RPSBLAST alignment for GI: 254780309 and conserved domain: COG1040

>gnl|CDD|31242 COG1040, ComFC, Predicted amidophosphoribosyltransferases [General function prediction only]. Length = 225
 Score = 54.6 bits (131), Expect = 5e-09
 Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 3/57 (5%)

Query: 2   RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58
           + AF +            +LL+DDVYTTGAT K AA  L++AGA  V +LT +R+ +
Sbjct: 172 KGAFRLK---KGIEEPKNVLLVDDVYTTGATLKEAAKLLREAGAKRVFVLTLARAPE 225