HHsearch alignment for GI: 254780321 and conserved domain: COG1160

>COG1160 Predicted GTPases [General function prediction only].
Probab=99.66  E-value=3.2e-15  Score=121.67  Aligned_cols=155  Identities=26%  Similarity=0.304  Sum_probs=114.2

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHH
Q ss_conf             17999801389877889999998298054444311305867798719505232799997437884389999617873002
Q gi|254780321|r   12 RNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDF   91 (606)
Q Consensus        12 RN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF   91 (606)
T Consensus         4 ~~VAIVGRPNVGKSTLFNRL~---g~---r~A--IV~D~p------GvTR-----Dr~y~~~~~~~~~f~lIDTgGl~~~   64 (444)
T COG1160           4 PVVAIVGRPNVGKSTLFNRLT---GR---RIA--IVSDTP------GVTR-----DRIYGDAEWLGREFILIDTGGLDDG   64 (444)
T ss_pred             CEEEEECCCCCCHHHHHHHHH---CC---EEE--EEECCC------CCCC-----CCCCCEEEECCCEEEEEECCCCCCC
T ss_conf             789998999875899998875---77---026--760699------9755-----7754506983860799978997768


Q ss_pred             H-----H----HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             7-----9----999999730268999986878865589999999970996799832678875321133888775553223
Q gi|254780321|r   92 T-----Y----EVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGIST  162 (606)
Q Consensus        92 ~-----~----EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~  162 (606)
T Consensus        65 ~~~~l~~~i~~Qa~~Ai~eADvilfvVD~~~Git~~D~~ia~~Lr~~~kpviLvvNK~D~~~-----~e~~~~efyslG~  139 (444)
T COG1160          65 DEDELQELIREQALIAIEEADVILFVVDGREGITPADEEIAKILRRSKKPVILVVNKIDNLK-----AEELAYEFYSLGF  139 (444)
T ss_pred             CCHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCH-----HHHHHHHHHHCCC
T ss_conf             81289999999999999767999999848878997899999999853998899997666730-----4564899986478


Q ss_pred             HHHHHHHHHCCCCCCHHHHHHHHHHHCCC
Q ss_conf             21000111002232006787763210001
Q gi|254780321|r  163 EDALLVSAKTGEGIPLLLERIVQQLPSPT  191 (606)
Q Consensus       163 ~~ii~vSAktG~GV~~LLd~Iv~~iP~P~  191 (606)
T Consensus       140 g~~~~ISA~Hg~Gi~dLld~v~~~l~-~~  167 (444)
T COG1160         140 GEPVPISAEHGRGIGDLLDAVLELLP-PD  167 (444)
T ss_pred             CCCEEEEHHHCCCHHHHHHHHHHHCC-CC
T ss_conf             98268425535698999999997567-74