BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780309|ref|YP_003064722.1| comF family protein [Candidatus Liberibacter asiaticus str. psy62] (59 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780309|ref|YP_003064722.1| comF family protein [Candidatus Liberibacter asiaticus str. psy62] Length = 59 Score = 120 bits (301), Expect = 4e-30, Method: Compositional matrix adjust. Identities = 59/59 (100%), Positives = 59/59 (100%) Query: 1 MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59 MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD Sbjct: 1 MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59 >gi|254780409|ref|YP_003064822.1| ribose-phosphate pyrophosphokinase [Candidatus Liberibacter asiaticus str. psy62] Length = 310 Score = 29.6 bits (65), Expect = 0.010, Method: Composition-based stats. Identities = 16/35 (45%), Positives = 22/35 (62%) Query: 15 VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVS 49 V G +LIDD+ TG T AA AL + GA++V+ Sbjct: 207 VEGKDCILIDDIVDTGGTLCGAADALYEQGALSVT 241 >gi|254780336|ref|YP_003064749.1| amidophosphoribosyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 488 Score = 24.6 bits (52), Expect = 0.29, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 20/36 (55%) Query: 15 VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSI 50 +AG +++LIDD G T+ ++ AGA V + Sbjct: 355 LAGKRVVLIDDSIVRGTTSVKIVQMIRSAGASEVHL 390 >gi|254781090|ref|YP_003065503.1| hypothetical protein CLIBASIA_04960 [Candidatus Liberibacter asiaticus str. psy62] Length = 71 Score = 20.8 bits (42), Expect = 4.2, Method: Compositional matrix adjust. Identities = 13/43 (30%), Positives = 20/43 (46%) Query: 17 GLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59 G+ + D Y +G T+K + K G SI T + +KD Sbjct: 12 GVNFRFLLDGYRSGKTSKDKYQKIVKIGDHAESIKTLADFIKD 54 >gi|254780604|ref|YP_003065017.1| 5-aminolevulinate synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 401 Score = 20.4 bits (41), Expect = 5.5, Method: Composition-based stats. Identities = 9/27 (33%), Positives = 13/27 (48%) Query: 20 ILLIDDVYTTGATAKCAAIALKKAGAM 46 I ID+V+ G C A ++ G M Sbjct: 209 ITYIDEVHAVGIHGSCGAGISEREGIM 235 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.322 0.131 0.361 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,569 Number of Sequences: 1233 Number of extensions: 768 Number of successful extensions: 5 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 59 length of database: 328,796 effective HSP length: 31 effective length of query: 28 effective length of database: 290,573 effective search space: 8136044 effective search space used: 8136044 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 31 (16.5 bits)