HHsearch alignment for GI: 254780321 and conserved domain: COG4917

>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism].
Probab=98.21  E-value=3e-06  Score=61.42  Aligned_cols=136  Identities=25%  Similarity=0.278  Sum_probs=85.4

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
T Consensus         3 ri~~vG~~gcGKTtL~q~L~---G~~~l-y--------------k----KTQ--Ave~~d~----~---~IDTPGEy-~~   50 (148)
T COG4917           3 RIAFVGQVGCGKTTLFQSLY---GNDTL-Y--------------K----KTQ--AVEFNDK----G---DIDTPGEY-FE   50 (148)
T ss_pred             EEEEECCCCCCCHHHHHHHH---CCHHH-H--------------C----CCC--EEECCCC----C---CCCCCHHH-HH
T ss_conf             06875145657316788861---60332-1--------------0----000--1330475----5---65880666-52


Q ss_pred             H-HHHHHHHH----CCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCC-CCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             9-99999973----026899998687886558999999997099679983267887-53211338887755532232100
Q gi|254780321|r   93 Y-EVSRSLSA----CEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLP-SADPDRVKKQIEETIGISTEDAL  166 (606)
Q Consensus        93 ~-EV~r~l~a----~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~-~A~~e~v~~ei~~~~g~~~~~ii  166 (606)
T Consensus        51 ~~~~Y~aL~tt~~dadvi~~v~~and~~s~---f~p~f~~~~~k~vIgvVTK~DLaed~dI~~~~~~L~ea-G--a~~iF  124 (148)
T COG4917          51 HPRWYHALITTLQDADVIIYVHAANDPESR---FPPGFLDIGVKKVIGVVTKADLAEDADISLVKRWLREA-G--AEPIF  124 (148)
T ss_pred             HHHHHHHHHHHHHCCCEEEEEECCCCCCCC---CCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHC-C--CCCEE
T ss_conf             467899998876113325543002684444---88421344666558998603466467689999999974-8--75268


Q ss_pred             HHHHHCCCCCCHHHHHHHHH
Q ss_conf             01110022320067877632
Q gi|254780321|r  167 LVSAKTGEGIPLLLERIVQQ  186 (606)
Q Consensus       167 ~vSAktG~GV~~LLd~Iv~~  186 (606)
T Consensus       125 ~~s~~d~~gv~~l~~~L~~~  144 (148)
T COG4917         125 ETSAVDNQGVEELVDYLASL  144 (148)
T ss_pred             EEECCCCCCHHHHHHHHHHH
T ss_conf             87255831199999999740