RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780314|ref|YP_003064727.1| outer membrane protein [Candidatus Liberibacter asiaticus str. psy62] (351 letters) >gnl|CDD|145590 pfam02530, Porin_2, Porin subfamily. This family consists of porins from the alpha subdivision of Proteobacteria the members of this family are related to pfam00267. The porins form large aqueous channels in the cell membrane allowing the selective entry of hydrophilic compounds this so called 'molecular sieve' is found in the cell walls of gram negative bacteria. Length = 378 Score = 50.2 bits (120), Expect = 8e-07 Identities = 38/157 (24%), Positives = 54/157 (34%), Gaps = 9/157 (5%) Query: 192 GLSTDLLQKDGLKQVLGIGYMASYAIGKIRSTVTGGYDAGTNNVAIRANISSPVSRAGTL 251 L + G YD+ A+RA +S TL Sbjct: 206 DLGAYGANSYIGSYTPDVVGGVKVDQGWGAFQGVVAYDSDKEEGAVRARLSVKAGDGDTL 265 Query: 252 DCGAVWASGDNSYYDKSKY-------SVFAGYKFDVAKSITISGGGQYFGDINKTGKD-- 302 + +ASG N Y S+Y +V+AGY + I+ G Q+ G N D Sbjct: 266 NIAGGYASGANRYTGDSEYHNWGGNWAVWAGYTYKATDKTAITPGAQWGGAGNVCNPDFD 325 Query: 303 GWSAGISAKYMISSGLEAQASVAFNDNFVKKGVAIDK 339 GW+ G + Y I L A V + D K + K Sbjct: 326 GWAVGANVDYTIVDNLTFTAEVRYTDLGQKYFGSDAK 362 >gnl|CDD|58574 cd04273, ZnMc_ADAMTS_like, Zinc-dependent metalloprotease, ADAMTS_like subgroup. ADAMs (A Disintegrin And Metalloprotease) are glycoproteins, which play roles in cell signaling, cell fusion, and cell-cell interactions. This particular subfamily represents domain architectures that combine ADAM-like metalloproteinases with thrombospondin type-1 repeats. ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) proteinases are inhibited by TIMPs (tissue inhibitors of metalloproteinases), and they play roles in coagulation, angiogenesis, development and progression of arthritis. They hydrolyze the von Willebrand factor precursor and various components of the extracellular matrix.. Length = 207 Score = 30.2 bits (68), Expect = 0.87 Identities = 18/85 (21%), Positives = 36/85 (42%), Gaps = 6/85 (7%) Query: 51 PHITKVGGSLEKSLQA--RY-HKLNGNNEFNSLAYDIPV---KGNLEVNANAGDVTGVAK 104 + G+ +KSL++ R+ KLN N+ + +D + + ++ + D G+A Sbjct: 60 ESGLLISGNAQKSLKSFCRWQKKLNPPNDSDPEHHDHAILLTRQDICRSNGNCDTLGLAP 119 Query: 105 LKLAVDDVLSMQFAESDVRALAFTV 129 + S E + AFT+ Sbjct: 120 VGGMCSPSRSCSINEDTGLSSAFTI 144 >gnl|CDD|34386 COG4773, FhuE, Outer membrane receptor for ferric coprogen and ferric-rhodotorulic acid [Inorganic ion transport and metabolism]. Length = 719 Score = 28.0 bits (62), Expect = 3.6 Identities = 13/58 (22%), Positives = 25/58 (43%), Gaps = 4/58 (6%) Query: 239 ANISSPVSRAGTLDCGAVWASGDNSY----YDKSKYSVFAGYKFDVAKSITISGGGQY 292 A++S P++ GT+ V A D Y+ K+ + + D+ ++ G Y Sbjct: 211 ADVSGPLNSEGTVRGRLVAAYEDKDSFKDRYNSRKHVFYGIAEADLGPDTVLTAGADY 268 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.314 0.131 0.369 Gapped Lambda K H 0.267 0.0595 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,849,565 Number of extensions: 194054 Number of successful extensions: 213 Number of sequences better than 10.0: 1 Number of HSP's gapped: 213 Number of HSP's successfully gapped: 13 Length of query: 351 Length of database: 6,263,737 Length adjustment: 95 Effective length of query: 256 Effective length of database: 4,210,882 Effective search space: 1077985792 Effective search space used: 1077985792 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 58 (26.4 bits)