BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780310|ref|YP_003064723.1| hypothetical protein CLIBASIA_00975 [Candidatus Liberibacter asiaticus str. psy62] (119 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780310|ref|YP_003064723.1| hypothetical protein CLIBASIA_00975 [Candidatus Liberibacter asiaticus str. psy62] Length = 119 Score = 245 bits (625), Expect = 2e-67, Method: Compositional matrix adjust. Identities = 119/119 (100%), Positives = 119/119 (100%) Query: 1 MPAIIQTVKSIIIELFHCIYPSICPIYSRIINLRFCLCGHCWSKIHFITATEHILKNNKD 60 MPAIIQTVKSIIIELFHCIYPSICPIYSRIINLRFCLCGHCWSKIHFITATEHILKNNKD Sbjct: 1 MPAIIQTVKSIIIELFHCIYPSICPIYSRIINLRFCLCGHCWSKIHFITATEHILKNNKD 60 Query: 61 NIDKDPLKSMQKDLPLTQIRSVTLYCDMSCVLVRLLKYHDRTDLAIMMAQWMFRVLEKI 119 NIDKDPLKSMQKDLPLTQIRSVTLYCDMSCVLVRLLKYHDRTDLAIMMAQWMFRVLEKI Sbjct: 61 NIDKDPLKSMQKDLPLTQIRSVTLYCDMSCVLVRLLKYHDRTDLAIMMAQWMFRVLEKI 119 >gi|254780741|ref|YP_003065154.1| carboxynorspermidine decarboxylase [Candidatus Liberibacter asiaticus str. psy62] Length = 367 Score = 25.0 bits (53), Expect = 0.43, Method: Composition-based stats. Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query: 19 IYPSICPIYSRIINLRFCLCGHCWSKIHF 47 IYP+ P Y+ ++ R CL G + + HF Sbjct: 281 IYPNTGP-YTAMVCGRSCLAGDIFGEFHF 308 >gi|255764505|ref|YP_003065248.2| polysialic acid capsule expression protein [Candidatus Liberibacter asiaticus str. psy62] Length = 341 Score = 23.5 bits (49), Expect = 1.1, Method: Compositional matrix adjust. Identities = 10/30 (33%), Positives = 13/30 (43%) Query: 16 FHCIYPSICPIYSRIINLRFCLCGHCWSKI 45 FHC I I R++ GH SK+ Sbjct: 53 FHCAVEKIKAIKGRVVITGIGKSGHIGSKL 82 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.332 0.142 0.462 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74,523 Number of Sequences: 1233 Number of extensions: 2616 Number of successful extensions: 7 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 6 length of query: 119 length of database: 328,796 effective HSP length: 64 effective length of query: 55 effective length of database: 249,884 effective search space: 13743620 effective search space used: 13743620 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (22.0 bits) S2: 33 (17.3 bits)