HHsearch alignment for GI: 254780314 and conserved domain: PRK09980

>PRK09980 ompL outer membrane porin L; Provisional.
Probab=93.57  E-value=0.21  Score=28.68  Aligned_cols=52  Identities=19%  Similarity=0.353  Sum_probs=28.8

Q ss_pred             EEECEEEEECCCEEEECCCC----CCC-CCEEEEEEEEEEEEECCCEEEEEEEECCC
Q ss_conf             63110478604525404567----678-52277877888885159127789873274
Q gi|254780314|r  278 FDVAKSITISGGGQYFGDIN----KTG-KDGWSAGISAKYMISSGLEAQASVAFNDN  329 (351)
Q Consensus       278 ikaTDKl~ITPG~QY~gd~~----~sg-~DaWk~GlTvDYqItegL~tK~SVqY~D~  329 (351)
T Consensus       154 y~~~~~~~~~~~~tY~~~vnd~~~~NgKk~~~E~n~~~~Yk~~~~w~PY~E~~~ld~  210 (230)
T PRK09980        154 FIITDKFSYTFEPHYFYNVNDFNSSNGTKHHWEITNTFRYRINEHWLPYFELRWLDR  210 (230)
T ss_pred             EEECCCEEEEEEEEEEEECCCCEECCCCCHHHHEEEEEEEECCCCCCCEEEEEECCC
T ss_conf             897574379973099985077073278640443102688842896243189874223