HHsearch results for GI: 254780317 and protein with PDBid: 1nj8_A

>1nj8_A Proline-tRNA synthetase, proline--tRNA ligase; class-II tRNA synthetase; 3.20A {Methanocaldococcus jannaschii} SCOP: c.51.1.1 d.68.5.1 d.104.1.1
Probab=96.09  E-value=0.11  Score=31.84  Aligned_cols=123  Identities=15%  Similarity=0.141  Sum_probs=76.3

Q ss_pred             HHCCCCCCCCCCCCCCCCCCH-----HHHHHHHHHHHHHHCCCEEECCCEEECH-HHHHHHHCCCCCCCCCCCCCEEEEE
Q ss_conf             310000011232122674238-----9999999999998739876237234158-8988861898877331633127750
Q gi|254780317|r   97 QSVDVSLPVFSSPCHRGRIHP-----VTQVIDEVTCIFMDMGFALEEGSDIETD-YYNFAALNFPDDHPARQMHDTFFVP  170 (366)
Q Consensus        97 E~iDVTLP~~~~~~~~G~~HP-----Itqvi~eI~~IF~~lGF~v~eGPEIEtd-~~NFdaLNiP~~HPARdmqDTFyl~  170 (366)
                      +-+|..-|+.|-+    -.+|     ...+.+-+++.|.+.||+.+.-|-++.. .|.=.+     +|=.-=.-+-|.+.
T Consensus        19 ~l~~~~~~vkG~~----~~lP~G~~i~~~ie~~~r~~~~~~G~~ei~tP~l~~~~l~~k~~-----~h~d~f~~Em~~v~   89 (459)
T 1nj8_A           19 EIYDVRYPIKGCG----VYLPYGFKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEA-----EHIKGFEDEVYWVT   89 (459)
T ss_dssp             SSCBCCSTTSSCC----BBCHHHHHHHHHHHHHHHHHHHHTTCEECBCCSEEEHHHHHHHC-----SSSGGGGGGCEEEE
T ss_pred             CCCCCCCCCCCCE----EECCCHHHHHHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHC-----CCCCCCCCCCEEEE
T ss_conf             9810589999717----88845999999999999999998599899898537889998741-----67241374637883


Q ss_pred             CCC---CCCCCCCCCCCCCHHHHHHHH-----CCCEEEEEECCCCCCCCC-CCC---CCCCCCCCCEEEE
Q ss_conf             566---655632244676305555430-----363122541057647454-421---3781002005786
Q gi|254780317|r  171 GIA---GGKHKLLRTHTSPVQIRVMES-----QDLPIKVIVPGKTYRRDS-DST---HSPMFHQIEGLVV  228 (366)
Q Consensus       171 ~~~---~~~~~lLRthTS~vQiR~m~~-----~~pP~~~~~~GrvyR~d~-D~t---H~~~FhQ~egl~v  228 (366)
                      ...   .++...||.-..+.-++...+     +++|+|+.-.|.|||+|. -..   ...+|||+.-.++
T Consensus        90 ~~g~~~~~~~~~LrPt~e~~~~~~~~~~~~s~rdLPlrl~q~g~~fR~E~~~~~~~lR~rEF~q~~~~h~  159 (459)
T 1nj8_A           90 HGGKTQLDVKLALRPTSETPIYYMMKLWVKVHTDLPIKIYQIVNTFRYETKHTRPLIRLREIMTFKEAHT  159 (459)
T ss_dssp             ESSSSEEEEEEEECSSSHHHHHHHHHTTCCBTTSCCCCEEEEECCBCCCCSCCBTTTBCSBCSCEEEEEE
T ss_pred             CCCCCCCCCCEEECCCCCHHHHHHHHHHHHCCCCCCEEEEECCCEECCCCCCCCCCEEEEEEEEECEEEE
T ss_conf             2786555762311179968999999865132255671898504125553323566769999975123677