HHsearch alignment for GI: 254780312 and conserved domain: pfam00563

>pfam00563 EAL EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues. The EAL domain is a good candidate for a diguanylate phosphodiesterase function. The domain contains many conserved acidic residues that could participate in metal binding and might form the phosphodiesterase active site.
Probab=92.27  E-value=0.77  Score=26.04  Aligned_cols=93  Identities=17%  Similarity=0.150  Sum_probs=67.6

Q ss_pred             CHHHHHHHHHHHHHCCCEEEE--ECCHHHHHHHHHHCCCCEEEEEEECC----CCCHHHHHHHHHHHCCCC-CEEEEECC
Q ss_conf             989999999999988989999--99979999999718998999983655----999799999999858998-59999437
Q gi|254780312|r   11 DDDMRRFLIKALGKAGYEVVS--CNNGASAYDKVREEPFSLLLTDIVMP----EMDGIELARRATELDPDL-KVMFITGF   83 (122)
Q Consensus        11 ~~~~r~~l~~~L~~~G~~v~~--a~~g~~al~~~~~~~~dlii~D~~mP----~~dG~el~~~ir~~~~~~-pii~~s~~   83 (122)
T Consensus       130 ~~~~~~~i~-~lk~~G~~iaiDdfG~~~~~~~~l~~l~~d~iKid~~~~~~~~~~~~~~~~~~l~~~a~~~~~~viaeGV  208 (233)
T pfam00563       130 DLRLLEALA-RLRSLGFRLALDDFGTGYSSLSYLSRLPPDYIKIDRSFIKDLSDPESRALLRALIALARELGIKVVAEGV  208 (233)
T ss_pred             CHHHHHHHH-HHHHCCCCEEECCCCCCCCCHHHHHHCCCCEEEECHHHHHHCCCCCHHHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             199999999-9997799589617899976778997488878999899984077721899999999999987998999708


Q ss_pred             CCHHHHHHHHHCCCCE----EEECC
Q ss_conf             9789999999769986----99769
Q gi|254780312|r   84 AAVALNPDSNAPKNAK----VLSKP  104 (122)
Q Consensus        84 ~~~~~~~~~~~~g~~~----~l~KP  104 (122)
T Consensus       209 E~~~~~~~l~~~Gv~~~QG~~~~~P  233 (233)
T pfam00563       209 ETEEQLELLKELGIDYVQGYLFSKP  233 (233)
T ss_pred             CCHHHHHHHHHCCCCEEECCCCCCC
T ss_conf             6399999999759998316810279