RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780319|ref|YP_003064732.1| 50S ribosomal protein L35 [Candidatus Liberibacter asiaticus str. psy62] (67 letters) >gnl|CDD|178913 PRK00172, rpmI, 50S ribosomal protein L35; Reviewed. Length = 65 Score = 72.5 bits (179), Expect = 3e-14 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 1/66 (1%) Query: 1 MPKMKTNSSSKKRFSITATGKVRAQAAGKRHGMIKRSNKFIRNARGTMVLASADAKKVIR 60 MPKMKT S + KRF +T +GKV+ + AGKRH + K+S K R RGT V++ ADAK+V R Sbjct: 1 MPKMKTKSGAAKRFKVTGSGKVKRKHAGKRHILTKKSTKRKRQLRGTTVVSKADAKRVKR 60 Query: 61 NYLPNG 66 LP Sbjct: 61 -MLPYA 65 >gnl|CDD|129113 TIGR00001, rpmI_bact, ribosomal protein L35. This ribosomal protein is found in bacteria and organelles only. It is not closely related to any eukaryotic or archaeal ribosomal protein. Length = 63 Score = 54.6 bits (132), Expect = 5e-09 Identities = 26/59 (44%), Positives = 41/59 (69%) Query: 2 PKMKTNSSSKKRFSITATGKVRAQAAGKRHGMIKRSNKFIRNARGTMVLASADAKKVIR 60 PKMKT+ ++ KRF IT +GK++ + AGKRH + K+S+K RN R ++++ D K+V Sbjct: 1 PKMKTHKAAAKRFKITGSGKIKRKKAGKRHLLTKKSSKRKRNLRKKAIVSAGDLKRVKL 59 >gnl|CDD|180226 PRK05731, PRK05731, thiamine monophosphate kinase; Provisional. Length = 318 Score = 26.0 bits (58), Expect = 2.5 Identities = 9/27 (33%), Positives = 11/27 (40%) Query: 6 TNSSSKKRFSITATGKVRAQAAGKRHG 32 T S+TA G V A +R G Sbjct: 122 TTRGPDLSISVTAIGDVPGGRALRRSG 148 >gnl|CDD|181827 PRK09407, gabD2, succinic semialdehyde dehydrogenase; Reviewed. Length = 524 Score = 25.6 bits (57), Expect = 3.2 Identities = 9/14 (64%), Positives = 12/14 (85%) Query: 17 TATGKVRAQAAGKR 30 TATG+V A+ AG+R Sbjct: 241 TATGRVLAEQAGRR 254 >gnl|CDD|180516 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated. Length = 460 Score = 25.5 bits (57), Expect = 3.3 Identities = 8/23 (34%), Positives = 10/23 (43%), Gaps = 2/23 (8%) Query: 13 RFSITATGKVRAQAAGKRHGMIK 35 A G RA+ GK G +K Sbjct: 372 EVPFEAQG--RARVMGKNDGFVK 392 >gnl|CDD|182544 PRK10555, PRK10555, aminoglycoside/multidrug efflux system; Provisional. Length = 1037 Score = 24.4 bits (53), Expect = 6.1 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Query: 21 KVRAQAAGKRHGMIKRSNK-FIRNARGTMVLASADA 55 KV QAA + N ++RN G MV SA A Sbjct: 768 KVYVQAAAPYRMLPDDINLWYVRNKDGGMVPFSAFA 803 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.317 0.127 0.342 Gapped Lambda K H 0.267 0.0741 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 990,020 Number of extensions: 45770 Number of successful extensions: 98 Number of sequences better than 10.0: 1 Number of HSP's gapped: 98 Number of HSP's successfully gapped: 11 Length of query: 67 Length of database: 5,994,473 Length adjustment: 38 Effective length of query: 29 Effective length of database: 5,173,369 Effective search space: 150027701 Effective search space used: 150027701 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.0 bits)