RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780318|ref|YP_003064731.1| ribosomal protein L20 [Candidatus Liberibacter asiaticus str. psy62] (123 letters) >gnl|CDD|179959 PRK05185, rplT, 50S ribosomal protein L20; Provisional. Length = 114 Score = 177 bits (451), Expect = 8e-46 Identities = 68/113 (60%), Positives = 84/113 (74%) Query: 3 RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62 RVKRGVV+ A+ KK+LK AKG+ G R R AK AV ++ QYAYRDRR KKRDFR LWI Sbjct: 2 RVKRGVVARARRKKILKLAKGYRGARSRLYRVAKQAVMKALQYAYRDRRQKKRDFRKLWI 61 Query: 63 QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115 RINAA R L+YS+FINGL KAGI +DRKVL+DLA+ +F +VE +++ Sbjct: 62 ARINAAARQNGLSYSRFINGLKKAGIEIDRKVLADLAVNDPAAFAALVEKAKA 114 >gnl|CDD|130104 TIGR01032, rplT_bact, ribosomal protein L20. This protein binds directly to 23s ribosomal RNA and is necessary for the in vitro assembly process of the 50s ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit. GO process changed accordingly. Length = 113 Score = 134 bits (339), Expect = 6e-33 Identities = 66/113 (58%), Positives = 83/113 (73%) Query: 2 TRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLW 61 RVK GVV+ + KK+LK AKGF G RK R AK V ++ YAYRDRR +KRDFRSLW Sbjct: 1 MRVKGGVVARRRRKKILKQAKGFRGTRKRHYRVAKQTVIKAMAYAYRDRRQRKRDFRSLW 60 Query: 62 IQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114 I RINAA R + L+YS+FINGL KA I ++RKVLS+LAI ++F +IVE ++ Sbjct: 61 ITRINAAARQHGLSYSRFINGLKKANIEINRKVLSELAINDPEAFAEIVEQAK 113 >gnl|CDD|185406 PTZ00030, PTZ00030, 60S ribosomal protein L20; Provisional. Length = 121 Score = 108 bits (273), Expect = 3e-25 Identities = 50/103 (48%), Positives = 71/103 (68%) Query: 15 KKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDL 74 KV K AKGF GR KN + A+ V ++ Y+Y RR +KR R WIQ INAA R +++ Sbjct: 6 DKVFKLAKGFRGRSKNCFKLARNRVMKALLYSYISRRKRKRILRVHWIQTINAATREHNM 65 Query: 75 NYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117 YS+FINGL+ + I L+RK+L++LAIT+ SFK +V+ S+ +L Sbjct: 66 TYSRFINGLNNSNIQLNRKILANLAITEPFSFKALVDESKYQL 108 >gnl|CDD|173003 PRK14537, PRK14537, 50S ribosomal protein L20/unknown domain fusion protein; Provisional. Length = 230 Score = 99.7 bits (248), Expect = 2e-22 Identities = 51/105 (48%), Positives = 70/105 (66%) Query: 13 KHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVY 72 + KKVLK AKG++G + + A V RS QYAYRDR+ +KRDFR LWI RINA + Sbjct: 13 RRKKVLKMAKGYFGSKSTLYKTAHEQVMRSLQYAYRDRKQRKRDFRKLWISRINAGAMLC 72 Query: 73 DLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117 + YS+ ++GL A + ++RKVLSDLA Q + F + VEL++ L Sbjct: 73 GIKYSRLMHGLALAKVDINRKVLSDLAHLQPEVFVQYVELAKKFL 117 >gnl|CDD|147905 pfam05997, Nop52, Nucleolar protein,Nop52. Nop52 believed to be involved in the generation of 28S rRNA. Length = 212 Score = 26.1 bits (58), Expect = 2.2 Identities = 21/84 (25%), Positives = 38/84 (45%), Gaps = 13/84 (15%) Query: 50 RRVKKRDFRSLWIQRINAAVRVYDLNYSQFINGL--HKAGIVLD--RKVLSDLAITQLDS 105 R +K+ + ++ +N + LN NGL H I LD KVL + ++ + Sbjct: 119 RLLKENKWDLDLVEELNEILLEKILNPEDDPNGLKYHFIDIFLDELAKVLEGESEDEVSA 178 Query: 106 ---------FKKIVELSRSRLLVD 120 F KI++ ++ ++LVD Sbjct: 179 VQVLLLLEPFLKILKKTKDKVLVD 202 >gnl|CDD|162876 TIGR02478, 6PF1K_euk, 6-phosphofructokinase, eukaryotic type. Members of this family are eukaryotic (with one exception) ATP-dependent 6-phosphofructokinases (EC 2.7.1.11) in which two tandem copies of the phosphofructokinase are found. Members are found, often including several isozymes, in animals and fungi and in the bacterium Propionibacterium acnes KPA171202 (a human skin commensal). Length = 745 Score = 25.8 bits (57), Expect = 3.1 Identities = 13/53 (24%), Positives = 25/53 (47%), Gaps = 6/53 (11%) Query: 26 GRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDLNYSQ 78 G+RKN + A+ A+DR + D + + ++R+ R+ L + Q Sbjct: 239 GKRKNIVIVAEGAIDRDLN------PITSEDVKDVLVERLGLDTRITVLGHVQ 285 >gnl|CDD|184717 PRK14508, PRK14508, 4-alpha-glucanotransferase; Provisional. Length = 497 Score = 25.5 bits (57), Expect = 3.6 Identities = 8/28 (28%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Query: 47 YRDRRVKKRDFRSLWIQRINAAVRVYDL 74 Y ++K +R WI+R+ + ++YD+ Sbjct: 267 YNWDALRKDGYRW-WIERLRRSFKLYDI 293 >gnl|CDD|135648 PRK05898, dnaE, DNA polymerase III DnaE; Validated. Length = 971 Score = 25.6 bits (56), Expect = 3.6 Identities = 9/22 (40%), Positives = 14/22 (63%) Query: 82 GLHKAGIVLDRKVLSDLAITQL 103 G H AG+VL +L+++ QL Sbjct: 439 GTHAAGVVLSNSLLTNIIPIQL 460 >gnl|CDD|130711 TIGR01650, PD_CobS, cobaltochelatase, CobS subunit. This model describes the aerobic cobalamin pathway Pseudomonas denitrificans CobS gene product, which is a cobalt chelatase subunit, with a MW ~37 kDa. The aerobic pathway cobalt chelatase is a heterotrimeric, ATP-dependent enzyme that catalyzes cobalt insertion during cobalamin biosynthesis. The other two subunits are the P. denitrificans CobT (TIGR01651) and CobN (pfam02514 CobN/Magnesium Chelatase) proteins. To avoid potential confusion with the nonhomologous Salmonella typhimurium/E.coli cobS gene product, the P. denitrificans gene symbol is not used in the name of this model. Length = 327 Score = 25.4 bits (55), Expect = 4.0 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 53 KKRDFRSLWIQR-INAAVRVYDLNYSQFING 82 K + F + INA VRV D+ + FING Sbjct: 232 KAKGFDDTEGKDIINAMVRVADMTRNAFING 262 >gnl|CDD|163467 TIGR03755, conj_TIGR03755, integrating conjugative element protein, PFL_4711 family. Members of this protein family are found in genomic regions associated with conjugative transfer and integrated TOL-like plasmids. The specific function is unknown. Length = 418 Score = 25.4 bits (56), Expect = 4.2 Identities = 11/35 (31%), Positives = 17/35 (48%), Gaps = 6/35 (17%) Query: 62 IQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLS 96 IQR N + Y+L NG+ +A + DR + Sbjct: 82 IQRANPGL--YNL----LTNGVLQARLDFDRSKKT 110 >gnl|CDD|182098 PRK09828, PRK09828, putative fimbrial outer membrane usher protein; Provisional. Length = 865 Score = 25.1 bits (55), Expect = 4.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Query: 59 SLWIQRINAAVRVYDLN 75 SLW INAA+ Y+LN Sbjct: 168 SLWENGINAAMLSYNLN 184 >gnl|CDD|161866 TIGR00413, rlpA, rare lipoprotein A. This is a family of prokaryotic proteins with unknown function. Lipoprotein annotation based on the presence of consensus lipoprotein signal sequence. Included in this family is the E. coli putative lipoprotein rlpA. Length = 208 Score = 24.6 bits (53), Expect = 6.5 Identities = 15/76 (19%), Positives = 24/76 (31%) Query: 5 KRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQR 64 K+ AK + VL+S F +K+ Q R R + L + Sbjct: 109 KQAKKQEAKDRLVLESNTLFDNTKKSINALKGTEFFCLQMGELRSRSQANKLITQLALAN 168 Query: 65 INAAVRVYDLNYSQFI 80 + V Y +I Sbjct: 169 LQTEVNRSGPKYEVYI 184 >gnl|CDD|162706 TIGR02104, pulA_typeI, pullulanase, type I. Pullulan is an unusual, industrially important polysaccharide in which short alpha-1,4 chains (maltotriose) are connected in alpha-1,6 linkages. Enzymes that cleave alpha-1,6 linkages in pullulan and release maltotriose are called pullulanases although pullulan itself may not be the natural substrate. This family consists of pullulanases related to the subfamilies described in TIGR02102 and TIGR02103 but having a different domain architecture with shorter sequences. Members are called type I pullulanases. Length = 605 Score = 24.6 bits (54), Expect = 7.3 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 5/48 (10%) Query: 65 INAAVRVYDLNYSQFINGLHKAGI--VLDRKVLSDLAITQLDSFKKIV 110 + A R+ +L Q I LH+ GI ++D V + + F+K V Sbjct: 222 YDPATRIRELK--QMIQALHENGIRVIMD-VVYNHTYSREESPFEKTV 266 >gnl|CDD|177661 PLN00023, PLN00023, GTP-binding protein; Provisional. Length = 334 Score = 24.4 bits (53), Expect = 8.4 Identities = 9/20 (45%), Positives = 14/20 (70%) Query: 55 RDFRSLWIQRINAAVRVYDL 74 +D RSL+ +IN + V+DL Sbjct: 97 KDCRSLFYSQINGVIFVHDL 116 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.323 0.134 0.366 Gapped Lambda K H 0.267 0.0727 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,918,929 Number of extensions: 111436 Number of successful extensions: 308 Number of sequences better than 10.0: 1 Number of HSP's gapped: 308 Number of HSP's successfully gapped: 33 Length of query: 123 Length of database: 5,994,473 Length adjustment: 82 Effective length of query: 41 Effective length of database: 4,222,617 Effective search space: 173127297 Effective search space used: 173127297 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (23.4 bits)