RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780309|ref|YP_003064722.1| comF family protein [Candidatus Liberibacter asiaticus str. psy62] (59 letters) >1vch_A Phosphoribosyltransferase-related protein; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.94A {Thermus thermophilus} SCOP: c.61.1.1 Length = 175 Score = 38.9 bits (90), Expect = 3e-04 Identities = 9/39 (23%), Positives = 19/39 (48%) Query: 15 VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53 + +++L+ DV +G T + + +AG V+ L Sbjct: 118 LLNQRVVLVSDVVASGETMRAMEKMVLRAGGHVVARLAV 156 >1o57_A PUR operon repressor; purine operon repressor, helix-turn-helix domain, phosphoribosyltranseferases, domain recombination, DNA binding; HET: EPE P6G 2PE PG4 1PE; 2.20A {Bacillus subtilis} SCOP: a.4.5.40 c.61.1.1 PDB: 1p4a_A* Length = 291 Score = 36.0 bits (83), Expect = 0.002 Identities = 10/35 (28%), Positives = 13/35 (37%) Query: 17 GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51 G +L+IDD G T L + A I Sbjct: 196 GSNVLIIDDFMKAGGTINGMINLLDEFNANVAGIG 230 >2wns_A Orotate phosphoribosyltransferase; alternative splicing, multifunctional enzyme, lyase, polymorphism, decarboxylase, phosphoprotein; HET: OMP; 1.90A {Homo sapiens} Length = 205 Score = 36.0 bits (83), Expect = 0.002 Identities = 11/45 (24%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Query: 15 VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT-FSRSLK 58 G L+I+DV T+G++ L+K G + R Sbjct: 109 NPGETCLIIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQG 153 >1qb7_A APRT, adenine phosphoribosyltransferase; dinucleotide binding fold; HET: ADE CIT; 1.50A {Leishmania donovani} SCOP: c.61.1.1 PDB: 1qb8_A* 1qcc_A* 1qcd_A 1mzv_A* Length = 236 Score = 35.8 bits (82), Expect = 0.003 Identities = 12/37 (32%), Positives = 22/37 (59%) Query: 17 GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53 G +++LIDDV TG TA ++ + A+ V +++ Sbjct: 138 GSRVVLIDDVLATGGTALSGLQLVEASDAVVVEMVSI 174 >1l1q_A Adenine phosphoribosyltransferase; aprtase, giardia lamblia, purine metabolism, catalytic loop; HET: 9DA; 1.85A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1l1r_A* Length = 186 Score = 34.9 bits (80), Expect = 0.004 Identities = 11/29 (37%), Positives = 13/29 (44%) Query: 17 GLKILLIDDVYTTGATAKCAAIALKKAGA 45 +LL DDV TG T A + AG Sbjct: 117 HDVVLLHDDVLATGGTLLAAIELCETAGV 145 >1g2q_A Adenine phosphoribosyltransferase 1; dimer, single domain, catalytic loop; 1.50A {Saccharomyces cerevisiae} SCOP: c.61.1.1 PDB: 1g2p_A Length = 187 Score = 34.6 bits (79), Expect = 0.005 Identities = 9/38 (23%), Positives = 19/38 (50%) Query: 14 HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51 AG ++++DD+ TG +A A +++ A + Sbjct: 119 IPAGSNVIIVDDIIATGGSAAAAGELVEQLEANLLEYN 156 >1zn8_A APRT, adenine phosphoribosyltransferase; glycosyltransferase, polymorphism, purine salvage; HET: AMP; 1.76A {Homo sapiens} SCOP: c.61.1.1 PDB: 1ore_A* 1zn7_A* 1zn9_A* Length = 180 Score = 34.7 bits (79), Expect = 0.005 Identities = 9/40 (22%), Positives = 19/40 (47%) Query: 14 HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53 G +++++DD+ TG T A L + A + ++ Sbjct: 117 LEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSL 156 >2jky_A Hypoxanthine-guanine phosphoribosyltransferase; nucleus, cytoplasm, magnesium, GMP complex, FLIP peptide-plane, glycosyltransferase; HET: 5GP; 2.3A {Saccharomyces cerevisiae} PDB: 2jkz_A* Length = 213 Score = 34.1 bits (77), Expect = 0.007 Identities = 10/34 (29%), Positives = 16/34 (47%) Query: 15 VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48 + G +L++D+V T T A L+K A Sbjct: 100 LVGKNVLIVDEVDDTRTTLHYALSELEKDAAEQA 133 >1wd5_A Hypothetical protein TT1426; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; HET: MES; 2.00A {Thermus thermophilus} SCOP: c.61.1.1 Length = 208 Score = 32.8 bits (74), Expect = 0.019 Identities = 10/44 (22%), Positives = 17/44 (38%) Query: 2 RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGA 45 R G ++L+DD TGA+ + A + + G Sbjct: 105 RAERYRRVRPKAARKGRDVVLVDDGVATGASMEAALSVVFQEGP 148 >2dy0_A APRT, adenine phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.25A {Escherichia coli K12} Length = 190 Score = 32.3 bits (73), Expect = 0.025 Identities = 9/35 (25%), Positives = 17/35 (48%) Query: 17 GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51 G K+L++DD+ TG T + +++ G Sbjct: 126 GDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAA 160 >3dez_A OPRT, oprtase, orotate phosphoribosyltransferase; glycosyltransferase, magnesium, pyrimidine biosynthesis; 2.40A {Streptococcus mutans} Length = 243 Score = 31.9 bits (72), Expect = 0.032 Identities = 12/44 (27%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Query: 17 GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT-FSRSLKD 59 G K+++I+D+ +TG + A A ++ GA + ++ F+ L Sbjct: 149 GQKMVIIEDLISTGGSVLDAVAAAQREGADVLGVVAIFTYELPK 192 >3m3h_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, structural genomics, infectious diseases; 1.75A {Bacillus anthracis} PDB: 3osc_A* Length = 234 Score = 31.5 bits (71), Expect = 0.049 Identities = 13/44 (29%), Positives = 26/44 (59%) Query: 9 QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52 Q K G K+++++D+ +TG +A AL++AG + I++ Sbjct: 129 QIEGKAEKGQKVVVVEDLISTGGSAITCVEALREAGCEVLGIVS 172 >3dah_A Ribose-phosphate pyrophosphokinase; seattle structural genomics center for infectious disease, ssgcid, cytoplasm, magnesium; HET: AMP; 2.30A {Burkholderia pseudomallei 1710B} Length = 319 Score = 31.0 bits (70), Expect = 0.064 Identities = 13/37 (35%), Positives = 18/37 (48%) Query: 14 HVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50 V G +++DD+ T T AA LK+ GA V Sbjct: 213 EVEGRTCVIMDDMVDTAGTLCKAAQVLKERGAKQVFA 249 >1ecf_A Glutamine phosphoribosylpyrophosphate amidotransferase; purine biosynthesis, glycosyltransferase, glutamine amidotransferase; HET: PIN; 2.00A {Escherichia coli} SCOP: c.61.1.1 d.153.1.1 PDB: 1ecb_A* 1ecc_A* 1ecg_A* 1ecj_A* Length = 504 Score = 30.4 bits (68), Expect = 0.10 Identities = 10/40 (25%), Positives = 17/40 (42%) Query: 11 VSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50 +LL+DD G T++ ++AGA V + Sbjct: 353 NRAEFRDKNVLLVDDSIVRGTTSEQIIEMAREAGAKKVYL 392 >3ohp_A Hypoxanthine phosphoribosyltransferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Vibrio cholerae} PDB: 1g9s_A* 1g9t_A* 1grv_A 1j7j_A Length = 177 Score = 28.7 bits (64), Expect = 0.35 Identities = 10/38 (26%), Positives = 16/38 (42%) Query: 16 AGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53 G +LL++D+ TG T L ++ I T Sbjct: 90 KGKDVLLVEDIIDTGNTLNKVKEILALREPKSIRICTL 127 >1nul_A XPRT, xanthine-guanine phosphoribosyltransferase; purine salvage enzyme; 1.80A {Escherichia coli} SCOP: c.61.1.1 PDB: 1a96_A* 1a95_A 1a98_A 1a97_A* Length = 152 Score = 28.3 bits (63), Expect = 0.39 Identities = 14/54 (25%), Positives = 20/54 (37%) Query: 6 NVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59 + G ++IDD+ TG TA KA +T+ R L D Sbjct: 70 ELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVD 123 >3dmp_A Uracil phosphoribosyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.60A {Burkholderia pseudomallei} Length = 217 Score = 28.2 bits (63), Expect = 0.46 Identities = 9/37 (24%), Positives = 16/37 (43%) Query: 15 VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSIL 51 + +L D + TG +A A LK+ G ++ Sbjct: 127 LEDRIFILCDPMVATGYSAAHAIDVLKRRGVPGERLM 163 >1lh0_A OMP synthase; loop closure, monomer closure, orotate phosphoribosyltransferase; HET: ORO PRP; 2.00A {Salmonella typhimurium} SCOP: c.61.1.1 PDB: 1opr_A* 1sto_A* 1oro_A Length = 213 Score = 27.7 bits (61), Expect = 0.60 Identities = 9/35 (25%), Positives = 18/35 (51%) Query: 19 KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53 +++L+DDV T G + + ++ GA +L Sbjct: 119 RVMLVDDVITAGTAIRESMEIIQAHGATLAGVLIS 153 >3mjd_A Orotate phosphoribosyltransferase; IDP02311, csgid, structural genomics, center for structural genomics of infectious diseases; 1.90A {Francisella tularensis} Length = 232 Score = 27.7 bits (61), Expect = 0.66 Identities = 12/34 (35%), Positives = 16/34 (47%) Query: 19 KILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52 K+LLIDDV T G + LK A ++ Sbjct: 138 KVLLIDDVMTAGTAFYESYNKLKIINAKIAGVVL 171 >1y0b_A Xanthine phosphoribosyltransferase; purine metabolism, structural genomics, PSI, protein structure initative; HET: G4P; 1.80A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 2fxv_A* Length = 197 Score = 27.7 bits (61), Expect = 0.69 Identities = 11/37 (29%), Positives = 15/37 (40%) Query: 17 GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53 +L+IDD G A +K+AGA I Sbjct: 120 QDHVLIIDDFLANGQAAHGLVSIVKQAGASIAGIGIV 156 >3n2l_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, infectious diseases; 2.10A {Vibrio cholerae} Length = 238 Score = 26.9 bits (59), Expect = 1.0 Identities = 8/35 (22%), Positives = 17/35 (48%) Query: 19 KILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53 +++L+DDV T G + + ++ A +L Sbjct: 144 RVMLVDDVITAGTAIRESMELIQANKADLAGVLVA 178 >1w30_A PYRR bifunctional protein; transferase, glycosyltransferase, PSI, protein structure initiative, TB structural genomics consortium, TB; 1.9A {Mycobacterium tuberculosis} SCOP: c.61.1.1 Length = 201 Score = 25.8 bits (56), Expect = 2.7 Identities = 9/31 (29%), Positives = 17/31 (54%) Query: 15 VAGLKILLIDDVYTTGATAKCAAIALKKAGA 45 + ++L+DDV +G + + A AL+ G Sbjct: 110 IDDALVILVDDVLYSGRSVRSALDALRDVGR 140 >1a3c_A PYRR, pyrimidine operon regulatory protein PYRR; transcription regulation, attenuation protein, RNA-binding protein, pyrimidine biosynthesis; 1.60A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 1a4x_A 2igb_A* 1xz8_A* 1non_A 1xzn_A* Length = 181 Score = 25.8 bits (56), Expect = 2.8 Identities = 11/41 (26%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Query: 14 HVAGLKILLIDDVYTTGATAKCAAIALKKAG-AMTVSILTF 53 + K++L+DDV TG T + AL G ++ + Sbjct: 95 DITDQKVILVDDVLYTGRTVRAGMDALVDVGRPSSIQLAVL 135 >1v9s_A Uracil phosphoribosyltransferase; pyrimidine salvage, oligomerization, structural genomics; 2.10A {Thermus thermophilus HB8} SCOP: c.61.1.1 Length = 208 Score = 25.3 bits (55), Expect = 3.4 Identities = 14/58 (24%), Positives = 25/58 (43%), Gaps = 2/58 (3%) Query: 1 MRNAFNVPQYV--SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRS 56 + V Y+ +A + L+D + TG +A A LK+ GA V ++ + Sbjct: 105 PESLNPVQYYIKLPPDIAERRAFLLDPMLATGGSASLALSLLKERGATGVKLMAILAA 162 >1ao0_A Glutamine phosphoribosylpyrophosphate amidotransferase; glutamine amidotransferase, prtase, purine biosynthesis, phosphoribosyltransferase; HET: 5GP ADP; 2.80A {Bacillus subtilis} SCOP: c.61.1.1 d.153.1.1 PDB: 1gph_1* Length = 459 Score = 24.0 bits (51), Expect = 8.9 Identities = 12/42 (28%), Positives = 22/42 (52%) Query: 9 QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50 V V G +++++DD G T++ L++AGA V + Sbjct: 330 SAVRGVVEGKRVVMVDDSIVRGTTSRRIVTMLREAGATEVHV 371 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.322 0.131 0.361 Gapped Lambda K H 0.267 0.0613 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 442,647 Number of extensions: 14297 Number of successful extensions: 115 Number of sequences better than 10.0: 1 Number of HSP's gapped: 115 Number of HSP's successfully gapped: 35 Length of query: 59 Length of database: 5,693,230 Length adjustment: 30 Effective length of query: 29 Effective length of database: 4,965,910 Effective search space: 144011390 Effective search space used: 144011390 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 50 (23.3 bits)