RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780310|ref|YP_003064723.1| hypothetical protein CLIBASIA_00975 [Candidatus Liberibacter asiaticus str. psy62] (119 letters) >gnl|CDD|31242 COG1040, ComFC, Predicted amidophosphoribosyltransferases [General function prediction only]. Length = 225 Score = 36.9 bits (85), Expect = 0.001 Identities = 19/99 (19%), Positives = 36/99 (36%), Gaps = 3/99 (3%) Query: 19 IYPSICPIYSRIINLRFCLCGHCWSKIHFITAT-EHILKNNKDNIDKDPLKSMQKDLPLT 77 + P C ++ LC C + + I + + K P Sbjct: 9 LLPPRC-WLCLLLLFFPGLCSGCQADLPLIGNLCPLCGLPLSSHACRCGECL-AKPPPFE 66 Query: 78 QIRSVTLYCDMSCVLVRLLKYHDRTDLAIMMAQWMFRVL 116 ++RS+ Y L+ LK+ DLA ++A+ + + L Sbjct: 67 RLRSLGSYNGPLRELISQLKFQGDLDLAKLLARLLAKAL 105 >gnl|CDD|39038 KOG3834, KOG3834, KOG3834, Golgi reassembly stacking protein GRASP65, contains PDZ domain [Intracellular trafficking, secretion, and vesicular transport]. Length = 462 Score = 26.9 bits (59), Expect = 1.3 Identities = 11/40 (27%), Positives = 17/40 (42%) Query: 45 IHFITATEHILKNNKDNIDKDPLKSMQKDLPLTQIRSVTL 84 FI + I N ++ K LK+ + + LT S T Sbjct: 37 FDFIVSINGIRLNKDNDTLKALLKANSEKVKLTVYNSKTQ 76 >gnl|CDD|36677 KOG1464, KOG1464, KOG1464, COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones, Signal transduction mechanisms]. Length = 440 Score = 25.8 bits (56), Expect = 2.8 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 10/51 (19%) Query: 48 ITATEHILKNNKDNIDKDP-LKSMQKDLPLTQIRSVTLYCDMSCVLVRLLK 97 I E ILK+N+ NI DP ++ +DL L IR+ VL++L+K Sbjct: 319 IIEFERILKSNRSNIMDDPFIREHIEDL-LRNIRTQ--------VLLKLIK 360 >gnl|CDD|176757 cd08779, Death_PIDD, Death Domain of p53-induced protein with a death domain. Death domain (DD) found in PIDD (p53-induced protein with a death domain) and similar proteins. PIDD is a component of the PIDDosome complex, which is an oligomeric caspase-activating complex involved in caspase-2 activation and plays a role in mediating stress-induced apoptosis. The PIDDosome complex is composed of three components, PIDD, RAIDD and caspase-2, which interact through their DDs and DD-like domains. The DD of PIDD interacts with the DD of RAIDD, which also contains a Caspase Activation and Recruitment Domain (CARD) that interacts with the caspase-2 CARD. Autoproteolysis of PIDD determines the downstream signaling event, between pro-survival NF-kB or pro-death caspase-2 activation. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD, DED (Death Effector Domain), and PYRIN. They serve as adaptors in signaling pathways and can recruit other proteins into signaling complexes. Length = 86 Score = 25.1 bits (55), Expect = 4.4 Identities = 16/57 (28%), Positives = 23/57 (40%), Gaps = 11/57 (19%) Query: 52 EHILKNNKDNIDK---DPLKSMQKDLPLTQIRSVTLYCDMSCVLVRLLKYHDRTDLA 105 + I NN+D++D+ D L S + D LV L+ R DLA Sbjct: 31 QRIKYNNRDDLDEQIFDMLFSWAQRQAGDP--------DAVGKLVTALEESGRQDLA 79 >gnl|CDD|35437 KOG0216, KOG0216, KOG0216, RNA polymerase I, second largest subunit [Transcription]. Length = 1111 Score = 24.5 bits (53), Expect = 7.7 Identities = 9/24 (37%), Positives = 13/24 (54%) Query: 90 CVLVRLLKYHDRTDLAIMMAQWMF 113 VLV L D+ +L I M Q ++ Sbjct: 313 YVLVHLDSDEDKFNLLIFMIQKLY 336 >gnl|CDD|34971 COG5412, COG5412, Phage-related protein [Function unknown]. Length = 637 Score = 24.1 bits (52), Expect = 8.3 Identities = 8/32 (25%), Positives = 16/32 (50%) Query: 1 MPAIIQTVKSIIIELFHCIYPSICPIYSRIIN 32 MP + Q S++ + I+ +I P+ + N Sbjct: 257 MPIVTQAGISVVKDSLSGIWNAIKPLIGFLFN 288 >gnl|CDD|34842 COG5245, DYN1, Dynein, heavy chain [Cytoskeleton]. Length = 3164 Score = 24.2 bits (52), Expect = 9.4 Identities = 11/56 (19%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Query: 49 TATEHILKNNKDNIDKDPLKSMQKDLPLTQIRSVTLYCDMSCVLVRLLKYHDRTDL 104 T T L + + P + + P ++ + L+CD L +Y+ T + Sbjct: 1532 TMTPSKLSVLERETEYYPNTGVVRLYPKPVVKDLVLFCD-EINLPYGFEYYPPTVI 1586 >gnl|CDD|36500 KOG1286, KOG1286, KOG1286, Amino acid transporters [Amino acid transport and metabolism]. Length = 554 Score = 24.1 bits (52), Expect = 9.8 Identities = 11/37 (29%), Positives = 18/37 (48%), Gaps = 4/37 (10%) Query: 68 KSMQKDLPLTQIRSV----TLYCDMSCVLVRLLKYHD 100 K+ +K +P +S+ Y S VL L+ Y+D Sbjct: 259 KNPRKAIPKAIKQSLLRILLFYILSSIVLGLLVPYND 295 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.332 0.142 0.462 Gapped Lambda K H 0.267 0.0707 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,453,773 Number of extensions: 66662 Number of successful extensions: 191 Number of sequences better than 10.0: 1 Number of HSP's gapped: 190 Number of HSP's successfully gapped: 14 Length of query: 119 Length of database: 6,263,737 Length adjustment: 81 Effective length of query: 38 Effective length of database: 4,513,408 Effective search space: 171509504 Effective search space used: 171509504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (22.0 bits) S2: 51 (23.5 bits)