RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780318|ref|YP_003064731.1| ribosomal protein L20 [Candidatus Liberibacter asiaticus str. psy62] (123 letters) >gnl|CDD|144155 pfam00453, Ribosomal_L20, Ribosomal protein L20. Length = 107 Score = 156 bits (397), Expect = 2e-39 Identities = 64/107 (59%), Positives = 78/107 (72%) Query: 3 RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62 RVKRGVV+ + KK+LK AKGF G R R AK V ++ QYAYRDR+ KKRDFR LWI Sbjct: 1 RVKRGVVARKRRKKILKLAKGFRGARSKLFRTAKQQVMKALQYAYRDRKKKKRDFRRLWI 60 Query: 63 QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKI 109 RINAA R + L+YS+FINGL KA I L+RKVL+ LAI ++FK + Sbjct: 61 TRINAAAREHGLSYSRFINGLKKANIELNRKVLAQLAINDPEAFKAL 107 >gnl|CDD|30640 COG0292, RplT, Ribosomal protein L20 [Translation, ribosomal structure and biogenesis]. Length = 118 Score = 145 bits (368), Expect = 3e-36 Identities = 70/117 (59%), Positives = 86/117 (73%) Query: 1 MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60 M RVKRGVV+ A+ KK+LK AKG+ G R R AK AV ++ QYAYRDRR +KRDFR L Sbjct: 1 MARVKRGVVARARRKKILKLAKGYRGARSRLYRVAKQAVMKALQYAYRDRRQRKRDFRKL 60 Query: 61 WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117 WI RINAA R L+YS+FINGL KAGI +DRKVL+DLAI +F +VE +++ L Sbjct: 61 WIARINAAARENGLSYSRFINGLKKAGIEIDRKVLADLAINDPAAFAALVEKAKAAL 117 >gnl|CDD|177008 CHL00068, rpl20, ribosomal protein L20. Length = 115 Score = 113 bits (286), Expect = 1e-26 Identities = 51/111 (45%), Positives = 71/111 (63%) Query: 1 MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60 MTRVKRG ++ + KK+LK A GF G R A ++ +YRDR+ KKRDFR L Sbjct: 1 MTRVKRGYIARKRRKKILKFASGFRGAHSRLFRTANQQKMKALVSSYRDRKKKKRDFRRL 60 Query: 61 WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111 WI RINAA+R ++YS+FI+ L+K I+L+RK+L+ +AI + F I Sbjct: 61 WITRINAAIRENGVSYSKFIHNLYKNQILLNRKILAQIAILDPNCFYTISN 111 >gnl|CDD|39905 KOG4707, KOG4707, KOG4707, Mitochondrial/chloroplast ribosomal protein L20 [Translation, ribosomal structure and biogenesis]. Length = 147 Score = 98.1 bits (244), Expect = 6e-22 Identities = 49/116 (42%), Positives = 71/116 (61%) Query: 1 MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60 + RG + +++ K A F GR++ R A V R+ YA +DR +KKRD R+L Sbjct: 8 LWLRNRGPDRYMRRQELFKFAAHFRGRKRRCYRLAVRTVIRALVYATKDRYLKKRDMRTL 67 Query: 61 WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116 WI+R+NA + + YS F +GLHK+ I+L+RKVLS LAI + SF +V LS+ R Sbjct: 68 WIERVNAGAAEHGVRYSPFKHGLHKSPILLNRKVLSQLAIVEPRSFCALVVLSKER 123 >gnl|CDD|34372 COG4758, COG4758, Predicted membrane protein [Function unknown]. Length = 235 Score = 27.1 bits (60), Expect = 1.3 Identities = 15/72 (20%), Positives = 21/72 (29%), Gaps = 11/72 (15%) Query: 24 FYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDLNYSQFINGL 83 R + K + V DFR+ W VY + NG+ Sbjct: 94 IKKREPQLVNLKKEPSE-----------VNNTDFRNQWFGNQRYYYDVYQWDDINIQNGI 142 Query: 84 HKAGIVLDRKVL 95 I L + VL Sbjct: 143 GDDIIDLTKAVL 154 >gnl|CDD|39080 KOG3877, KOG3877, KOG3877, NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit [Energy production and conversion]. Length = 393 Score = 25.8 bits (56), Expect = 2.9 Identities = 10/34 (29%), Positives = 18/34 (52%), Gaps = 5/34 (14%) Query: 70 RVYDLNYSQFINGLHK-----AGIVLDRKVLSDL 98 R+Y+ + Q+++ L G+VL+R SD Sbjct: 151 RIYNCRFDQYLDALAHILNTGQGVVLERSPHSDF 184 >gnl|CDD|36160 KOG0942, KOG0942, KOG0942, E3 ubiquitin protein ligase [Posttranslational modification, protein turnover, chaperones]. Length = 1001 Score = 25.3 bits (55), Expect = 4.1 Identities = 14/58 (24%), Positives = 25/58 (43%), Gaps = 3/58 (5%) Query: 7 GVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYA--YRDRRVKKRDFRSLWI 62 G S + +L+ A +R+ + K AV + Q + +R R +K FR + Sbjct: 1 GASSLNERDNLLRRAAEERHKREEERKQEKNAV-KVQSFWRGFRVRHNQKLLFREEFD 57 >gnl|CDD|146277 pfam03552, Cellulose_synt, Cellulose synthase. Cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues, is the major component of wood and thus paper, and is synthesized by plants, most algae, some bacteria and fungi, and even some animals. The genes that synthesize cellulose in higher plants differ greatly from the well-characterized genes found in Acetobacter and Agrobacterium sp. More correctly designated as 'cellulose synthase catalytic subunits', plant cellulose synthase (CesA) proteins are integral membrane proteins, approximately 1,000 amino acids in length. There are a number of highly conserved residues, including several motifs shown to be necessary for processive glycosyltransferase activity. Length = 716 Score = 24.7 bits (54), Expect = 7.4 Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 40 DRSQQYAYRDRRVKKRDFRSLWIQRINAAV 69 D+ Q ++RR KR++ + RINA V Sbjct: 89 DKVQPDFVKERRAMKREYEEFKV-RINALV 117 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.323 0.134 0.366 Gapped Lambda K H 0.267 0.0671 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,335,184 Number of extensions: 62656 Number of successful extensions: 220 Number of sequences better than 10.0: 1 Number of HSP's gapped: 219 Number of HSP's successfully gapped: 20 Length of query: 123 Length of database: 6,263,737 Length adjustment: 82 Effective length of query: 41 Effective length of database: 4,491,799 Effective search space: 184163759 Effective search space used: 184163759 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (23.5 bits)