP_05657375.1| ribose-phosphate pyrophosphokinase [Enterococcus casseliflavus
           EC20]
 gi|257802227|gb|EEV31099.1| ribose-phosphate pyrophosphokinase [Enterococcus casseliflavus
           EC30]
 gi|257808776|gb|EEV37598.1| ribose-phosphate pyrophosphokinase [Enterococcus casseliflavus
           EC10]
 gi|257811888|gb|EEV40708.1| ribose-phosphate pyrophosphokinase [Enterococcus casseliflavus
           EC20]
          Length = 324

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 23/46 (50%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            HV G   +LIDD+  T  T   AA ALK+AGA +V        L 
Sbjct: 215 GHVEGKTCVLIDDMIDTAGTITLAANALKQAGAKSVYASCTHPVLS 260


>gi|228989272|ref|ZP_04149265.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus
           pseudomycoides DSM 12442]
 gi|228995455|ref|ZP_04155125.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus mycoides
           Rock3-17]
 gi|229003076|ref|ZP_04160929.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus mycoides
           Rock1-4]
 gi|229083383|ref|ZP_04215733.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus cereus
           Rock3-44]
 gi|228699919|gb|EEL52554.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus cereus
           Rock3-44]
 gi|228758179|gb|EEM07371.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus mycoides
           Rock1-4]
 gi|228764316|gb|EEM13193.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus mycoides
           Rock3-17]
 gi|228770482|gb|EEM19053.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus
           pseudomycoides DSM 12442]
          Length = 179

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V G  IL+++D+  +G T        K   A +V I+T 
Sbjct: 77  GEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTL 127


>gi|323339726|ref|ZP_08079996.1| amidophosphoribosyltransferase [Lactobacillus ruminis ATCC 25644]
 gi|323092805|gb|EFZ35407.1| amidophosphoribosyltransferase [Lactobacillus ruminis ATCC 25644]
          Length = 485

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            V   V G ++ +IDD    G T+      LK+AGA  V +   S  LK
Sbjct: 343 AVRGVVEGKRVAIIDDSIVRGTTSMQIVRMLKEAGAKEVHMRIASPPLK 391


>gi|168208662|ref|ZP_02634287.1| hypoxanthine phosphoribosyltransferase [Clostridium perfringens B
           str. ATCC 3626]
 gi|170713026|gb|EDT25208.1| hypoxanthine phosphoribosyltransferase [Clostridium perfringens B
           str. ATCC 3626]
          Length = 174

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               V   +  ++ GL +L++DD+  +G T       +K  GA +V   T 
Sbjct: 77  GIVKVVNDIPDNIEGLDVLIVDDIIDSGITMDFVINHVKSLGAKSVKTCTL 127


>gi|157370228|ref|YP_001478217.1| ribose-phosphate pyrophosphokinase [Serratia proteamaculans 568]
 gi|157321992|gb|ABV41089.1| ribose-phosphate pyrophosphokinase [Serratia proteamaculans 568]
          Length = 315

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|293404750|ref|ZP_06648742.1| ribose-phosphate pyrophosphokinase [Escherichia coli FVEC1412]
 gi|293409594|ref|ZP_06653170.1| conserved hypothetical protein [Escherichia coli B354]
 gi|293433523|ref|ZP_06661951.1| ribose-phosphate pyrophosphokinase [Escherichia coli B088]
 gi|298380393|ref|ZP_06989992.1| ribose-phosphate pyrophosphokinase [Escherichia coli FVEC1302]
 gi|309789165|ref|ZP_07683758.1| ribose-phosphate pyrophosphokinase [Shigella dysenteriae 1617]
 gi|312971394|ref|ZP_07785569.1| ribose-phosphate pyrophosphokinase [Escherichia coli 1827-70]
 gi|291324342|gb|EFE63764.1| ribose-phosphate pyrophosphokinase [Escherichia coli B088]
 gi|291426958|gb|EFE99984.1| ribose-phosphate pyrophosphokinase [Escherichia coli FVEC1412]
 gi|291470062|gb|EFF12546.1| conserved hypothetical protein [Escherichia coli B354]
 gi|298277835|gb|EFI19349.1| ribose-phosphate pyrophosphokinase [Escherichia coli FVEC1302]
 gi|308922919|gb|EFP68433.1| ribose-phosphate pyrophosphokinase [Shigella dysenteriae 1617]
 gi|310335991|gb|EFQ01191.1| ribose-phosphate pyrophosphokinase [Escherichia coli 1827-70]
 gi|315615951|gb|EFU96577.1| ribose-phosphate pyrophosphokinase [Escherichia coli 3431]
 gi|323162268|gb|EFZ48126.1| ribose-phosphate pyrophosphokinase [Escherichia coli E128010]
 gi|323168377|gb|EFZ54058.1| ribose-phosphate pyrophosphokinase [Shigella sonnei 53G]
 gi|323172440|gb|EFZ58077.1| ribose-phosphate pyrophosphokinase [Escherichia coli LT-68]
 gi|323185631|gb|EFZ70992.1| ribose-phosphate pyrophosphokinase [Escherichia coli 1357]
 gi|323187437|gb|EFZ72746.1| ribose-phosphate pyrophosphokinase [Escherichia coli RN587/1]
          Length = 312

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 203 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 251


>gi|86516956|gb|ABC98170.1| PrsA [Shigella boydii]
          Length = 315

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|332158399|ref|YP_004423678.1| amidophosphoribosyltransferase [Pyrococcus sp. NA2]
 gi|331033862|gb|AEC51674.1| amidophosphoribosyltransferase [Pyrococcus sp. NA2]
          Length = 445

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/41 (34%), Positives = 21/41 (51%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
            V K V G +++L+DD    G T +     L+ AGA  V +
Sbjct: 327 PVKKVVEGKRVVLVDDSIVRGTTMRRIVRMLRDAGAREVHV 367


>gi|222152228|ref|YP_002561403.1| amidophosphoribosyltransferase [Streptococcus uberis 0140J]
 gi|222113039|emb|CAR40368.1| putative amidophosphoribosyltransferase precursor [Streptococcus
           uberis 0140J]
          Length = 484

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 13/42 (30%), Positives = 23/42 (54%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51
            VS  V G +++++DD    G T++     L++AGA  V + 
Sbjct: 343 AVSGVVKGKRVVMVDDSIVRGTTSRRIVSLLREAGAKEVHVA 384


>gi|196039439|ref|ZP_03106744.1| comF operon protein 3 [Bacillus cereus NVH0597-99]
 gi|196029599|gb|EDX68201.1| comF operon protein 3 [Bacillus cereus NVH0597-99]
          Length = 190

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/45 (46%), Positives = 24/45 (53%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
            +   G  ILL+DDVYTTG T +     L   GA  VS LT  RS
Sbjct: 146 EEMFHGQHILLVDDVYTTGITVRQIGSLLYDRGAKEVSSLTLCRS 190


>gi|77460974|ref|YP_350481.1| ribose-phosphate pyrophosphokinase [Pseudomonas fluorescens Pf0-1]
 gi|77384977|gb|ABA76490.1| ribose-phosphate pyrophosphokinase [Pseudomonas fluorescens Pf0-1]
          Length = 310

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 22/49 (44%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +L+DD+  T  T   AA ALK+ GA  V        L 
Sbjct: 202 HIIGDVEGRTCILVDDMVDTAGTLCHAAKALKEHGAAKVFAYCTHPVLS 250


>gi|152973912|ref|YP_001373429.1| hypoxanthine-guanine phosphoribosyltransferase [Bacillus cereus
           subsp. cytotoxis NVH 391-98]
 gi|152022664|gb|ABS20434.1| hypoxanthine phosphoribosyltransferase [Bacillus cytotoxicus NVH
           391-98]
          Length = 180

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V G  IL+++D+  +G T        K   A +V I+T 
Sbjct: 78  GEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTL 128


>gi|295095632|emb|CBK84722.1| ribose-phosphate pyrophosphokinase [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 321

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 212 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 260


>gi|261212300|ref|ZP_05926586.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio sp. RC341]
 gi|260838908|gb|EEX65559.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio sp. RC341]
          Length = 177

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 10/49 (20%), Positives = 20/49 (40%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
             + + +   + G  +LL++D+  TG T       L      ++ I T 
Sbjct: 79  VRILKDLDDDIKGKDVLLVEDIIDTGNTLNKVKEILALREPKSIRICTL 127


>gi|241889670|ref|ZP_04776968.1| amidophosphoribosyltransferase [Gemella haemolysans ATCC 10379]
 gi|241863292|gb|EER67676.1| amidophosphoribosyltransferase [Gemella haemolysans ATCC 10379]
          Length = 483

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/41 (39%), Positives = 20/41 (48%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
            V   V G  I+L+DD    G T K     LK+AGA  V +
Sbjct: 340 PVRGVVQGKSIVLVDDSIVRGTTCKRIVKMLKEAGAREVHV 380


>gi|227545124|ref|ZP_03975173.1| competence protein FC [Lactobacillus reuteri CF48-3A]
 gi|300909205|ref|ZP_07126666.1| competence protein FC [Lactobacillus reuteri SD2112]
 gi|227184912|gb|EEI64983.1| competence protein FC [Lactobacillus reuteri CF48-3A]
 gi|300893070|gb|EFK86429.1| competence protein FC [Lactobacillus reuteri SD2112]
          Length = 226

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 26/46 (56%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
              + V   K+LL+DDVYTTG T   AA   K+AG   +  ++ +R
Sbjct: 181 DAPEKVINKKVLLVDDVYTTGRTLYHAANLFKQAGCKEIGSVSLAR 226


>gi|205371980|ref|ZP_03224798.1| hypoxanthine phosphoribosyltransferase [Bacillus coahuilensis m4-4]
          Length = 181

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V G  IL+++D+  +G T    A   +   A ++ I+T 
Sbjct: 77  GEVKIVKDLDTKVEGRDILIVEDIIDSGLTLSYLAELFRYRKAKSIKIVTL 127


>gi|124513326|ref|XP_001350019.1| ribose-phosphate pyrophosphokinase, putative [Plasmodium falciparum
           3D7]
 gi|23615436|emb|CAD52427.1| ribose-phosphate pyrophosphokinase, putative [Plasmodium falciparum
           3D7]
          Length = 560

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/47 (29%), Positives = 22/47 (46%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
             + G   +L+DD+  TG  ++  A  LK AGA  + +      L D
Sbjct: 446 GDIKGCDCILVDDIIDTGEKSQKVAAILKNAGARKIYLYATHAILSD 492


>gi|16760673|ref|NP_456290.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|16765121|ref|NP_460736.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|29141568|ref|NP_804910.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|161613721|ref|YP_001587686.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|168237837|ref|ZP_02662895.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|168241365|ref|ZP_02666297.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168820521|ref|ZP_02832521.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|194443225|ref|YP_002041032.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194450469|ref|YP_002045825.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194469964|ref|ZP_03075948.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194735902|ref|YP_002114812.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195873230|ref|ZP_02696672.2| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197249386|ref|YP_002146247.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197265029|ref|ZP_03165103.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|198244774|ref|YP_002215363.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|200390249|ref|ZP_03216860.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204927636|ref|ZP_03218837.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205357392|ref|ZP_02347364.2| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205357928|ref|ZP_02574321.2| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205358757|ref|ZP_02658872.2| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205360281|ref|ZP_02681965.2| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|207856713|ref|YP_002243364.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|283785504|ref|YP_003365369.1| ribose-phosphate pyrophosphokinase [Citrobacter rodentium ICC168]
 gi|311279349|ref|YP_003941580.1| ribose-phosphate pyrophosphokinase [Enterobacter cloacae SCF1]
 gi|60392584|sp|P0A1V6|KPRS_SALTY RecName: Full=Ribose-phosphate pyrophosphokinase; Short=RPPK;
           AltName: Full=Phosphoribosyl pyrophosphate synthase;
           Short=P-Rib-PP synthase; Short=PRPP synthase
 gi|60392585|sp|P0A1V7|KPRS_SALTI RecName: Full=Ribose-phosphate pyrophosphokinase; Short=RPPK;
           AltName: Full=Phosphoribosyl pyrophosphate synthase;
           Short=P-Rib-PP synthase; Short=PRPP synthase
 gi|25288323|pir||AF0720 ribose-phosphate diphosphokinase (EC 2.7.6.1) [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)
 gi|154285|gb|AAA27196.1| phosphoribosylpyrophosphate synthetase (EC 2.7.6.1) [Salmonella
           enterica subsp. enterica serovar Typhimurium]
 gi|16420310|gb|AAL20695.1| phosphoribosylpyrophosphate synthetase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|16502969|emb|CAD02135.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29137195|gb|AAO68759.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|161363085|gb|ABX66853.1| hypothetical protein SPAB_01446 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194401888|gb|ACF62110.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194408773|gb|ACF68992.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194456328|gb|EDX45167.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194711404|gb|ACF90625.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195634267|gb|EDX52619.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197213089|gb|ACH50486.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197243284|gb|EDY25904.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197289269|gb|EDY28636.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|197939290|gb|ACH76623.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|199602694|gb|EDZ01240.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204322978|gb|EDZ08174.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205321991|gb|EDZ09830.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205328632|gb|EDZ15396.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205332112|gb|EDZ18876.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205339207|gb|EDZ25971.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205342563|gb|EDZ29327.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205351121|gb|EDZ37752.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|206708516|emb|CAR32837.1| Ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|261246966|emb|CBG24783.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267993731|gb|ACY88616.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|282948958|emb|CBG88561.1| ribose-phosphate pyrophosphokinase [Citrobacter rodentium ICC168]
 gi|301158304|emb|CBW17803.1| Ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|308748544|gb|ADO48296.1| ribose-phosphate pyrophosphokinase [Enterobacter cloacae SCF1]
 gi|320085718|emb|CBY95496.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|321224411|gb|EFX49474.1| Ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322633741|gb|EFY30481.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322644100|gb|EFY40645.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322649171|gb|EFY45609.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322655330|gb|EFY51638.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322667974|gb|EFY64133.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674264|gb|EFY70358.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322686897|gb|EFY82875.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323200196|gb|EFZ85282.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323204524|gb|EFZ89528.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323240374|gb|EGA24417.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323245267|gb|EGA29267.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323266740|gb|EGA50226.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|332988667|gb|AEF07650.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 315

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|296196488|ref|XP_002745882.1| PREDICTED: amidophosphoribosyltransferase [Callithrix jacchus]
          Length = 514

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 24/48 (50%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +S +  G +I+L+DD    G T       LK++GA  V I   S  +K
Sbjct: 373 LSDNFKGKRIVLVDDSIVRGNTISPIIKLLKESGAKEVHIRVASPPIK 420


>gi|296101955|ref|YP_003612101.1| ribose-phosphate pyrophosphokinase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295056414|gb|ADF61152.1| ribose-phosphate pyrophosphokinase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 315

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|290475211|ref|YP_003468097.1| phosphoribosylpyrophosphate synthetase [Xenorhabdus bovienii
           SS-2004]
 gi|289174530|emb|CBJ81324.1| phosphoribosylpyrophosphate synthetase [Xenorhabdus bovienii
           SS-2004]
          Length = 315

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|205352552|ref|YP_002226353.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205272333|emb|CAR37213.1| Ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
          Length = 315

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|157145528|ref|YP_001452847.1| ribose-phosphate pyrophosphokinase [Citrobacter koseri ATCC
           BAA-895]
 gi|161503107|ref|YP_001570219.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|213421122|ref|ZP_03354188.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Typhi str. E01-6750]
 gi|213426491|ref|ZP_03359241.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|238913681|ref|ZP_04657518.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|291085271|ref|ZP_06352592.2| ribose-phosphate pyrophosphokinase [Citrobacter youngae ATCC 29220]
 gi|157082733|gb|ABV12411.1| hypothetical protein CKO_01271 [Citrobacter koseri ATCC BAA-895]
 gi|160864454|gb|ABX21077.1| hypothetical protein SARI_01172 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|291071451|gb|EFE09560.1| ribose-phosphate pyrophosphokinase [Citrobacter youngae ATCC 29220]
 gi|312912770|dbj|BAJ36744.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|322616776|gb|EFY13684.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322620413|gb|EFY17279.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625685|gb|EFY22504.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322626135|gb|EFY22945.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322638895|gb|EFY35588.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322640878|gb|EFY37527.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322660912|gb|EFY57143.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322662790|gb|EFY58997.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|323130052|gb|ADX17482.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323195212|gb|EFZ80392.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323207359|gb|EFZ92307.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323217344|gb|EGA02063.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323219239|gb|EGA03734.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323228016|gb|EGA12161.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323235805|gb|EGA19884.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323252828|gb|EGA36664.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323254898|gb|EGA38692.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323261013|gb|EGA44608.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323268946|gb|EGA52402.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
          Length = 321

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 212 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 260


>gi|62088072|dbj|BAD92483.1| phosphoribosyl pyrophosphate amidotransferase proprotein variant
           [Homo sapiens]
          Length = 217

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 24/48 (50%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +S +  G +I+L+DD    G T       LK++GA  V I   S  +K
Sbjct: 76  LSDNFKGKRIVLVDDSIVRGNTISPIIKLLKESGAKEVHIRVASPPIK 123


>gi|30062731|ref|NP_836902.1| ribose-phosphate pyrophosphokinase [Shigella flexneri 2a str.
           2457T]
 gi|56479854|ref|NP_707116.2| ribose-phosphate pyrophosphokinase [Shigella flexneri 2a str. 301]
 gi|30040979|gb|AAP16709.1| phosphoribosylpyrophosphate synthetase [Shigella flexneri 2a str.
           2457T]
 gi|56383405|gb|AAN42823.2| phosphoribosylpyrophosphate synthetase [Shigella flexneri 2a str.
           301]
 gi|86516952|gb|ABC98168.1| PrsA [Shigella boydii]
 gi|86517004|gb|ABC98194.1| PrsA [Shigella flexneri]
 gi|86517006|gb|ABC98195.1| PrsA [Shigella flexneri]
 gi|86517008|gb|ABC98196.1| PrsA [Shigella flexneri]
 gi|86517010|gb|ABC98197.1| PrsA [Shigella flexneri]
 gi|86517012|gb|ABC98198.1| PrsA [Shigella flexneri]
 gi|86517014|gb|ABC98199.1| PrsA [Shigella flexneri]
 gi|86517016|gb|ABC98200.1| PrsA [Shigella flexneri]
 gi|86517020|gb|ABC98202.1| PrsA [Shigella flexneri]
 gi|86517022|gb|ABC98203.1| PrsA [Shigella flexneri]
 gi|313649396|gb|EFS13827.1| ribose-phosphate pyrophosphokinase [Shigella flexneri 2a str.
           2457T]
 gi|332757860|gb|EGJ88187.1| ribose-phosphate pyrophosphokinase [Shigella flexneri 4343-70]
 gi|332759412|gb|EGJ89720.1| ribose-phosphate pyrophosphokinase [Shigella flexneri 2747-71]
 gi|332760301|gb|EGJ90591.1| ribose-phosphate pyrophosphokinase [Shigella flexneri K-671]
 gi|333005046|gb|EGK24566.1| ribose-phosphate pyrophosphokinase [Shigella flexneri VA-6]
 gi|333005360|gb|EGK24878.1| ribose-phosphate pyrophosphokinase [Shigella flexneri K-218]
 gi|333007540|gb|EGK27018.1| ribose-phosphate pyrophosphokinase [Shigella flexneri K-272]
 gi|333019239|gb|EGK38526.1| ribose-phosphate pyrophosphokinase [Shigella flexneri K-304]
 gi|333019920|gb|EGK39192.1| ribose-phosphate pyrophosphokinase [Shigella flexneri K-227]
          Length = 315

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|14521898|ref|NP_127375.1| ribose-phosphate pyrophosphokinase [Pyrococcus abyssi GE5]
 gi|24418550|sp|Q9UY08|KPRS_PYRAB RecName: Full=Ribose-phosphate pyrophosphokinase; Short=RPPK;
           AltName: Full=Phosphoribosyl pyrophosphate synthase;
           Short=P-Rib-PP synthase; Short=PRPP synthase
 gi|5459118|emb|CAB50604.1| Phosphoribosylpyrophosphate synthetase [Pyrococcus abyssi GE5]
          Length = 282

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 26/51 (50%)

Query: 9   QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           + V   V G  +L++DD+ +TG T   AA  L++ GA  + ++       +
Sbjct: 193 KPVDVDVNGKNVLIVDDIISTGGTMIKAANILRELGAKEIFVVATHGVFAE 243


>gi|312869626|ref|ZP_07729775.1| amidophosphoribosyltransferase [Lactobacillus oris PB013-T2-3]
 gi|311094823|gb|EFQ53118.1| amidophosphoribosyltransferase [Lactobacillus oris PB013-T2-3]
          Length = 488

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 22/42 (52%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51
            V   V G +++++DD    G T+K     L+ AGA  V +L
Sbjct: 343 AVRGVVNGKRVIVVDDSIVRGTTSKQIIKMLRDAGAKEVHML 384


>gi|262163994|ref|ZP_06031733.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio mimicus
           VM223]
 gi|262027522|gb|EEY46188.1| hypoxanthine-guanine phosphoribosyltransferase [Vibrio mimicus
           VM223]
          Length = 177

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 10/49 (20%), Positives = 20/49 (40%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
             + + +   + G  +LL++D+  TG T       L      ++ I T 
Sbjct: 79  VRILKDLDDDIKGKDVLLVEDIIDTGNTLNKVKEILALREPKSIRICTL 127


>gi|51596327|ref|YP_070518.1| ribose-phosphate pyrophosphokinase [Yersinia pseudotuberculosis IP
           32953]
 gi|108807392|ref|YP_651308.1| ribose-phosphate pyrophosphokinase [Yersinia pestis Antiqua]
 gi|108811657|ref|YP_647424.1| ribose-phosphate pyrophosphokinase [Yersinia pestis Nepal516]
 gi|145598401|ref|YP_001162477.1| ribose-phosphate pyrophosphokinase [Yersinia pestis Pestoides F]
 gi|149366055|ref|ZP_01888090.1| ribose-phosphate pyrophosphokinase [Yersinia pestis CA88-4125]
 gi|153948595|ref|YP_001401043.1| ribose-phosphate pyrophosphokinase [Yersinia pseudotuberculosis IP
           31758]
 gi|162420503|ref|YP_001606882.1| ribose-phosphate pyrophosphokinase [Yersinia pestis Angola]
 gi|165926486|ref|ZP_02222318.1| ribose-phosphate pyrophosphokinase [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165938826|ref|ZP_02227380.1| ribose-phosphate pyrophosphokinase [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166009307|ref|ZP_02230205.1| ribose-phosphate pyrophosphokinase [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166210908|ref|ZP_02236943.1| ribose-phosphate pyrophosphokinase [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|167401471|ref|ZP_02306968.1| ribose-phosphate pyrophosphokinase [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167420277|ref|ZP_02312030.1| ribose-phosphate pyrophosphokinase [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167424659|ref|ZP_02316412.1| ribose-phosphate pyrophosphokinase [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|170024415|ref|YP_001720920.1| ribose-phosphate pyrophosphokinase [Yersinia pseudotuberculosis
           YPIII]
 gi|186895369|ref|YP_001872481.1| ribose-phosphate pyrophosphokinase [Yersinia pseudotuberculosis
           PB1/+]
 gi|218929124|ref|YP_002346999.1| ribose-phosphate pyrophosphokinase [Yersinia pestis CO92]
 gi|229894724|ref|ZP_04509904.1| phosphoribosylpyrophosphate synthase [Yersinia pestis Pestoides A]
 gi|229897424|ref|ZP_04512580.1| phosphoribosylpyrophosphate synthase [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229898067|ref|ZP_04513218.1| phosphoribosylpyrophosphate synthase [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229901936|ref|ZP_04517057.1| phosphoribosylpyrophosphate synthase [Yersinia pestis Nepal516]
 gi|238755543|ref|ZP_04616881.1| Ribose-phosphate pyrophosphokinase [Yersinia ruckeri ATCC 29473]
 gi|270490881|ref|ZP_06207955.1| ribose-phosphate diphosphokinase [Yersinia pestis KIM D27]
 gi|294503916|ref|YP_003567978.1| ribose-phosphate pyrophosphokinase [Yersinia pestis Z176003]
 gi|24418515|sp|Q8ZEY2|KPRS_YERPE RecName: Full=Ribose-phosphate pyrophosphokinase; Short=RPPK;
           AltName: Full=Phosphoribosyl pyrophosphate synthase;
           Short=P-Rib-PP synthase; Short=PRPP synthase
 gi|51589609|emb|CAH21239.1| ribose-phosphate pyrophosphokinase [Yersinia pseudotuberculosis IP
           32953]
 gi|108775305|gb|ABG17824.1| ribose-phosphate pyrophosphokinase [Yersinia pestis Nepal516]
 gi|108779305|gb|ABG13363.1| ribose-phosphate pyrophosphokinase [Yersinia pestis Antiqua]
 gi|115347735|emb|CAL20650.1| ribose-phosphate pyrophosphokinase [Yersinia pestis CO92]
 gi|145210097|gb|ABP39504.1| ribose-phosphate pyrophosphokinase [Yersinia pestis Pestoides F]
 gi|149292468|gb|EDM42542.1| ribose-phosphate pyrophosphokinase [Yersinia pestis CA88-4125]
 gi|152960090|gb|ABS47551.1| ribose-phosphate pyrophosphokinase [Yersinia pseudotuberculosis IP
           31758]
 gi|162353318|gb|ABX87266.1| ribose-phosphate pyrophosphokinase [Yersinia pestis Angola]
 gi|165913189|gb|EDR31812.1| ribose-phosphate pyrophosphokinase [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165921707|gb|EDR38904.1| ribose-phosphate pyrophosphokinase [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165991862|gb|EDR44163.1| ribose-phosphate pyrophosphokinase [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166208088|gb|EDR52568.1| ribose-phosphate pyrophosphokinase [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|166961972|gb|EDR57993.1| ribose-phosphate pyrophosphokinase [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167049167|gb|EDR60575.1| ribose-phosphate pyrophosphokinase [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167056541|gb|EDR66310.1| ribose-phosphate pyrophosphokinase [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|169750949|gb|ACA68467.1| ribose-phosphate pyrophosphokinase [Yersinia pseudotuberculosis
           YPIII]
 gi|186698395|gb|ACC89024.1| ribose-phosphate pyrophosphokinase [Yersinia pseudotuberculosis
           PB1/+]
 gi|229680832|gb|EEO76927.1| phosphoribosylpyrophosphate synthase [Yersinia pestis Nepal516]
 gi|229689108|gb|EEO81173.1| phosphoribosylpyrophosphate synthase [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229693761|gb|EEO83810.1| phosphoribosylpyrophosphate synthase [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229702197|gb|EEO90216.1| phosphoribosylpyrophosphate synthase [Yersinia pestis Pestoides A]
 gi|238706223|gb|EEP98602.1| Ribose-phosphate pyrophosphokinase [Yersinia ruckeri ATCC 29473]
 gi|262361963|gb|ACY58684.1| ribose-phosphate pyrophosphokinase [Yersinia pestis D106004]
 gi|262365898|gb|ACY62455.1| ribose-phosphate pyrophosphokinase [Yersinia pestis D182038]
 gi|270339385|gb|EFA50162.1| ribose-phosphate diphosphokinase [Yersinia pestis KIM D27]
 gi|294354375|gb|ADE64716.1| ribose-phosphate pyrophosphokinase [Yersinia pestis Z176003]
 gi|320015309|gb|ADV98880.1| phosphoribosylpyrophosphate synthase [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 315

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|194467378|ref|ZP_03073365.1| hypoxanthine phosphoribosyltransferase [Lactobacillus reuteri
           100-23]
 gi|194454414|gb|EDX43311.1| hypoxanthine phosphoribosyltransferase [Lactobacillus reuteri
           100-23]
          Length = 178

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + Q +S  + G  +++++D+  TG T K  A      GA ++ I + 
Sbjct: 77  GKVKLIQDLSHDIKGRPVIIMEDIIDTGHTLKYLAGLFADRGAKSIEICSL 127


>gi|163938072|ref|YP_001642956.1| hypoxanthine phosphoribosyltransferase [Bacillus weihenstephanensis
           KBAB4]
 gi|163860269|gb|ABY41328.1| hypoxanthine phosphoribosyltransferase [Bacillus weihenstephanensis
           KBAB4]
          Length = 180

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V G  IL+++D+  +G T        K   A +V I+T 
Sbjct: 78  GEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTL 128


>gi|328703119|ref|XP_001951505.2| PREDICTED: amidophosphoribosyltransferase-like isoform 1
           [Acyrthosiphon pisum]
 gi|328703121|ref|XP_003242099.1| PREDICTED: amidophosphoribosyltransferase-like isoform 2
           [Acyrthosiphon pisum]
          Length = 492

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/49 (36%), Positives = 25/49 (51%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            + ++VAG +++LIDD    G T       L+ AGA  V I   S  LK
Sbjct: 369 AIVENVAGKRLILIDDSIVRGTTMGPIIKLLRDAGAKEVHIRVASPPLK 417


>gi|330446875|ref|ZP_08310526.1| hypoxanthine phosphoribosyltransferase [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328491066|dbj|GAA05023.1| hypoxanthine phosphoribosyltransferase [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 177

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 10/49 (20%), Positives = 20/49 (40%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
             + + +   + G  +LL++D+  TG T       L      ++ I T 
Sbjct: 79  VRILKDLDDDIKGKDVLLVEDIIDTGNTLSKVCEILSLREPKSIRICTL 127


>gi|322832990|ref|YP_004213017.1| ribose-phosphate pyrophosphokinase [Rahnella sp. Y9602]
 gi|321168191|gb|ADW73890.1| ribose-phosphate pyrophosphokinase [Rahnella sp. Y9602]
          Length = 315

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|319790146|ref|YP_004151779.1| amidophosphoribosyltransferase [Thermovibrio ammonificans HB-1]
 gi|317114648|gb|ADU97138.1| amidophosphoribosyltransferase [Thermovibrio ammonificans HB-1]
          Length = 462

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 12/41 (29%), Positives = 22/41 (53%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
            V   + G ++++IDD    G T++     L++AGA  V +
Sbjct: 337 PVPGLLKGKRVVVIDDSIVRGTTSRKIVRMLREAGAKEVHM 377


>gi|227548214|ref|ZP_03978263.1| ribose-phosphate pyrophosphokinase [Corynebacterium lipophiloflavum
           DSM 44291]
 gi|227079688|gb|EEI17651.1| ribose-phosphate pyrophosphokinase [Corynebacterium lipophiloflavum
           DSM 44291]
          Length = 325

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 22/52 (42%)

Query: 7   VPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           V   V   V G   +L+DD+  TG T   A   LK AGA +V I        
Sbjct: 213 VSNRVVGEVEGKDCILMDDMIDTGGTIAGAVGVLKDAGAKSVLIACTHGVFS 264


>gi|213650572|ref|ZP_03380625.1| ribose-phosphate pyrophosphokinase [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
          Length = 192

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 83  HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 131


>gi|22126180|ref|NP_669603.1| ribose-phosphate pyrophosphokinase [Yersinia pestis KIM 10]
 gi|45441665|ref|NP_993204.1| ribose-phosphate pyrophosphokinase [Yersinia pestis biovar Microtus
           str. 91001]
 gi|21959145|gb|AAM85854.1|AE013832_4 phosphoribosylpyrophosphate synthetase [Yersinia pestis KIM 10]
 gi|45436527|gb|AAS62081.1| phosphoribosylpyrophosphate synthetase [Yersinia pestis biovar
           Microtus str. 91001]
          Length = 321

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 212 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 260


>gi|306828585|ref|ZP_07461779.1| hypoxanthine phosphoribosyltransferase [Streptococcus mitis ATCC
           6249]
 gi|304429193|gb|EFM32279.1| hypoxanthine phosphoribosyltransferase [Streptococcus mitis ATCC
           6249]
          Length = 180

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
              N+ Q V++ + G  +L ++D+  TG T K       +  A +V I T 
Sbjct: 78  GVINIKQDVTQDIKGRHVLFVEDIIDTGQTLKNLRDMFIEREAASVKIATL 128


>gi|300780434|ref|ZP_07090290.1| hypoxanthine phosphoribosyltransferase [Corynebacterium genitalium
           ATCC 33030]
 gi|300534544|gb|EFK55603.1| hypoxanthine phosphoribosyltransferase [Corynebacterium genitalium
           ATCC 33030]
          Length = 215

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 10/53 (18%), Positives = 25/53 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + + K ++G  +L+++D+  +G T       LK     ++ ++T  R
Sbjct: 95  GVVRIMKDLDKEISGRDVLVVEDIIDSGLTLSWLMKNLKGRQPKSLRVVTLLR 147


>gi|238788558|ref|ZP_04632351.1| Ribose-phosphate pyrophosphokinase [Yersinia frederiksenii ATCC
           33641]
 gi|238723471|gb|EEQ15118.1| Ribose-phosphate pyrophosphokinase [Yersinia frederiksenii ATCC
           33641]
          Length = 312

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 203 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 251


>gi|166714084|ref|ZP_02245291.1| competence protein F [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 219

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 5/56 (8%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +R+AF     +        + L+DDV TTGAT   AA AL+KAG   V     +R 
Sbjct: 168 LRDAFVARGPLPA-----HVALVDDVMTTGATLNAAAKALRKAGVQRVDAWVCARV 218


>gi|153831450|ref|ZP_01984117.1| ribose-phosphate pyrophosphokinase [Vibrio cholerae 623-39]
 gi|148873068|gb|EDL71203.1| ribose-phosphate pyrophosphokinase [Vibrio cholerae 623-39]
          Length = 296

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 21/48 (43%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +   V G   +++DD+  TG T   AA ALK+ GA  V          
Sbjct: 207 LIGDVEGRDCVIVDDMIDTGGTLCKAAEALKERGAKRVFAYATHAVFS 254


>gi|127513844|ref|YP_001095041.1| ribose-phosphate pyrophosphokinase [Shewanella loihica PV-4]
 gi|126639139|gb|ABO24782.1| ribose-phosphate pyrophosphokinase [Shewanella loihica PV-4]
          Length = 324

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 22/49 (44%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +++DD+  TG T   AA ALK+ GA  V          
Sbjct: 215 HIIGDVQGRDCIIVDDMIDTGGTLCKAAEALKEHGANRVFAYATHPVFS 263


>gi|30260255|ref|NP_842632.1| hypoxanthine-guanine phosphoribosyltransferase [Bacillus anthracis
           str. Ames]
 gi|42779143|ref|NP_976390.1| hypoxanthine-guanine phosphoribosyltransferase [Bacillus cereus
           ATCC 10987]
 gi|47570188|ref|ZP_00240842.1| hypoxanthine phosphoribosyltransferase [Bacillus cereus G9241]
 gi|49183098|ref|YP_026350.1| hypoxanthine-guanine phosphoribosyltransferase [Bacillus anthracis
           str. Sterne]
 gi|49479325|ref|YP_034417.1| hypoxanthine-guanine phosphoribosyltransferase [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|52145152|ref|YP_081676.1| hypoxanthine-guanine phosphoribosyltransferase [Bacillus cereus
           E33L]
 gi|65317525|ref|ZP_00390484.1| COG0634: Hypoxanthine-guanine phosphoribosyltransferase [Bacillus
           anthracis str. A2012]
 gi|118475835|ref|YP_892986.1| hypoxanthine phosphoribosyltransferase [Bacillus thuringiensis str.
           Al Hakam]
 gi|190568972|ref|ZP_03021873.1| hypoxanthine phosphoribosyltransferase [Bacillus anthracis
           Tsiankovskii-I]
 gi|196036418|ref|ZP_03103815.1| hypoxanthine phosphoribosyltransferase [Bacillus cereus W]
 gi|196041755|ref|ZP_03109045.1| hypoxanthine phosphoribosyltransferase [Bacillus cereus NVH0597-99]
 gi|196047402|ref|ZP_03114615.1| hypoxanthine phosphoribosyltransferase [Bacillus cereus 03BB108]
 gi|206977955|ref|ZP_03238842.1| hypoxanthine phosphoribosyltransferase [Bacillus cereus H3081.97]
 gi|217957640|ref|YP_002336182.1| hypoxanthine phosphoribosyltransferase [Bacillus cereus AH187]
 gi|222093834|ref|YP_002527883.1| hypoxanthine phosphoribosyltransferase (hypoxanthine-guanine
           phosphoribosyltransferase) [Bacillus cereus Q1]
 gi|225862117|ref|YP_002747495.1| hypoxanthine phosphoribosyltransferase [Bacillus cereus 03BB102]
 gi|227812738|ref|YP_002812747.1| hypoxanthine phosphoribosyltransferase [Bacillus anthracis str. CDC
           684]
 gi|229604496|ref|YP_002864716.1| hypoxanthine phosphoribosyltransferase [Bacillus anthracis str.
           A0248]
 gi|254682309|ref|ZP_05146170.1| hypoxanthine phosphoribosyltransferase [Bacillus anthracis str.
           CNEVA-9066]
 gi|254724205|ref|ZP_05185990.1| hypoxanthine phosphoribosyltransferase [Bacillus anthracis str.
           A1055]
 gi|254735466|ref|ZP_05193174.1| hypoxanthine phosphoribosyltransferase [Bacillus anthracis str.
           Western North America USA6153]
 gi|254744632|ref|ZP_05202311.1| hypoxanthine phosphoribosyltransferase [Bacillus anthracis str.
           Kruger B]
 gi|254756337|ref|ZP_05208366.1| hypoxanthine phosphoribosyltransferase [Bacillus anthracis str.
           Vollum]
 gi|254762393|ref|ZP_05214235.1| hypoxanthine phosphoribosyltransferase [Bacillus anthracis str.
           Australia 94]
 gi|301051802|ref|YP_003790013.1| hypoxanthine-guanine phosphoribosyltransferase [Bacillus anthracis
           CI]
 gi|30253576|gb|AAP24118.1| hypoxanthine phosphoribosyltransferase [Bacillus anthracis str.
           Ames]
 gi|42735058|gb|AAS38998.1| hypoxanthine phosphoribosyltransferase [Bacillus cereus ATCC 10987]
 gi|47553132|gb|EAL11529.1| hypoxanthine phosphoribosyltransferase [Bacillus cereus G9241]
 gi|49177025|gb|AAT52401.1| hypoxanthine phosphoribosyltransferase [Bacillus anthracis str.
           Sterne]
 gi|49330881|gb|AAT61527.1| hypoxanthine phosphoribosyltransferase (hypoxanthine-guanine
           phosphoribosyltransferase) [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|51978621|gb|AAU20171.1| hypoxanthine phosphoribosyltransferase (hypoxanthine-guanine
           phosphoribosyltransferase) [Bacillus cereus E33L]
 gi|118415060|gb|ABK83479.1| hypoxanthine phosphoribosyltransferase [Bacillus thuringiensis str.
           Al Hakam]
 gi|190559896|gb|EDV13880.1| hypoxanthine phosphoribosyltransferase [Bacillus anthracis
           Tsiankovskii-I]
 gi|195991048|gb|EDX55019.1| hypoxanthine phosphoribosyltransferase [Bacillus cereus W]
 gi|196021804|gb|EDX60498.1| hypoxanthine phosphoribosyltransferase [Bacillus cereus 03BB108]
 gi|196027375|gb|EDX65992.1| hypoxanthine phosphoribosyltransferase [Bacillus cereus NVH0597-99]
 gi|206743861|gb|EDZ55281.1| hypoxanthine phosphoribosyltransferase [Bacillus cereus H3081.97]
 gi|217067544|gb|ACJ81794.1| hypoxanthine phosphoribosyltransferase [Bacillus cereus AH187]
 gi|221237881|gb|ACM10591.1| hypoxanthine phosphoribosyltransferase (hypoxanthine-guanine
           phosphoribosyltransferase) [Bacillus cereus Q1]
 gi|225786072|gb|ACO26289.1| hypoxanthine phosphoribosyltransferase [Bacillus cereus 03BB102]
 gi|227006771|gb|ACP16514.1| hypoxanthine phosphoribosyltransferase [Bacillus anthracis str. CDC
           684]
 gi|229268904|gb|ACQ50541.1| hypoxanthine phosphoribosyltransferase [Bacillus anthracis str.
           A0248]
 gi|300373971|gb|ADK02875.1| hypoxanthine-guanine phosphoribosyltransferase [Bacillus cereus
           biovar anthracis str. CI]
 gi|324324054|gb|ADY19314.1| hypoxanthine phosphoribosyltransferase [Bacillus thuringiensis
           serovar finitimus YBT-020]
          Length = 180

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V G  IL+++D+  +G T        K   A +V I+T 
Sbjct: 78  GEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTL 128


>gi|325567754|ref|ZP_08144365.1| phosphoribosyl pyrophosphate synthetase [Enterococcus casseliflavus
           ATCC 12755]
 gi|325158527|gb|EGC70674.1| phosphoribosyl pyrophosphate synthetase [Enterococcus casseliflavus
           ATCC 12755]
          Length = 333

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 23/46 (50%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            HV G   +LIDD+  T  T   AA ALK+AGA +V        L 
Sbjct: 224 GHVEGKTCVLIDDMIDTAGTITLAANALKQAGAKSVYASCTHPVLS 269


>gi|225027267|ref|ZP_03716459.1| hypothetical protein EUBHAL_01523 [Eubacterium hallii DSM 3353]
 gi|224955420|gb|EEG36629.1| hypothetical protein EUBHAL_01523 [Eubacterium hallii DSM 3353]
          Length = 491

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/40 (35%), Positives = 19/40 (47%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
           +   V G +I++IDD    G T       LK AGA  V +
Sbjct: 370 LKDAVKGKRIVMIDDSIVRGTTCHRIVRMLKDAGAKEVHV 409


>gi|170691540|ref|ZP_02882705.1| putative competence protein F-related protein [Burkholderia
           graminis C4D1M]
 gi|170143745|gb|EDT11908.1| putative competence protein F-related protein [Burkholderia
           graminis C4D1M]
          Length = 233

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 4/56 (7%)

Query: 4   AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           AF V      +V GL + ++DDV TTGAT +  A  LK AGA  V+     R+ K+
Sbjct: 182 AFEVA----GNVQGLHVGIVDDVMTTGATLEALARTLKAAGARRVTNFVALRTPKN 233


>gi|42524405|ref|NP_969785.1| amidophosphoribosyltransferase [Bdellovibrio bacteriovorus HD100]
 gi|39576614|emb|CAE80778.1| amidophosphoribosyltransferase [Bdellovibrio bacteriovorus HD100]
          Length = 479

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            V   + G KILL+DD    G T+      L+ AGA  V + +    ++
Sbjct: 350 PVQSEIKGKKILLVDDSIVRGTTSARIIRLLRDAGAEKVYLASTCPPIR 398


>gi|323140871|ref|ZP_08075784.1| ribose-phosphate diphosphokinase [Phascolarctobacterium sp. YIT
           12067]
 gi|322414609|gb|EFY05415.1| ribose-phosphate diphosphokinase [Phascolarctobacterium sp. YIT
           12067]
          Length = 336

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 21/49 (42%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +   V G   +++DD+  T  +    A ALKK GA  V        L D
Sbjct: 227 LIGDVKGKTCIMVDDMVDTAGSLTEGARALKKFGAKEVYACCTHPILTD 275


>gi|229546906|ref|ZP_04435631.1| hypoxanthine-guanine phosphoribosyltransferase [Enterococcus
           faecalis TX1322]
 gi|256855218|ref|ZP_05560579.1| predicted protein [Enterococcus faecalis T8]
 gi|307290190|ref|ZP_07570108.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX0411]
 gi|229307834|gb|EEN73821.1| hypoxanthine-guanine phosphoribosyltransferase [Enterococcus
           faecalis TX1322]
 gi|256709731|gb|EEU24778.1| predicted protein [Enterococcus faecalis T8]
 gi|306498746|gb|EFM68245.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX0411]
 gi|315028817|gb|EFT40749.1| hypoxanthine phosphoribosyltransferase [Enterococcus faecalis
           TX4000]
          Length = 181

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +  +V G  IL+++D+  +G T        +   A +V I+T 
Sbjct: 78  GEVKIVKDLDTNVEGRHILIVEDIIDSGRTLAYLVDLFRYRKAASVKIVTL 128


>gi|256833158|ref|YP_003161885.1| ribose-phosphate pyrophosphokinase [Jonesia denitrificans DSM
           20603]
 gi|256686689|gb|ACV09582.1| ribose-phosphate pyrophosphokinase [Jonesia denitrificans DSM
           20603]
          Length = 327

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 24/54 (44%)

Query: 6   NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           +V   V   VAG   +L+DD+  TG T   A     ++GA  V +      L D
Sbjct: 213 SVANRVVGDVAGRTCVLVDDLIDTGGTIAEAVRVCLESGAKDVIVAATHGVLSD 266


>gi|262201505|ref|YP_003272713.1| ribose-phosphate pyrophosphokinase [Gordonia bronchialis DSM 43247]
 gi|262084852|gb|ACY20820.1| ribose-phosphate pyrophosphokinase [Gordonia bronchialis DSM 43247]
          Length = 325

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 23/53 (43%)

Query: 7   VPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           V   V   V G   +LIDD+  TG T   A   LK AGA  V I T      D
Sbjct: 212 VAHRVVGEVEGRTCVLIDDMIDTGGTIAGAVAKLKDAGAGDVVIATTHAVFSD 264


>gi|148997946|ref|ZP_01825459.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           SP11-BS70]
 gi|149003153|ref|ZP_01828062.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           SP14-BS69]
 gi|149007704|ref|ZP_01831313.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           SP18-BS74]
 gi|149020170|ref|ZP_01835144.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           SP23-BS72]
 gi|168487653|ref|ZP_02712161.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           CDC1087-00]
 gi|168491782|ref|ZP_02715925.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           CDC0288-04]
 gi|168576122|ref|ZP_02722027.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           MLV-016]
 gi|169833613|ref|YP_001693446.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           Hungary19A-6]
 gi|225855747|ref|YP_002737258.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           P1031]
 gi|225857821|ref|YP_002739331.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           70585]
 gi|225860058|ref|YP_002741567.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           Taiwan19F-14]
 gi|237651092|ref|ZP_04525344.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           CCRI 1974]
 gi|237821204|ref|ZP_04597049.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           CCRI 1974M2]
 gi|298229477|ref|ZP_06963158.1| hypoxanthine-guanine phosphoribosyltransferase [Streptococcus
           pneumoniae str. Canada MDR_19F]
 gi|298255107|ref|ZP_06978693.1| hypoxanthine-guanine phosphoribosyltransferase [Streptococcus
           pneumoniae str. Canada MDR_19A]
 gi|298501802|ref|YP_003723742.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           TCH8431/19A]
 gi|307066648|ref|YP_003875614.1| hypoxanthine-guanine phosphoribosyltransferase [Streptococcus
           pneumoniae AP200]
 gi|307126186|ref|YP_003878217.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           670-6B]
 gi|147755956|gb|EDK62999.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           SP11-BS70]
 gi|147758894|gb|EDK65890.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           SP14-BS69]
 gi|147760699|gb|EDK67671.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           SP18-BS74]
 gi|147930848|gb|EDK81829.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           SP23-BS72]
 gi|168996115|gb|ACA36727.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           Hungary19A-6]
 gi|183569574|gb|EDT90102.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           CDC1087-00]
 gi|183574081|gb|EDT94609.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           CDC0288-04]
 gi|183578083|gb|EDT98611.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           MLV-016]
 gi|225720759|gb|ACO16613.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           70585]
 gi|225725046|gb|ACO20898.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           P1031]
 gi|225728258|gb|ACO24109.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           Taiwan19F-14]
 gi|298237397|gb|ADI68528.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           TCH8431/19A]
 gi|306408185|gb|ADM83612.1| Hypoxanthine-guanine phosphoribosyltransferase [Streptococcus
           pneumoniae AP200]
 gi|306483248|gb|ADM90117.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           670-6B]
 gi|327388997|gb|EGE87345.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           GA04375]
 gi|332071334|gb|EGI81829.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           GA17545]
 gi|332199079|gb|EGJ13160.1| hypoxanthine phosphoribosyltransferase [Streptococcus pneumoniae
           GA47901]
          Length = 180

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
              N+ Q V++ + G  +L ++D+  TG T K      K   A +V I T 
Sbjct: 78  GVINIKQDVTQDIKGRHVLFVEDIIDTGQTLKNLRDMFKAREAASVKIATL 128


>gi|270261423|ref|ZP_06189696.1| ribose-phosphate pyrophosphokinase [Serratia odorifera 4Rx13]
 gi|270044907|gb|EFA17998.1| ribose-phosphate pyrophosphokinase [Serratia odorifera 4Rx13]
          Length = 315

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 206 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 254


>gi|164449238|gb|ABY56069.1| hypoxanthine phosphoribosyltransferase [uncultured bacterium
           pFosPlaG]
          Length = 208

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
             F V   + + + G  ILL++D+  TG T       L+     ++ + TF
Sbjct: 108 GEFKVVMDLDESIEGRDILLVEDIVDTGNTFSKVIQMLESRNPASLKVCTF 158


>gi|307711227|ref|ZP_07647649.1| hypoxanthine phosphoribosyltransferase [Streptococcus mitis SK321]
 gi|307617189|gb|EFN96367.1| hypoxanthine phosphoribosyltransferase [Streptococcus mitis SK321]
          Length = 180

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
              N+ Q V++ + G  +L ++D+  TG T K      K   A +V I T 
Sbjct: 78  GVINIKQDVTQDIKGRHVLFVEDIIDTGQTLKSLRDMFKAREAASVKIATL 128


>gi|227509311|ref|ZP_03939360.1| hypoxanthine phosphoribosyltransferase [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
 gi|227191241|gb|EEI71308.1| hypoxanthine phosphoribosyltransferase [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
          Length = 180

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 26/51 (50%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
              ++   +S  V+G  +L+I+D+  TG T K     L K GA ++ + T 
Sbjct: 77  GKVDLVTDISTDVSGRDVLIIEDIVDTGRTLKFLMDNLTKRGARSIKVCTL 127


>gi|261340155|ref|ZP_05968013.1| ribose-phosphate pyrophosphokinase [Enterobacter cancerogenus ATCC
           35316]
 gi|288317670|gb|EFC56608.1| ribose-phosphate pyrophosphokinase [Enterobacter cancerogenus ATCC
           35316]
          Length = 312

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 203 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 251


>gi|261345805|ref|ZP_05973449.1| hypoxanthine phosphoribosyltransferase [Providencia rustigianii DSM
           4541]
 gi|282566294|gb|EFB71829.1| hypoxanthine phosphoribosyltransferase [Providencia rustigianii DSM
           4541]
          Length = 178

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 9/49 (18%), Positives = 23/49 (46%)

Query: 5   FNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
             + + + + + G  +L+++D+  +G T        +  G  +V+I T 
Sbjct: 80  VKIVKDLDEDIRGKHVLIVEDIIDSGNTLNKVREIFELRGPASVAICTL 128


>gi|170016966|ref|YP_001727885.1| amidophosphoribosyltransferase [Leuconostoc citreum KM20]
 gi|169803823|gb|ACA82441.1| Amidophosphoribosyltransferase [Leuconostoc citreum KM20]
          Length = 540

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 22/49 (44%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            V   V    ++L+DD    G T+      LK+AGA +V +   S   K
Sbjct: 365 AVKDVVRNKNVVLVDDSIVRGTTSMYIIRMLKEAGAKSVHVRIASPVFK 413


>gi|258542216|ref|YP_003187649.1| competence protein F [Acetobacter pasteurianus IFO 3283-01]
 gi|256633294|dbj|BAH99269.1| competence protein F [Acetobacter pasteurianus IFO 3283-01]
 gi|256636353|dbj|BAI02322.1| competence protein F [Acetobacter pasteurianus IFO 3283-03]
 gi|256639406|dbj|BAI05368.1| competence protein F [Acetobacter pasteurianus IFO 3283-07]
 gi|256642462|dbj|BAI08417.1| competence protein F [Acetobacter pasteurianus IFO 3283-22]
 gi|256645517|dbj|BAI11465.1| competence protein F [Acetobacter pasteurianus IFO 3283-26]
 gi|256648570|dbj|BAI14511.1| competence protein F [Acetobacter pasteurianus IFO 3283-32]
 gi|256651623|dbj|BAI17557.1| competence protein F [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654614|dbj|BAI20541.1| competence protein F [Acetobacter pasteurianus IFO 3283-12]
          Length = 255

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 29/52 (55%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
           M +A        + + G  ++L+DD+ TTGATA     AL++AG  +V +L 
Sbjct: 188 MHSAITFRPKWQQKLQGRSVVLVDDMLTTGATATACVQALRQAGVRSVRLLV 239


>gi|229009574|ref|ZP_04166801.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus mycoides
           DSM 2048]
 gi|229053911|ref|ZP_04195346.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus cereus
           AH603]
 gi|229131072|ref|ZP_04259985.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus cereus
           BDRD-ST196]
 gi|229165053|ref|ZP_04292849.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus cereus
           AH621]
 gi|228618438|gb|EEK75467.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus cereus
           AH621]
 gi|228652409|gb|EEL08333.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus cereus
           BDRD-ST196]
 gi|228721452|gb|EEL72972.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus cereus
           AH603]
 gi|228751718|gb|EEM01517.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus mycoides
           DSM 2048]
          Length = 179

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V G  IL+++D+  +G T        K   A +V I+T 
Sbjct: 77  GEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTL 127


>gi|218236151|ref|YP_002364914.1| hypoxanthine phosphoribosyltransferase [Bacillus cereus B4264]
 gi|296500897|ref|YP_003662597.1| hypoxanthine-guanine phosphoribosyltransferase [Bacillus
           thuringiensis BMB171]
 gi|218164108|gb|ACK64100.1| hypoxanthine phosphoribosyltransferase [Bacillus cereus B4264]
 gi|296321949|gb|ADH04877.1| hypoxanthine-guanine phosphoribosyltransferase [Bacillus
           thuringiensis BMB171]
          Length = 180

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V G  IL+++D+  +G T        K   A +V I+T 
Sbjct: 78  GEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTL 128


>gi|18073191|emb|CAC80678.1| putative ribose-phosphate pyrophosphokinase [Listeria grayi]
          Length = 120

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 21/46 (45%)

Query: 13 KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +V G   +LIDD+  T  T   AA ALK AGA  V        L 
Sbjct: 16 GNVEGKVCILIDDIIDTAGTITLAANALKNAGATQVYACCTHPVLS 61


>gi|83648031|ref|YP_436466.1| amidophosphoribosyltransferase [Hahella chejuensis KCTC 2396]
 gi|83636074|gb|ABC32041.1| predicted amidophosphoribosyltransferase [Hahella chejuensis KCTC
           2396]
          Length = 244

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 31/55 (56%), Gaps = 4/55 (7%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
           ++N F     + +      +++IDDV TTG+T    A  LK+AGA+ V + + +R
Sbjct: 190 VKNGFEASSKLPQ----QPLIIIDDVVTTGSTVDELARTLKQAGALEVYVFSIAR 240


>gi|73975309|ref|XP_854170.1| PREDICTED: similar to phosphoribosyl pyrophosphate amidotransferase
           proprotein [Canis familiaris]
          Length = 517

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 24/48 (50%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +S +  G +I+L+DD    G T       LK++GA  V I   S  ++
Sbjct: 376 LSDNFKGKRIVLVDDSIVRGNTISPIIKLLKESGAKEVHIRVASPPVR 423


>gi|332685803|ref|YP_004455577.1| hypoxanthine-guanine phosphoribosyltransferase [Melissococcus
           plutonius ATCC 35311]
 gi|332369812|dbj|BAK20768.1| hypoxanthine-guanine phosphoribosyltransferase [Melissococcus
           plutonius ATCC 35311]
          Length = 181

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +  +V G  IL+++D+  +G T        K   A +V I+T 
Sbjct: 78  GEVKIIKDLDTNVEGRHILIVEDIIDSGRTLAYLVDLFKYRKAASVKIVTL 128


>gi|326942979|gb|AEA18875.1| comF operon protein 3 [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 190

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/45 (46%), Positives = 26/45 (57%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
            +  +G  ILL+DDVYTTG T +     L + GA  VS LT  RS
Sbjct: 146 EEMFSGQHILLVDDVYTTGITVRQIGSLLYERGAREVSSLTLCRS 190


>gi|308176583|ref|YP_003915989.1| ribose-phosphate diphosphokinase [Arthrobacter arilaitensis Re117]
 gi|307744046|emb|CBT75018.1| ribose-phosphate diphosphokinase [Arthrobacter arilaitensis Re117]
          Length = 326

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/52 (36%), Positives = 23/52 (44%)

Query: 8   PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
            + V   V G   +LIDD+  TG T   A   LK+AGA  V I        D
Sbjct: 214 SKTVVGQVEGRTAILIDDMIDTGGTIAGAVRVLKEAGAKDVIIAATHAVFSD 265


>gi|296505611|ref|YP_003667311.1| ComF operon protein 3 [Bacillus thuringiensis BMB171]
 gi|296326663|gb|ADH09591.1| comF operon protein 3 [Bacillus thuringiensis BMB171]
          Length = 234

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/45 (46%), Positives = 26/45 (57%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
            +  +G  ILL+DDVYTTG T +     L + GA  VS LT  RS
Sbjct: 190 EEMFSGQHILLVDDVYTTGITVRQIGSLLYERGAREVSSLTLCRS 234


>gi|283456139|ref|YP_003360703.1| ribose-phosphate pyrophosphokinase [Bifidobacterium dentium Bd1]
 gi|283102773|gb|ADB09879.1| prsA Ribose-phosphate pyrophosphokinase [Bifidobacterium dentium
           Bd1]
          Length = 339

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 24/53 (45%)

Query: 6   NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
            V   V   V G   +L+DD+  T  T   A   LK AGA +V+++     L 
Sbjct: 215 AVANRVVGDVEGKDCVLVDDLIDTAGTIAGACSVLKDAGAKSVTVVATHGVLS 267


>gi|228923916|ref|ZP_04087193.1| ComF operon protein 3 [Bacillus thuringiensis serovar huazhongensis
           BGSC 4BD1]
 gi|228835715|gb|EEM81079.1| ComF operon protein 3 [Bacillus thuringiensis serovar huazhongensis
           BGSC 4BD1]
          Length = 164

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/45 (46%), Positives = 26/45 (57%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
            +  +G  ILL+DDVYTTG T +     L + GA  VS LT  RS
Sbjct: 120 EEMFSGQHILLVDDVYTTGITVRQIGSLLYERGAREVSSLTLCRS 164


>gi|228961428|ref|ZP_04123041.1| ComF operon protein 3 [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228798242|gb|EEM45242.1| ComF operon protein 3 [Bacillus thuringiensis serovar pakistani
           str. T13001]
          Length = 190

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/45 (46%), Positives = 26/45 (57%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
            +  +G  ILL+DDVYTTG T +     L + GA  VS LT  RS
Sbjct: 146 EEMFSGQHILLVDDVYTTGITVRQIGSLLYERGAREVSSLTLCRS 190


>gi|228942326|ref|ZP_04104865.1| ComF operon protein 3 [Bacillus thuringiensis serovar berliner ATCC
           10792]
 gi|228975256|ref|ZP_04135814.1| ComF operon protein 3 [Bacillus thuringiensis serovar thuringiensis
           str. T01001]
 gi|228981894|ref|ZP_04142189.1| ComF operon protein 3 [Bacillus thuringiensis Bt407]
 gi|228778006|gb|EEM26278.1| ComF operon protein 3 [Bacillus thuringiensis Bt407]
 gi|228784535|gb|EEM32556.1| ComF operon protein 3 [Bacillus thuringiensis serovar thuringiensis
           str. T01001]
 gi|228817370|gb|EEM63456.1| ComF operon protein 3 [Bacillus thuringiensis serovar berliner ATCC
           10792]
          Length = 164

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/45 (46%), Positives = 26/45 (57%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
            +  +G  ILL+DDVYTTG T +     L + GA  VS LT  RS
Sbjct: 120 EEMFSGQHILLVDDVYTTGITVRQIGSLLYERGAREVSSLTLCRS 164


>gi|229072645|ref|ZP_04205847.1| ComF operon protein 3 [Bacillus cereus F65185]
 gi|228710621|gb|EEL62594.1| ComF operon protein 3 [Bacillus cereus F65185]
          Length = 190

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/45 (46%), Positives = 26/45 (57%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
            +  +G  ILL+DDVYTTG T +     L + GA  VS LT  RS
Sbjct: 146 EEMFSGQHILLVDDVYTTGITVRQIGSLLYERGAREVSSLTLCRS 190


>gi|229112599|ref|ZP_04242136.1| ComF operon protein 3 [Bacillus cereus Rock1-15]
 gi|228670979|gb|EEL26286.1| ComF operon protein 3 [Bacillus cereus Rock1-15]
          Length = 164

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/45 (46%), Positives = 26/45 (57%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
            +  +G  ILL+DDVYTTG T +     L + GA  VS LT  RS
Sbjct: 120 EEMFSGQHILLVDDVYTTGITVRQIGSLLYERGAREVSSLTLCRS 164


>gi|229050852|ref|ZP_04194404.1| ComF operon protein 3 [Bacillus cereus AH676]
 gi|229147721|ref|ZP_04276064.1| ComF operon protein 3 [Bacillus cereus BDRD-ST24]
 gi|228635734|gb|EEK92221.1| ComF operon protein 3 [Bacillus cereus BDRD-ST24]
 gi|228722508|gb|EEL73901.1| ComF operon protein 3 [Bacillus cereus AH676]
          Length = 164

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/45 (46%), Positives = 26/45 (57%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
            +  +G  ILL+DDVYTTG T +     L + GA  VS LT  RS
Sbjct: 120 EEMFSGQHILLVDDVYTTGITVRQIGSLLYERGAREVSSLTLCRS 164


>gi|229153346|ref|ZP_04281524.1| ComF operon protein 3 [Bacillus cereus m1550]
 gi|228629950|gb|EEK86601.1| ComF operon protein 3 [Bacillus cereus m1550]
          Length = 163

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/45 (46%), Positives = 26/45 (57%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
            +  +G  ILL+DDVYTTG T +     L + GA  VS LT  RS
Sbjct: 119 EEMFSGQHILLVDDVYTTGITVRQIGSLLYERGAREVSSLTLCRS 163


>gi|229181452|ref|ZP_04308780.1| ComF operon protein 3 [Bacillus cereus 172560W]
 gi|228602027|gb|EEK59520.1| ComF operon protein 3 [Bacillus cereus 172560W]
          Length = 164

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/45 (46%), Positives = 26/45 (57%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
            +  +G  ILL+DDVYTTG T +     L + GA  VS LT  RS
Sbjct: 120 EEMFSGQHILLVDDVYTTGITVRQIGSLLYERGAREVSSLTLCRS 164


>gi|229193439|ref|ZP_04320386.1| ComF operon protein 3 [Bacillus cereus ATCC 10876]
 gi|228589971|gb|EEK47843.1| ComF operon protein 3 [Bacillus cereus ATCC 10876]
          Length = 190

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/45 (46%), Positives = 26/45 (57%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
            +  +G  ILL+DDVYTTG T +     L + GA  VS LT  RS
Sbjct: 146 EEMFSGQHILLVDDVYTTGITVRQIGSLLYERGAREVSSLTLCRS 190


>gi|218234900|ref|YP_002369966.1| comF operon protein 3 [Bacillus cereus B4264]
 gi|218162857|gb|ACK62849.1| comF operon protein 3 [Bacillus cereus B4264]
          Length = 190

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/45 (46%), Positives = 26/45 (57%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
            +  +G  ILL+DDVYTTG T +     L + GA  VS LT  RS
Sbjct: 146 EEMFSGQHILLVDDVYTTGITVRQIGSLLYERGAREVSSLTLCRS 190


>gi|212636635|ref|YP_002313160.1| ribose-phosphate pyrophosphokinase [Shewanella piezotolerans WP3]
 gi|212558119|gb|ACJ30573.1| Ribose-phosphate pyrophosphokinase [Shewanella piezotolerans WP3]
          Length = 324

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 22/49 (44%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   V G   +++DD+  TG T   AA ALK+ GA  V          
Sbjct: 215 HIIGDVQGRDCIIVDDMIDTGGTLCKAAEALKEHGANRVFAYATHPVFS 263


>gi|206970476|ref|ZP_03231429.1| comF operon protein 3 [Bacillus cereus AH1134]
 gi|206735053|gb|EDZ52222.1| comF operon protein 3 [Bacillus cereus AH1134]
          Length = 190

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/45 (46%), Positives = 26/45 (57%)

Query: 12  SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
            +  +G  ILL+DDVYTTG T +     L + GA  VS LT  RS
Sbjct: 146 EEMFSGQHILLVDDVYTTGITVRQIGSLLYERGAREVSSLTLCRS 190


>gi|124483374|emb|CAM32560.1| Phosphoribosylpyrophosphate synthetase protein [Herbaspirillum
           seropedicae]
          Length = 317

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/46 (30%), Positives = 19/46 (41%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
             V G   +++DD+  T  T   AA  LK+ GA  V        L 
Sbjct: 211 GEVEGRNCVIMDDMVDTAGTLTKAAEVLKERGAKKVVAYCTHPVLS 256


>gi|187927323|ref|YP_001897810.1| putative competence protein F-like protein [Ralstonia pickettii
           12J]
 gi|309779976|ref|ZP_07674730.1| ComF family protein [Ralstonia sp. 5_7_47FAA]
 gi|187724213|gb|ACD25378.1| putative competence protein F-related protein [Ralstonia pickettii
           12J]
 gi|308921335|gb|EFP66978.1| ComF family protein [Ralstonia sp. 5_7_47FAA]
          Length = 240

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56
           +  AF V +     +AG  I ++DDV TTG T    A  LK+AGA  V+ +   R+
Sbjct: 186 LHGAFVVAEPAR--IAGRHIGVVDDVMTTGTTLGEIATQLKRAGATRVTNVVALRT 239


>gi|157164147|ref|YP_001467207.1| ribose-phosphate pyrophosphokinase [Campylobacter concisus 13826]
 gi|112799938|gb|EAT97282.1| ribose-Phosphate pyrophosphokinase (rppk)
           (phosphoribosylpyrophosphate synthetase) (p-rib-pp
           synthetase) (prpp synthetase) [Campylobacter concisus
           13826]
          Length = 309

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/46 (30%), Positives = 20/46 (43%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
             V G  ++L+DD+  T  T   AA   K+ GA +V        L 
Sbjct: 208 GDVKGKDVILVDDMIDTAGTIVKAAEIFKERGATSVMAFCTHPVLS 253


>gi|66809283|ref|XP_638364.1| hypoxanthine phosphoribosyltransferase [Dictyostelium discoideum
           AX4]
 gi|74853931|sp|Q54NJ8|HPRT_DICDI RecName: Full=Hypoxanthine-guanine phosphoribosyltransferase;
           Short=HGPRT; Short=HGPRTase
 gi|60466806|gb|EAL64853.1| hypoxanthine phosphoribosyltransferase [Dictyostelium discoideum
           AX4]
          Length = 180

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 9/53 (16%), Positives = 19/53 (35%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               +   +   + G  +L+I+D+  +G T K     L      ++      R
Sbjct: 78  GVIRIMMDLRTSIEGKDVLIIEDIVDSGLTLKHLMELLNHRNPNSLHTAVLLR 130


>gi|332767441|gb|EGJ97635.1| ribose-phosphate diphosphokinase [Shigella flexneri 2930-71]
          Length = 312

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           ++   VAG   +L+DD+  TG T   AA ALK+ GA  V          
Sbjct: 203 HIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFS 251


>gi|307707911|ref|ZP_07644386.1| hypoxanthine phosphoribosyltransferase [Streptococcus mitis NCTC
           12261]
 gi|307615976|gb|EFN95174.1| hypoxanthine phosphoribosyltransferase [Streptococcus mitis NCTC
           12261]
          Length = 180

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
              N+ Q V++ + G  +L ++D+  TG T K          A +V I T 
Sbjct: 78  GVINIKQDVTQDIKGRHVLFVEDIIDTGQTLKNLRDMFIAREAASVHIATL 128


>gi|291546768|emb|CBL19876.1| amidophosphoribosyltransferase [Ruminococcus sp. SR1/5]
          Length = 464

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/40 (35%), Positives = 20/40 (50%)

Query: 11  VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
           +   V G +I+L+DD    G T       LK+AGA  V +
Sbjct: 346 LESVVKGKRIVLVDDSIVRGTTIANLIHMLKEAGAKEVHV 385


>gi|291279982|ref|YP_003496817.1| amidophosphoribosyltransferase [Deferribacter desulfuricans SSM1]
 gi|290754684|dbj|BAI81061.1| amidophosphoribosyltransferase [Deferribacter desulfuricans SSM1]
          Length = 463

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 12/41 (29%), Positives = 22/41 (53%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
            V   + G +++++DD    G T++     LK+AGA  V +
Sbjct: 339 AVRSVIEGKRVVVVDDSIVRGTTSRKIVKMLKEAGAKEVHM 379


>gi|291087306|ref|ZP_06571895.1| hypoxanthine phosphoribosyltransferase [Clostridium sp. M62/1]
 gi|291075291|gb|EFE12655.1| hypoxanthine phosphoribosyltransferase [Clostridium sp. M62/1]
          Length = 179

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 9/51 (17%), Positives = 24/51 (47%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + + + +AG  +L+++D+  +G T       LK+    ++ + T 
Sbjct: 81  GIVKIVKDLDEPLAGKDVLIVEDIIDSGRTLAYLIEVLKQRNPKSIQLCTL 131


>gi|205356401|ref|ZP_03223166.1| ribose phosphate pyrophosphokinase [Campylobacter jejuni subsp.
           jejuni CG8421]
 gi|205345786|gb|EDZ32424.1| ribose phosphate pyrophosphokinase [Campylobacter jejuni subsp.
           jejuni CG8421]
          Length = 309

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 22/46 (47%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
             V   +++L+DD+  T  T   AA ALK+ GA +V        L 
Sbjct: 207 GDVKDKEVILVDDIIDTAGTIVKAAEALKEKGAKSVMACCTHAVLS 252


>gi|168705168|ref|ZP_02737445.1| hypoxanthine-guanine phosphoribosyltransferase [Gemmata
           obscuriglobus UQM 2246]
          Length = 171

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 24/57 (42%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           +     +   +   +AG  ILL+DD+  TG T       L   GA +V +    R L
Sbjct: 70  VSGLLEIRDDLLPDIAGRHILLLDDILDTGKTLARVVAHLIDRGAASVKVGVLLRKL 126


>gi|86153102|ref|ZP_01071307.1| ribose-phosphate pyrophosphokinase [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|121612719|ref|YP_001000592.1| ribose-phosphate pyrophosphokinase [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|157415175|ref|YP_001482431.1| ribose-phosphate pyrophosphokinase [Campylobacter jejuni subsp.
           jejuni 81116]
 gi|167005523|ref|ZP_02271281.1| ribose-phosphate pyrophosphokinase [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|85843987|gb|EAQ61197.1| ribose-phosphate pyrophosphokinase [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|87248876|gb|EAQ71839.1| ribose-phosphate pyrophosphokinase [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|157386139|gb|ABV52454.1| ribose-phosphate pyrophosphokinase [Campylobacter jejuni subsp.
           jejuni 81116]
 gi|307747816|gb|ADN91086.1| Ribose-phosphate pyrophosphokinase [Campylobacter jejuni subsp.
           jejuni M1]
 gi|315932601|gb|EFV11532.1| Ribose-phosphate diphosphokinase [Campylobacter jejuni subsp.
           jejuni 327]
          Length = 309

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 22/46 (47%)

Query: 13  KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
             V   +++L+DD+  T  T   AA ALK+ GA +V        L 
Sbjct: 207 GDVKDKEVILVDDIIDTAGTIVKAAEALKEKGAKSVMACCTHAVLS 252


>gi|114321584|ref|YP_743267.1| competence protein F [Alkalilimnicola ehrlichii MLHE-1]
 gi|114227978|gb|ABI57777.1| competence protein F [Alkalilimnicola ehrlichii MLHE-1]
          Length = 262

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 25/58 (43%), Gaps = 4/58 (6%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           +R AF +            + L+DDV TTGAT    A  LK AG   V     +R+  
Sbjct: 189 VRGAFVLEGAPPA----QHVALVDDVMTTGATLDEIAGCLKAAGVEVVEAWAVARTPP 242


>gi|291287888|ref|YP_003504704.1| amidophosphoribosyltransferase [Denitrovibrio acetiphilus DSM
           12809]
 gi|290885048|gb|ADD68748.1| amidophosphoribosyltransferase [Denitrovibrio acetiphilus DSM
           12809]
          Length = 454

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 11/41 (26%), Positives = 23/41 (56%)

Query: 10  YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50
            V + + G +++++DD    G T++     L++AGA  V +
Sbjct: 338 PVREVIEGKRVVVVDDSIVRGTTSRKIVKMLREAGAKEVHM 378


>gi|228912804|ref|ZP_04076452.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus
           thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|228925318|ref|ZP_04088415.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus
           thuringiensis serovar pondicheriensis BGSC 4BA1]
 gi|228931567|ref|ZP_04094474.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus
           thuringiensis serovar andalousiensis BGSC 4AW1]
 gi|228943871|ref|ZP_04106257.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus
           thuringiensis serovar monterrey BGSC 4AJ1]
 gi|228983320|ref|ZP_04143534.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus
           thuringiensis serovar tochigiensis BGSC 4Y1]
 gi|229027911|ref|ZP_04184066.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus cereus
           AH1271]
 gi|229089196|ref|ZP_04220478.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus cereus
           Rock3-42]
 gi|229119727|ref|ZP_04248989.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus cereus
           95/8201]
 gi|229136911|ref|ZP_04265539.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus cereus
           BDRD-ST26]
 gi|229153843|ref|ZP_04281974.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus cereus
           ATCC 4342]
 gi|229182459|ref|ZP_04309711.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus cereus
           BGSC 6E1]
 gi|229194455|ref|ZP_04321259.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus cereus
           m1293]
 gi|291612198|ref|YP_016666.2| hypoxanthine-guanine phosphoribosyltransferase [Bacillus anthracis
           str. 'Ames Ancestor']
 gi|224552854|gb|AAT29141.2| hypoxanthine phosphoribosyltransferase [Bacillus anthracis str.
           'Ames Ancestor']
 gi|228589045|gb|EEK47059.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus cereus
           m1293]
 gi|228601039|gb|EEK58607.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus cereus
           BGSC 6E1]
 gi|228629647|gb|EEK86343.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus cereus
           ATCC 4342]
 gi|228646576|gb|EEL02782.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus cereus
           BDRD-ST26]
 gi|228663752|gb|EEL19330.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus cereus
           95/8201]
 gi|228694159|gb|EEL47840.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus cereus
           Rock3-42]
 gi|228733425|gb|EEL84252.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus cereus
           AH1271]
 gi|228776434|gb|EEM24786.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus
           thuringiensis serovar tochigiensis BGSC 4Y1]
 gi|228815828|gb|EEM62063.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus
           thuringiensis serovar monterrey BGSC 4AJ1]
 gi|228828119|gb|EEM73846.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus
           thuringiensis serovar andalousiensis BGSC 4AW1]
 gi|228834365|gb|EEM79905.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus
           thuringiensis serovar pondicheriensis BGSC 4BA1]
 gi|228846864|gb|EEM91868.1| Hypoxanthine-guanine phosphoribosyltransferase [Bacillus
           thuringiensis serovar pulsiensis BGSC 4CC1]
          Length = 179

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V G  IL+++D+  +G T        K   A +V I+T 
Sbjct: 77  GEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTL 127


>gi|108805622|ref|YP_645559.1| hypoxanthine phosphoribosyltransferase [Rubrobacter xylanophilus
           DSM 9941]
 gi|108766865|gb|ABG05747.1| hypoxanthine phosphoribosyltransferase [Rubrobacter xylanophilus
           DSM 9941]
          Length = 175

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 8/51 (15%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + + + ++G  +L+++D+  TG T      +L      ++ I   
Sbjct: 77  GVVRILKDLEEDISGRHVLIVEDIIDTGLTLSYLRRSLLARKPASLEICAL 127


>gi|331270420|ref|YP_004396912.1| competence protein F [Clostridium botulinum BKT015925]
 gi|329126970|gb|AEB76915.1| competence protein F [Clostridium botulinum BKT015925]
          Length = 226

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL 57
           ++N+F         + G KILL+DDV TTGATA   +  +   GA  VSILT ++S 
Sbjct: 171 LKNSFKCID--INKIQGKKILLVDDVLTTGATAFYCSKEMILNGAKDVSILTVAKST 225


>gi|297243773|ref|ZP_06927703.1| hypoxanthine-guanine phosphoribosyltransferase [Gardnerella
           vaginalis AMD]
 gi|296888194|gb|EFH26936.1| hypoxanthine-guanine phosphoribosyltransferase [Gardnerella
           vaginalis AMD]
          Length = 164

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 23/51 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               V + +S  V G  +L+++D+  +G T       LK  GA +V +   
Sbjct: 62  GQITVREDLSTDVRGRDVLIVEDIVDSGRTLAWLVDELKGRGAASVKVFAL 112


>gi|269216264|ref|ZP_06160118.1| hypoxanthine phosphoribosyltransferase [Slackia exigua ATCC 700122]
 gi|269130523|gb|EEZ61601.1| hypoxanthine phosphoribosyltransferase [Slackia exigua ATCC 700122]
          Length = 206

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 11/53 (20%), Positives = 24/53 (45%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55
               + + +S +V G  +++ +D+  +