BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780315|ref|YP_003064728.1| hypothetical protein CLIBASIA_01000 [Candidatus Liberibacter asiaticus str. psy62] (45 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780315|ref|YP_003064728.1| hypothetical protein CLIBASIA_01000 [Candidatus Liberibacter asiaticus str. psy62] Length = 45 Score = 88.2 bits (217), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 45/45 (100%), Positives = 45/45 (100%) Query: 1 MRSIWELSLGGSPCLMFFLLRSFLKDQIVFFKLKFLRFDLYFLGK 45 MRSIWELSLGGSPCLMFFLLRSFLKDQIVFFKLKFLRFDLYFLGK Sbjct: 1 MRSIWELSLGGSPCLMFFLLRSFLKDQIVFFKLKFLRFDLYFLGK 45 >gi|254780229|ref|YP_003064642.1| hypothetical protein CLIBASIA_00570 [Candidatus Liberibacter asiaticus str. psy62] Length = 1775 Score = 21.6 bits (44), Expect = 2.7, Method: Composition-based stats. Identities = 11/20 (55%), Positives = 13/20 (65%) Query: 19 LLRSFLKDQIVFFKLKFLRF 38 LLRS L+DQI FK + F Sbjct: 575 LLRSRLEDQIKAFKDVIVEF 594 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.341 0.156 0.505 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,100 Number of Sequences: 1233 Number of extensions: 673 Number of successful extensions: 3 Number of sequences better than 100.0: 2 Number of HSP's better than 100.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 2 length of query: 45 length of database: 328,796 effective HSP length: 18 effective length of query: 27 effective length of database: 306,602 effective search space: 8278254 effective search space used: 8278254 T: 11 A: 40 X1: 15 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.9 bits) S2: 31 (16.5 bits)