BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780318|ref|YP_003064731.1| ribosomal protein L20 [Candidatus Liberibacter asiaticus str. psy62] (123 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780318|ref|YP_003064731.1| ribosomal protein L20 [Candidatus Liberibacter asiaticus str. psy62] Length = 123 Score = 241 bits (615), Expect = 3e-66, Method: Compositional matrix adjust. Identities = 123/123 (100%), Positives = 123/123 (100%) Query: 1 MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60 MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL Sbjct: 1 MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60 Query: 61 WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120 WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD Sbjct: 61 WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120 Query: 121 VAS 123 VAS Sbjct: 121 VAS 123 >gi|254781074|ref|YP_003065487.1| uracil-DNA glycosylase [Candidatus Liberibacter asiaticus str. psy62] Length = 227 Score = 23.9 bits (50), Expect = 0.89, Method: Compositional matrix adjust. Identities = 10/24 (41%), Positives = 14/24 (58%) Query: 5 KRGVVSSAKHKKVLKSAKGFYGRR 28 KR +V A H L ++ GF+G R Sbjct: 180 KRHLVLKAAHPSPLSASHGFFGCR 203 >gi|254780775|ref|YP_003065188.1| undecaprenyl diphosphate synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 243 Score = 21.2 bits (43), Expect = 6.8, Method: Compositional matrix adjust. Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Query: 5 KRGVVSSAKHKKVLKS--AKGFYGRRKNTIR 33 +R V ++ K++KS KGFY +KN I+ Sbjct: 69 RRPVSEISELVKLIKSFLKKGFYSLKKNNIK 99 >gi|254780859|ref|YP_003065272.1| NADH dehydrogenase subunit G [Candidatus Liberibacter asiaticus str. psy62] Length = 700 Score = 20.4 bits (41), Expect = 9.4, Method: Composition-based stats. Identities = 10/27 (37%), Positives = 16/27 (59%) Query: 93 KVLSDLAITQLDSFKKIVELSRSRLLV 119 + L+DL Q FKK+ E +R ++V Sbjct: 429 EALADLVSGQHPFFKKLQEATRPLIIV 455 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.323 0.134 0.366 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,947 Number of Sequences: 1233 Number of extensions: 2157 Number of successful extensions: 11 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 7 length of query: 123 length of database: 328,796 effective HSP length: 64 effective length of query: 59 effective length of database: 249,884 effective search space: 14743156 effective search space used: 14743156 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 33 (17.3 bits)