HHsearch alignment for GI: 254780311 and conserved domain: TIGR00385

>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily; InterPro: IPR004799 Periplasmic protein thiol:disulphide oxidoreductase is involved in the biogenesis of c-type cytochromes as well as in disulphide bond formation in some periplasmic proteins. This group defines the DsbE subfamily.; GO: 0015036 disulfide oxidoreductase activity, 0017004 cytochrome complex assembly, 0030288 outer membrane-bounded periplasmic space.
Probab=97.87  E-value=0.00013  Score=44.93  Aligned_cols=117  Identities=17%  Similarity=0.205  Sum_probs=90.1

Q ss_pred             ECCCCCCCCCCCCC--CCEEHHHHHCCCEEEEEEECCCCCCCCCHHHCHHHHHHHHHHHHHCCCEEEEEECCCC-HHHHH
Q ss_conf             36706884036888--4023589838974999982288787410010104653112455310110234303540-11366
Q gi|254780311|r   15 VATVLPDGSKAFQW--KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDA-FVMNA   91 (177)
Q Consensus        15 vGd~~Pd~tl~~~~--~~~~~~d~f~gKkVvL~~~P~AfTp~Ct~~~~~~~~~~~~~~~~~~~~~i~~~s~~d~-~~~~a   91 (177)
T Consensus        37 igkpvP~~~~a~L~~~~q~~~~~~~~qG~~~LlNVWAsWCp~CraEHp~-----L~eLak~Grl~ivG~dYKD~~~~Al~  111 (175)
T TIGR00385        37 IGKPVPAFGLAALREPLQLYTADIFRQGKPVLLNVWASWCPPCRAEHPY-----LNELAKEGRLPIVGVDYKDQSQNALK  111 (175)
T ss_pred             CCCCCCCCHHHHCCCCCCCCCHHHHHCCCEEEEEEEECCCCCCHHCCHH-----HHHHHHCCCCEEEEEECCCCCHHHHH
T ss_conf             3889885112202467861364453089606998840368883100057-----89997539730788634788457888


Q ss_pred             HHCCCCCCEEEEEECCCHHHHHHHHCCCCCCCCCCCEEEEEEEEEEC-CCEEEEEEE
Q ss_conf             52235875278610367154333200224765434410015999987-996999997
Q gi|254780311|r   92 WGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIK-DMVVESWFV  147 (177)
Q Consensus        92 w~~~~~~~~~~~l~D~~~~~~~~~g~~~~~~~~g~g~rs~R~a~Ii~-dG~I~~~~~  147 (177)
T Consensus       112 ~LkelGNPy~~~~~D~~G~~glDlGV~GaPE-----------Tflvdg~G~I~YRha  157 (175)
T TIGR00385       112 FLKELGNPYQLILADPKGKLGLDLGVYGAPE-----------TFLVDGNGVILYRHA  157 (175)
T ss_pred             HHHHCCCCEEEEEECCCCCEEEECCCCCCCC-----------CEEECCCCEEEEEEC
T ss_conf             8764489066888789984653226688985-----------478679865877743