HHsearch alignment of GI: 254780314 and MMDB domain: 2por_A_

>2por_A (A:) Porin; HET: C8E; 1.80A {Rhodobacter capsulatus}
Probab=95.28  E-value=0.21  Score=28.23  Aligned_cols=157  Identities=18%  Similarity=0.162  Sum_probs=100.3

Q ss_pred             EEEEEECCCEEEEEEHHHCCCCCCC--CEEEEEEEEEEEECCEEEEEEEEEECCCC------CCEEEEEEEECCCCCCEE
Q ss_conf             6899825754510330321466665--40347889634541268999852211466------512798886136788202
Q gi|254780314|r  180 LSYRHSFGLLKAGLSTDLLQKDGLK--QVLGIGYMASYAIGKIRSTVTGGYDAGTN------NVAIRANISSPVSRAGTL  251 (351)
Q Consensus       180 irYqYe~G~F~AGiSvDeLE~dg~~--n~VGV~g~vsg~aGavS~qltGGyDtd~e------eGAIRAl~ta~iG~PGTl  251 (351)
                      +-|..+++.|+.+++.-.-++++..  +.-+.+..+.+..+++.......+.....      .-+.+....-.++   -+
T Consensus       119 ~~~s~~~~g~~~~a~y~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~~~---~~  195 (301)
T 2por_A          119 LLYTYSAGAFSVAASMSDGKVGETSEDDAQEMAVAAAYTFGNYTVGLGYEKIDSPDTALMADMEQLELAAIAKFG---AT  195 (301)
T ss_dssp             EEEEEEETTEEEEEEECCSBSTTSSCBCCEEEEEEEEEEETTEEEEEEEEEEECSCTTTSCCEEEEEEEEEEEET---TE
T ss_pred             EEECCCCCCEEEEEEEEEECCCCCCCCCCCCEEEEEEEECCCCEEEEEEEECCCCCCCCCCCCCEEEEEEEEECC---CE
T ss_conf             996243376589999987216786431132104656761576202442131111101245665226788887114---28


Q ss_pred             EEEEEEECCC------------------CCCCCCCCEEEEEEEEEEECEEEEECCCEEEECCCCCCCCCEEEEEEEEEEE
Q ss_conf             4678873386------------------4000112113664355631104786045254045676785227787788888
Q gi|254780314|r  252 DCGAVWASGD------------------NSYYDKSKYSVFAGYKFDVAKSITISGGGQYFGDINKTGKDGWSAGISAKYM  313 (351)
Q Consensus       252 glAgVwASgp------------------NaYY~~SEWaVAAeYaikaTDKl~ITPG~QY~gd~~~sg~DaWk~GlTvDYq  313 (351)
                      .+++.|....                  ..+.....|.+-+.|.+....     +...|...-+....+.+...+.++|+
T Consensus       196 ~l~a~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Y~~~~~~-----~~~~~~~~~~~~~~~~~~~~~g~~Y~  270 (301)
T 2por_A          196 NVKAYYADGELDRDFARAVFDLTPVAAAATAVDHKAYGLSVDSTFGATT-----VGGYVQVLDIDTIDDVTYYGLGASYD  270 (301)
T ss_dssp             EEEEEEEEEEEEHHHHHHHTTCCCCSSCCCEEEEEEEEEEEEEEETTEE-----EEEEEEEEEETTTEEEEEEEEEEEEE
T ss_pred             EEEEEEEEEEECCCCCCCEEEEEECCCCCCCCCEEEEEEEEEEECCCEE-----EEEEEEEECCCCCCCEEEEEEEEEEE
T ss_conf             9999999863123322210001101355565201457888999816568-----99999985268888626999999998


Q ss_pred             EECCCEEEEEEEECCCCCCCCCCCCCCCCCCCCHHCCC
Q ss_conf             51591277898732742113542346631001101139
Q gi|254780314|r  314 ISSGLEAQASVAFNDNFVKKGVAIDKGVDLSVGLKKSF  351 (351)
Q Consensus       314 ItegL~tK~SVqY~D~~~~~~~~~d~g~d~t~gl~~sf  351 (351)
                      +...+..-+..+|.+.       -++.+...+|++--|
T Consensus       271 lsk~~~~y~~~~~~~~-------~~~~~~~~vG~r~~F  301 (301)
T 2por_A          271 LGGGASIVGGIADNDL-------PNSDMVADLGVKFKF  301 (301)
T ss_dssp             EETTEEEEEEEEEECS-------SSCCCEEEEEEEEEC
T ss_pred             CCCCEEEEEEEEEEEC-------CCCCEEEEEEEEEEC
T ss_conf             8999799999999966-------899737999869989