RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780309|ref|YP_003064722.1| comF family protein [Candidatus Liberibacter asiaticus str. psy62] (59 letters) >1nul_A XPRT, xanthine-guanine phosphoribosyltransferase; purine salvage enzyme; 1.80A {Escherichia coli} (A:9-131) Length = 123 Score = 37.6 bits (87), Expect = 6e-04 Identities = 12/48 (25%), Positives = 18/48 (37%) Query: 1 MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48 N + G ++IDD+ TG TA KA +T+ Sbjct: 57 HDNQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTI 104 >1hgx_A HGXPRTASE, hypoxanthine-guanine-xanthine phosphoribosyltransferase; glycosyltransferase, purine salvage, transferase (glycosyltransferase); HET: 5GP; 1.90A {Tritrichomonas foetus} (A:18-155) Length = 138 Score = 37.2 bits (86), Expect = 7e-04 Identities = 8/38 (21%), Positives = 18/38 (47%) Query: 15 VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52 + G +L+++D+ TG T L+ ++ + T Sbjct: 76 IEGRHVLVVEDIIDTGLTMYQLLNNLQMRKPASLKVCT 113 >1j7j_A HPRT, hypoxanthine phosphoribosyltransferase; glycosyltransferase, nucleotide metabolism, purine salvage; 2.30A {Salmonella typhimurium} (A:12-150) Length = 139 Score = 36.8 bits (85), Expect = 0.001 Identities = 8/38 (21%), Positives = 18/38 (47%) Query: 15 VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52 + G +L+++D+ +G T L +++I T Sbjct: 79 IRGKDVLIVEDIIDSGNTLSKVREILGLREPKSLAICT 116 >1pzm_A HGPRT, hypoxanthine-guanine phosphoribosyltransferase; HET: 5GP; 2.10A {Leishmania tarentolae} (A:31-176) Length = 146 Score = 35.4 bits (81), Expect = 0.003 Identities = 5/39 (12%), Positives = 15/39 (38%) Query: 14 HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52 V I+L++D+ + T + + ++ + Sbjct: 85 SVENRHIMLVEDIVDSAITLQYLMRFMLAKKPASLKTVV 123 >3dez_A OPRT, oprtase, orotate phosphoribosyltransferase; glycosyltransferase, magnesium, pyrimidine biosynthesis; 2.40A {Streptococcus mutans} (A:100-183) Length = 84 Score = 35.2 bits (81), Expect = 0.003 Identities = 9/33 (27%), Positives = 21/33 (63%) Query: 19 KILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51 K+++I+D+ +TG + A A ++ GA + ++ Sbjct: 52 KMVIIEDLISTGGSVLDAVAAAQREGADVLGVV 84 >2geb_A Hypoxanthine-guanine phosphoribosyltransferase; HGPRT, mutant, inhibitor design, selectivity; 1.70A {Thermoanaerobacter tengcongensis} (A:20-156) Length = 137 Score = 33.4 bits (76), Expect = 0.012 Identities = 8/38 (21%), Positives = 17/38 (44%) Query: 15 VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52 + G +L+++D+ +G T L ++ I T Sbjct: 77 IEGKDVLIVEDIIDSGLTLAYLRETLLGRKPRSLKICT 114 >1vdm_A Purine phosphoribosyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Pyrococcus horikoshii} (A:) Length = 153 Score = 33.1 bits (75), Expect = 0.013 Identities = 11/34 (32%), Positives = 19/34 (55%) Query: 19 KILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52 +++++DDV TG T + +KK GA + I Sbjct: 85 RVVIVDDVSDTGKTLEVVIEEVKKLGAKEIKIAC 118 >1dqn_A Guanine phosphoribosyltransferase; protein-inhibitor complex, Mg IONS, pyrophosphate, transition state analogue; HET: IMU; 1.75A {Giardia lamblia} (A:60-175) Length = 116 Score = 32.9 bits (75), Expect = 0.014 Identities = 7/37 (18%), Positives = 15/37 (40%) Query: 15 VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51 +++LID+ +G T +K A + + Sbjct: 57 KEKREVVLIDEYVDSGHTIFSIQEQIKHAKICSCFVK 93 >1vch_A Phosphoribosyltransferase-related protein; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.94A {Thermus thermophilus} (A:) Length = 175 Score = 32.9 bits (74), Expect = 0.016 Identities = 9/39 (23%), Positives = 19/39 (48%) Query: 15 VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53 + +++L+ DV +G T + + +AG V+ L Sbjct: 118 LLNQRVVLVSDVVASGETMRAMEKMVLRAGGHVVARLAV 156 >1yfz_A Hypoxanthine-guanine phosphoribosyltransferase; protein-nucleotide complex; HET: IMP; 2.20A {Thermoanaerobacter tengcongensis MB4} (A:39-176) Length = 138 Score = 32.7 bits (74), Expect = 0.017 Identities = 8/38 (21%), Positives = 17/38 (44%) Query: 15 VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52 + G +L+++D+ +G T L ++ I T Sbjct: 78 IEGKDVLIVEDIIDSGLTLAYLRETLLGRKPRSLKICT 115 >1a3c_A PYRR, pyrimidine operon regulatory protein PYRR; transcription regulation, attenuation protein, RNA-binding protein, pyrimidine biosynthesis; 1.60A {Bacillus subtilis} (A:) Length = 181 Score = 32.8 bits (74), Expect = 0.018 Identities = 12/38 (31%), Positives = 18/38 (47%) Query: 15 VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52 + K++L+DDV TG T + AL G + L Sbjct: 96 ITDQKVILVDDVLYTGRTVRAGMDALVDVGRPSSIQLA 133 >1lh0_A OMP synthase; loop closure, monomer closure, orotate phosphoribosyltransferase; HET: ORO PRP; 2.00A {Salmonella typhimurium} (A:40-184) Length = 145 Score = 32.6 bits (74), Expect = 0.019 Identities = 9/38 (23%), Positives = 18/38 (47%) Query: 15 VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52 +++L+DDV T G + + ++ GA +L Sbjct: 76 ALQGRVMLVDDVITAGTAIRESMEIIQAHGATLAGVLI 113 >1tc1_A Protein (hypoxanthine phosphoribosyltransferase); transferase,phosphoribosyltransferase, purine salvage, nucleotide metabolism; HET: FMB MES; 1.41A {Trypanosoma cruzi} (A:15-160) Length = 146 Score = 31.2 bits (70), Expect = 0.052 Identities = 5/42 (11%), Positives = 14/42 (33%) Query: 11 VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52 + G +L+++D+ T T ++ + Sbjct: 83 TRHSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVV 124 >1xtt_A Probable uracil phosphoribosyltransferase; tetramer, type 1 phosphoribosyltransferase, UMP complex; HET: U5P; 1.80A {Sulfolobus solfataricus} (A:) Length = 216 Score = 30.6 bits (68), Expect = 0.070 Identities = 6/42 (14%), Positives = 14/42 (33%) Query: 10 YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51 +++ D + T +T + KA + I+ Sbjct: 126 IPDIRAKVDNVIIADPMIATASTMLKVLEEVVKANPKRIYIV 167 >2ps1_A Orotate phosphoribosyltransferase 1; alpha beta, oprtase-OA-PRPP complex; HET: ORO PRP; 1.75A {Saccharomyces cerevisiae} PDB: 2pry_A* 2prz_A* (A:1-20,A:44-207) Length = 184 Score = 30.8 bits (69), Expect = 0.071 Identities = 11/39 (28%), Positives = 16/39 (41%) Query: 14 HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52 + +IL+IDDV T G A + A V + Sbjct: 99 ALENKRILIIDDVMTAGTAINEAFEIISNAKGQVVGSII 137 >1o57_A PUR operon repressor; purine operon repressor, helix-turn-helix domain, phosphoribosyltranseferases, domain recombination, DNA binding; HET: EPE P6G 2PE PG4 1PE; 2.20A {Bacillus subtilis} (A:77-291) Length = 215 Score = 30.5 bits (68), Expect = 0.078 Identities = 10/38 (26%), Positives = 13/38 (34%) Query: 15 VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52 G +L+IDD G T L + A I Sbjct: 118 KTGSNVLIIDDFMKAGGTINGMINLLDEFNANVAGIGV 155 >1ao0_A Glutamine phosphoribosylpyrophosphate amidotransferase; glutamine amidotransferase, prtase, purine biosynthesis, phosphoribosyltransferase; HET: 5GP ADP; 2.80A {Bacillus subtilis} (A:242-459) Length = 218 Score = 30.2 bits (67), Expect = 0.094 Identities = 13/55 (23%), Positives = 24/55 (43%) Query: 1 MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55 + V V G +++++DD G T++ L++AGA V + S Sbjct: 81 EQGVRMKLSAVRGVVEGKRVVMVDDSIVRGTTSRRIVTMLREAGATEVHVKISSP 135 >1ufr_A TT1027, PYR mRNA-binding attenuation protein; pyrimidine nucleotide biosynthesis, transcriptional attenuation, RNA-binding protein; 2.60A {Thermus thermophilus} (A:11-155) Length = 145 Score = 30.4 bits (68), Expect = 0.096 Identities = 14/34 (41%), Positives = 18/34 (52%) Query: 15 VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48 + G I+L+DDV TG TA+ A AL G Sbjct: 84 LTGKAIVLVDDVLYTGRTARAALDALIDLGRPRR 117 >1ecf_A Glutamine phosphoribosylpyrophosphate amidotransferase; purine biosynthesis, glycosyltransferase, glutamine amidotransferase; HET: PIN; 2.00A {Escherichia coli} (A:258-459) Length = 202 Score = 28.7 bits (63), Expect = 0.27 Identities = 10/46 (21%), Positives = 19/46 (41%) Query: 10 YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR 55 +LL+DD G T++ ++AGA V + + + Sbjct: 95 ANRAEFRDKNVLLVDDSIVRGTTSEQIIEMAREAGAKKVYLASAAP 140 >1y0b_A Xanthine phosphoribosyltransferase; purine metabolism, structural genomics, PSI, protein structure initative; HET: G4P; 1.80A {Bacillus subtilis} (A:) Length = 197 Score = 27.9 bits (61), Expect = 0.46 Identities = 11/40 (27%), Positives = 15/40 (37%) Query: 14 HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53 +L+IDD G A +K+AGA I Sbjct: 117 LSDQDHVLIIDDFLANGQAAHGLVSIVKQAGASIAGIGIV 156 >2aee_A OPRT, oprtase, orotate phosphoribosyltransferase; structural genomics, PSI, protein structure initiative; 1.95A {Streptococcus pyogenes} (A:68-174) Length = 107 Score = 27.9 bits (62), Expect = 0.46 Identities = 11/37 (29%), Positives = 23/37 (62%) Query: 15 VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51 + G K+++I+D+ +TG + AA A + GA + ++ Sbjct: 48 LKGQKMVIIEDLISTGGSVLDAAAAASREGADVLGVV 84 >1l1q_A Adenine phosphoribosyltransferase; aprtase, giardia lamblia, purine metabolism, catalytic loop; HET: 9DA; 1.85A {Giardia intestinalis} (A:) Length = 186 Score = 27.2 bits (59), Expect = 0.75 Identities = 12/42 (28%), Positives = 16/42 (38%) Query: 9 QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50 + +LL DDV TG T A + AG +I Sbjct: 109 VQKRQLGPHDVVLLHDDVLATGGTLLAAIELCETAGVKPENI 150 >2yzk_A OPRT, oprtase, orotate phosphoribosyltransferase; rossmann fold, glycosyltransferase, magnesium, pyrimidine biosynthesis, structural genomics; 1.80A {Aeropyrum pernix} (A:1-10,A:35-178) Length = 154 Score = 26.9 bits (59), Expect = 1.0 Identities = 10/45 (22%), Positives = 19/45 (42%) Query: 9 QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53 V +++++DDV TTG + + L+ G + L Sbjct: 74 SQVEGDPPKGRVVVVDDVATTGTSIAKSIEVLRSNGYTVGTALVL 118 >1i5e_A Uracil phosphoribosyltransferase; salvage pathway; HET: U5P; 3.00A {Bacillus caldolyticus} (A:1-8,A:70-209) Length = 148 Score = 26.8 bits (59), Expect = 1.2 Identities = 12/39 (30%), Positives = 20/39 (51%) Query: 14 HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52 V +++D + TG +A A ALKK GA ++ + Sbjct: 60 DVEERDFIIVDPMLATGGSAVAAIDALKKRGAKSIKFMC 98 >2ehj_A Uracil phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Escherichia coli} (A:) Length = 208 Score = 26.7 bits (58), Expect = 1.2 Identities = 10/49 (20%), Positives = 20/49 (40%) Query: 2 RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50 Q + ++ L++D + TG + LKKAG ++ + Sbjct: 108 LEPVPYFQKLVSNIDERMALIVDPMLATGGSVIATIDLLKKAGCSSIKV 156 >1zn8_A APRT, adenine phosphoribosyltransferase; glycosyltransferase, polymorphism, purine salvage; HET: AMP; 1.76A {Homo sapiens} (A:) Length = 180 Score = 26.4 bits (57), Expect = 1.3 Identities = 9/44 (20%), Positives = 19/44 (43%) Query: 10 YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53 G +++++DD+ TG T A L + A + ++ Sbjct: 113 QKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSL 156 >2dy0_A APRT, adenine phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.25A {Escherichia coli K12} (A:) Length = 190 Score = 25.4 bits (54), Expect = 3.1 Identities = 10/47 (21%), Positives = 20/47 (42%) Query: 6 NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52 + +V G K+L++DD+ TG T + +++ G Sbjct: 115 QLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAF 161 >2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} (A:) Length = 104 Score = 24.9 bits (54), Expect = 4.4 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 5/43 (11%) Query: 14 HVAGLK----ILLIDDVYTTGATAKCAAIALKKAGA-MTVSIL 51 H AGL+ + I+ V T G T K ++ +G +T+ L Sbjct: 62 HCAGLQAGDVLANINGVSTEGFTYKQVVDLIRSSGNLLTIETL 104 >3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} (A:1-40,A:123-179,A:298-355) Length = 155 Score = 24.1 bits (52), Expect = 7.4 Identities = 7/17 (41%), Positives = 11/17 (64%) Query: 35 CAAIALKKAGAMTVSIL 51 A+AL +AG V++L Sbjct: 18 SCALALHQAGIGKVTLL 34 >1u9y_A RPPK;, ribose-phosphate pyrophosphokinase; PRPP synthase, transferase; 2.65A {Methanocaldococcus jannaschii} (A:143-270) Length = 128 Score = 23.8 bits (51), Expect = 7.6 Identities = 10/33 (30%), Positives = 17/33 (51%) Query: 19 KILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51 + ++DD+ +TG T A LK+ GA + Sbjct: 65 DVFIVDDIISTGGTMATAVKLLKEQGAKKIIAA 97 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.322 0.131 0.361 Gapped Lambda K H 0.267 0.0644 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 380,554 Number of extensions: 11315 Number of successful extensions: 81 Number of sequences better than 10.0: 1 Number of HSP's gapped: 81 Number of HSP's successfully gapped: 33 Length of query: 59 Length of database: 4,956,049 Length adjustment: 28 Effective length of query: 31 Effective length of database: 4,009,509 Effective search space: 124294779 Effective search space used: 124294779 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 50 (23.2 bits)