BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780320|ref|YP_003064733.1| translation initiation factor IF-3 [Candidatus Liberibacter asiaticus str. psy62] (136 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780320|ref|YP_003064733.1| translation initiation factor IF-3 [Candidatus Liberibacter asiaticus str. psy62] Length = 136 Score = 274 bits (701), Expect = 4e-76, Method: Compositional matrix adjust. Identities = 136/136 (100%), Positives = 136/136 (100%) Query: 1 MQMAQEANLDLVEIDSSVTPSVCKILDLRKLRYTIQKNAVEARKKQKSTGIKEVKMRPVI 60 MQMAQEANLDLVEIDSSVTPSVCKILDLRKLRYTIQKNAVEARKKQKSTGIKEVKMRPVI Sbjct: 1 MQMAQEANLDLVEIDSSVTPSVCKILDLRKLRYTIQKNAVEARKKQKSTGIKEVKMRPVI 60 Query: 61 DLHDLQVKLKAIDGFLRDGCKVKISVKFRGREIMHQDLGRELLSNIKERFGEISRIDCEP 120 DLHDLQVKLKAIDGFLRDGCKVKISVKFRGREIMHQDLGRELLSNIKERFGEISRIDCEP Sbjct: 61 DLHDLQVKLKAIDGFLRDGCKVKISVKFRGREIMHQDLGRELLSNIKERFGEISRIDCEP 120 Query: 121 KFEGRQMIMILSSKCV 136 KFEGRQMIMILSSKCV Sbjct: 121 KFEGRQMIMILSSKCV 136 >gi|254780891|ref|YP_003065304.1| hypothetical protein CLIBASIA_03940 [Candidatus Liberibacter asiaticus str. psy62] Length = 215 Score = 23.5 bits (49), Expect = 1.5, Method: Compositional matrix adjust. Identities = 11/34 (32%), Positives = 19/34 (55%) Query: 33 YTIQKNAVEARKKQKSTGIKEVKMRPVIDLHDLQ 66 ++++ N AR +K T I + + ID HD+Q Sbjct: 149 FSLKINGNLARFPEKFTQIVDGNVESTIDSHDIQ 182 >gi|254780430|ref|YP_003064843.1| nitrogen fixation protein [Candidatus Liberibacter asiaticus str. psy62] Length = 189 Score = 22.7 bits (47), Expect = 2.4, Method: Compositional matrix adjust. Identities = 15/57 (26%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Query: 1 MQMAQEANLDLVEIDSSVTPSVCKILDLRKLRYTIQKNAVEARKKQKSTGIKEVKMR 57 M++ + D +E DS+V + ++LD R +R + ++ + K GI + MR Sbjct: 100 MKLDDMGSGDFIESDSAVVQRIKEVLDNR-VRPAVARDGGDIVFKGYRDGIVFLSMR 155 >gi|254780445|ref|YP_003064858.1| isoleucyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 963 Score = 21.9 bits (45), Expect = 4.2, Method: Composition-based stats. Identities = 16/64 (25%), Positives = 24/64 (37%) Query: 28 LRKLRYTIQKNAVEARKKQKSTGIKEVKMRPVIDLHDLQVKLKAIDGFLRDGCKVKISVK 87 L+KL YT ++A G V + P + D +A D L +K+ Sbjct: 318 LKKLGYTFSVPLIDAEYVANDCGTGFVHVAPSHGVEDFTAWNEAKDILLNRSVDIKVPSP 377 Query: 88 FRGR 91 GR Sbjct: 378 VDGR 381 >gi|254780368|ref|YP_003064781.1| electron transfer flavoprotein beta subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 249 Score = 21.9 bits (45), Expect = 4.5, Method: Compositional matrix adjust. Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Query: 20 PSVCKI-LDLRKLRYTIQKNAVEARKKQ 46 P+V + L+L + RY N ++ARKK+ Sbjct: 171 PAVITVDLNLNEPRYISLPNIIKARKKR 198 >gi|254780685|ref|YP_003065098.1| flagellar basal body rod protein FlgF [Candidatus Liberibacter asiaticus str. psy62] Length = 243 Score = 21.6 bits (44), Expect = 6.3, Method: Compositional matrix adjust. Identities = 9/41 (21%), Positives = 21/41 (51%) Query: 59 VIDLHDLQVKLKAIDGFLRDGCKVKISVKFRGREIMHQDLG 99 + ++VK + G +++ KIS G+E + +++G Sbjct: 31 TVGFRTIKVKFSEVVGAIKNDIDQKISFVASGKEYLSKEVG 71 >gi|255764511|ref|YP_003065518.2| S-adenosyl-methyltransferase MraW [Candidatus Liberibacter asiaticus str. psy62] Length = 341 Score = 21.2 bits (43), Expect = 6.8, Method: Compositional matrix adjust. Identities = 11/37 (29%), Positives = 19/37 (51%) Query: 74 GFLRDGCKVKISVKFRGREIMHQDLGRELLSNIKERF 110 G+ R CK+ +V R+ G+E + + KE+F Sbjct: 49 GYSRSFCKMGSNVIALDRDPFAVSCGQETMRDYKEQF 85 >gi|254780779|ref|YP_003065192.1| 30S ribosomal protein S2 [Candidatus Liberibacter asiaticus str. psy62] Length = 278 Score = 21.2 bits (43), Expect = 7.3, Method: Compositional matrix adjust. Identities = 11/36 (30%), Positives = 15/36 (41%) Query: 67 VKLKAIDGFLRDGCKVKISVKFRGREIMHQDLGREL 102 V AIDG R + K G ++H G +L Sbjct: 218 VASAAIDGIARQHSYMGADTKSAGETVVHSKEGMQL 253 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.322 0.138 0.382 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,032 Number of Sequences: 1233 Number of extensions: 2726 Number of successful extensions: 14 Number of sequences better than 100.0: 11 Number of HSP's better than 100.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 12 length of query: 136 length of database: 328,796 effective HSP length: 65 effective length of query: 71 effective length of database: 248,651 effective search space: 17654221 effective search space used: 17654221 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 34 (17.7 bits)