RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780309|ref|YP_003064722.1| comF family protein [Candidatus Liberibacter asiaticus str. psy62] (59 letters) >gnl|CDD|31242 COG1040, ComFC, Predicted amidophosphoribosyltransferases [General function prediction only]. Length = 225 Score = 54.6 bits (131), Expect = 5e-09 Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 3/57 (5%) Query: 2 RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58 + AF + +LL+DDVYTTGAT K AA L++AGA V +LT +R+ + Sbjct: 172 KGAFRLK---KGIEEPKNVLLVDDVYTTGATLKEAAKLLREAGAKRVFVLTLARAPE 225 >gnl|CDD|143924 pfam00156, Pribosyltran, Phosphoribosyl transferase domain. This family includes a range of diverse phosphoribosyl transferase enzymes. This family includes: Adenine phosphoribosyltransferase EC:2.4.2.7. Hypoxanthine-guanine-xanthine phosphoribosyltransferase. Hypoxanthine phosphoribosyltransferase EC:2.4.2.8. Ribose-phosphate pyrophosphokinase i EC:2.7.6.1. Amidophosphoribosyltransferase EC:2.4.2.14. Orotate phosphoribosyltransferase EC:2.4.2.10. Uracil phosphoribosyltransferase EC:2.4.2.9. Xanthine-guanine phosphoribosyltransferase EC:2.4.2.22. In Arabidopsis, At the very N-terminus of this domain is the ATP-GTP-binding domain. Length = 123 Score = 34.6 bits (80), Expect = 0.006 Identities = 16/38 (42%), Positives = 23/38 (60%) Query: 15 VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52 + G ++L++DDV TG T + A LKKAGA V + Sbjct: 84 LKGKRVLIVDDVLDTGGTLRAAVELLKKAGAKVVGVAV 121 >gnl|CDD|30809 COG0461, PyrE, Orotate phosphoribosyltransferase [Nucleotide transport and metabolism]. Length = 201 Score = 32.5 bits (74), Expect = 0.027 Identities = 15/39 (38%), Positives = 24/39 (61%) Query: 15 VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53 V G K+++++DV TTG + A AL++AGA V + Sbjct: 110 VKGEKVVVVEDVITTGGSILEAVEALREAGAEVVGVAVI 148 >gnl|CDD|32109 COG1926, COG1926, Predicted phosphoribosyltransferases [General function prediction only]. Length = 220 Score = 32.1 bits (73), Expect = 0.029 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Query: 1 MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52 R A+ + V + G ++L+DD TGAT K A AL+ G + I Sbjct: 109 RREAYRGGRPV-PSLKGRTVILVDDGIATGATMKAAVRALRAKGPKEIVIAV 159 >gnl|CDD|30849 COG0503, Apt, Adenine/guanine phosphoribosyltransferases and related PRPP-binding proteins [Nucleotide transport and metabolism]. Length = 179 Score = 32.2 bits (73), Expect = 0.033 Identities = 13/35 (37%), Positives = 20/35 (57%) Query: 16 AGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50 G ++L++DD+ TG TA L++AGA V Sbjct: 115 PGDRVLIVDDLLATGGTALALIELLEQAGAEVVGA 149 >gnl|CDD|30810 COG0462, PrsA, Phosphoribosylpyrophosphate synthetase [Nucleotide transport and metabolism / Amino acid transport and metabolism]. Length = 314 Score = 30.9 bits (70), Expect = 0.070 Identities = 15/38 (39%), Positives = 21/38 (55%) Query: 15 VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52 V G ++++DD+ TG T AA ALK+ GA V Sbjct: 212 VEGKDVVIVDDIIDTGGTIAKAAKALKERGAKKVYAAA 249 >gnl|CDD|31197 COG0856, COG0856, Orotate phosphoribosyltransferase homologs [Nucleotide transport and metabolism]. Length = 203 Score = 29.5 bits (66), Expect = 0.22 Identities = 14/34 (41%), Positives = 20/34 (58%) Query: 15 VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48 V G + +++DDV TTG+T K LK+ G V Sbjct: 139 VEGKRCVIVDDVITTGSTIKETIEQLKEEGGKPV 172 >gnl|CDD|30979 COG0634, Hpt, Hypoxanthine-guanine phosphoribosyltransferase [Nucleotide transport and metabolism]. Length = 178 Score = 28.9 bits (65), Expect = 0.31 Identities = 12/39 (30%), Positives = 21/39 (53%) Query: 15 VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53 + G +L+++D+ +G T LK+ GA +V I T Sbjct: 91 IKGRDVLIVEDIIDSGLTLSKVRDLLKERGAKSVRIATL 129 >gnl|CDD|30383 COG0034, PurF, Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism]. Length = 470 Score = 28.6 bits (64), Expect = 0.43 Identities = 12/34 (35%), Positives = 20/34 (58%) Query: 15 VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48 V G +++L+DD G T++ L++AGA V Sbjct: 346 VKGKRVVLVDDSIVRGTTSRRIVQMLREAGAKEV 379 >gnl|CDD|36924 KOG1712, KOG1712, KOG1712, Adenine phosphoribosyl transferases [Nucleotide transport and metabolism]. Length = 183 Score = 28.3 bits (63), Expect = 0.50 Identities = 11/33 (33%), Positives = 19/33 (57%) Query: 16 AGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48 G +++++DD+ TG T A L++ GA V Sbjct: 121 PGQRVVVVDDLLATGGTLAAATELLERVGAEVV 153 >gnl|CDD|35792 KOG0572, KOG0572, KOG0572, Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism]. Length = 474 Score = 27.2 bits (60), Expect = 1.0 Identities = 12/40 (30%), Positives = 22/40 (55%) Query: 11 VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50 + ++ G +++L+DD G T+ L++AGA V I Sbjct: 350 LRQNFEGKRVVLVDDSIVRGTTSSPIVKMLREAGAKEVHI 389 >gnl|CDD|32417 COG2236, COG2236, Predicted phosphoribosyltransferases [General function prediction only]. Length = 192 Score = 26.1 bits (57), Expect = 2.1 Identities = 12/28 (42%), Positives = 19/28 (67%) Query: 15 VAGLKILLIDDVYTTGATAKCAAIALKK 42 ++G K+L++DD+ TG T + A LKK Sbjct: 85 LSGKKVLIVDDIVDTGETLELALEELKK 112 >gnl|CDD|32248 COG2065, PyrR, Pyrimidine operon attenuation protein/uracil phosphoribosyltransferase [Nucleotide transport and metabolism]. Length = 179 Score = 25.6 bits (56), Expect = 2.8 Identities = 12/30 (40%), Positives = 18/30 (60%) Query: 15 VAGLKILLIDDVYTTGATAKCAAIALKKAG 44 + G +++L+DDV TG T + A AL G Sbjct: 94 ITGKRVILVDDVLYTGRTIRAALDALVDYG 123 >gnl|CDD|100021 cd02201, FtsZ_type1, FtsZ is a GTPase that is similar to the eukaryotic tubulins and is essential for cell division in prokaryotes. FtsZ is capable of polymerizing in a GTP-driven process into structures similar to those formed by tubulin. FtsZ forms a ring-shaped septum at the site of bacterial cell division, which is required for constriction of cell membrane and cell envelope to yield two daughter cells.. Length = 304 Score = 25.5 bits (57), Expect = 3.4 Identities = 12/24 (50%), Positives = 17/24 (70%), Gaps = 1/24 (4%) Query: 29 TGATAKCAAIALKKAGAMTVSILT 52 TGA A IA K+ GA+TV+++T Sbjct: 100 TGAAPVIAKIA-KEMGALTVAVVT 122 >gnl|CDD|132998 cd00897, UGPase_euk, Eukaryotic UGPase catalyses the synthesis of UDP-Glucose. UGPase (UDP-Glucose Pyrophosphorylase) catalyzes the reversible production of UDP-Glucose and pyrophosphate (PPi) from Glucose-1-phosphate and UTP. UDP-glucose plays pivotal roles in galactose utilization, in glycogen synthesis, and in the synthesis of the carbohydrate moieties of glycolipids, glycoproteins, and proteoglycans. UGPase is found in both prokaryotes and eukaryotes. Interestingly, while the prokaryotic and eukaryotic forms of UGPase catalyze the same reaction, they share low sequence similarity. This family consists of mainly eukaryotic UTP-glucose-1-phosphate uridylyltransferases. Length = 300 Score = 24.5 bits (54), Expect = 7.3 Identities = 12/45 (26%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Query: 12 SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56 + + ++L++ T T K LKK + V I TF++S Sbjct: 47 KTYGVDVPLVLMNSFNTDEDTKK----ILKKYAGVNVDIHTFNQS 87 >gnl|CDD|100095 cd05802, GlmM, GlmM is a bacterial phosphoglucosamine mutase (PNGM) that belongs to the alpha-D-phosphohexomutase superfamily. It is required for the interconversion of glucosamine-6-phosphate and glucosamine-1-phosphate in the biosynthetic pathway of UDP-N-acetylglucosamine, an essential precursor to components of the cell envelope. In order to be active, GlmM must be phosphorylated, which can occur via autophosphorylation or by the Ser/Thr kinase StkP. GlmM functions in a classical ping-pong bi-bi mechanism with glucosamine-1,6-diphosphate as an intermediate. Other members of the alpha-D-phosphohexomutase superfamily include phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, and the bifunctional phosphomannomutase/phosphoglucomutase (PMM/PGM). Each of these enzymes has four domains with a centrally located active site formed by four loops, one from each domain. All four domains are included in this alignment model.. Length = 434 Score = 24.4 bits (54), Expect = 7.3 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Query: 17 GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50 GLKI+L D GA K A ++ GA + I Sbjct: 169 GLKIVL--DC-ANGAAYKVAPEVFRELGAEVIVI 199 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.322 0.131 0.361 Gapped Lambda K H 0.267 0.0849 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 598,832 Number of extensions: 21249 Number of successful extensions: 84 Number of sequences better than 10.0: 1 Number of HSP's gapped: 84 Number of HSP's successfully gapped: 23 Length of query: 59 Length of database: 6,263,737 Length adjustment: 31 Effective length of query: 28 Effective length of database: 5,593,858 Effective search space: 156628024 Effective search space used: 156628024 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 51 (23.2 bits)