HHsearch alignment for GI: 254780312 and conserved domain: PRK09483

>PRK09483 response regulator; Provisional.
Probab=99.88  E-value=2e-21  Score=149.41  Aligned_cols=117  Identities=24%  Similarity=0.369  Sum_probs=111.6

Q ss_pred             EEEEECCCHHHHHHHHHHHHHC-CCEEE-EECCHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             6999759989999999999988-98999-999979999999718998999983655999799999999858998599994
Q gi|254780312|r    4 KILLAEDDDDMRRFLIKALGKA-GYEVV-SCNNGASAYDKVREEPFSLLLTDIVMPEMDGIELARRATELDPDLKVMFIT   81 (122)
Q Consensus         4 rILiVDD~~~~r~~l~~~L~~~-G~~v~-~a~~g~~al~~~~~~~~dlii~D~~mP~~dG~el~~~ir~~~~~~pii~~s   81 (122)
T Consensus         3 ~VlIvDDh~l~r~gl~~~L~~~~~~~vv~~a~~~~~~l~~~~~~~pDvvllDl~lp~~~Gl~~~~~i~~~~p~~~vivls   82 (216)
T PRK09483          3 NVLLVDDHELVRAGIRRILEDIKGIKVVGEASCGEDAVKWCRTNAVDVVLMDMNMPGIGGLEATRKILRSTPDVKIIMLT   82 (216)
T ss_pred             EEEEECCCHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEC
T ss_conf             89998499999999999997489958999989999999999855999999868898987523778887408998578630


Q ss_pred             CCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHC
Q ss_conf             379789999999769986997697989999999999603
Q gi|254780312|r   82 GFAAVALNPDSNAPKNAKVLSKPFHLRDLVNEVNRLLTI  120 (122)
Q Consensus        82 ~~~~~~~~~~~~~~g~~~~l~KP~~~~~L~~~i~~~l~~  120 (122)
T Consensus        83 ~~~~~~~~~~al~~Ga~gyl~K~~~~~~l~~ai~~v~~G  121 (216)
T PRK09483         83 VHTENPLPAKVMQAGAAGYLSKGAAPQEVVSAIRSVHSG  121 (216)
T ss_pred             CCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHCC
T ss_conf             566328899999748878994799999999999999859