BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780319|ref|YP_003064732.1| 50S ribosomal protein L35 [Candidatus Liberibacter asiaticus str. psy62] (67 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780319|ref|YP_003064732.1| 50S ribosomal protein L35 [Candidatus Liberibacter asiaticus str. psy62] Length = 67 Score = 134 bits (336), Expect = 3e-34, Method: Compositional matrix adjust. Identities = 67/67 (100%), Positives = 67/67 (100%) Query: 1 MPKMKTNSSSKKRFSITATGKVRAQAAGKRHGMIKRSNKFIRNARGTMVLASADAKKVIR 60 MPKMKTNSSSKKRFSITATGKVRAQAAGKRHGMIKRSNKFIRNARGTMVLASADAKKVIR Sbjct: 1 MPKMKTNSSSKKRFSITATGKVRAQAAGKRHGMIKRSNKFIRNARGTMVLASADAKKVIR 60 Query: 61 NYLPNGI 67 NYLPNGI Sbjct: 61 NYLPNGI 67 >gi|254780233|ref|YP_003064646.1| GTP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 624 Score = 24.3 bits (51), Expect = 0.36, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 28/63 (44%), Gaps = 5/63 (7%) Query: 3 KMKTNSSSKKRFSITATGKVRAQAAGKRHGMIKRSNKFIRNARGTMVLASADAKKVIRNY 62 KM + S + TG+VR G+I ++ + + RGT ++ ++ +Y Sbjct: 433 KMTLHKSEMIELRPSGTGRVRLVFLSPTRGLIGYQSQLMTDTRGTAIM-----NRLFHSY 487 Query: 63 LPN 65 P+ Sbjct: 488 QPH 490 >gi|254781094|ref|YP_003065507.1| glycyl-tRNA synthetase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 702 Score = 20.8 bits (42), Expect = 4.3, Method: Composition-based stats. Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 33 MIKRSNKFIRNARGTMVLASA 53 +IK N+F +A+G L SA Sbjct: 573 LIKHLNEFFSSAKGEKFLLSA 593 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.317 0.127 0.342 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,243 Number of Sequences: 1233 Number of extensions: 834 Number of successful extensions: 3 Number of sequences better than 100.0: 3 Number of HSP's better than 100.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 67 length of database: 328,796 effective HSP length: 38 effective length of query: 29 effective length of database: 281,942 effective search space: 8176318 effective search space used: 8176318 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.3 bits) S2: 31 (16.5 bits)