HHsearch alignment for GI: 254780321 and conserved domain: KOG0096

>KOG0096 consensus.
Probab=96.35  E-value=0.011  Score=37.59  Aligned_cols=147  Identities=16%  Similarity=0.155  Sum_probs=88.4

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCH
Q ss_conf             31799980138987788999999829805444431130586779871950523279999743788438999961787300
Q gi|254780321|r   11 IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVD   90 (606)
Q Consensus        11 IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~D   90 (606)
T Consensus        10 ~fklvlvGdgg~gKtt~vkr~l--tgeFe~~y~a---------------t~Gv~~~pl~f~-tn~g~irf~~wdtagqEk   71 (216)
T KOG0096          10 TFKLVLVGDGGTGKTTFVKRHL--TGEFEKTYPA---------------TLGVEVHPLLFD-TNRGQIRFNVWDTAGQEK   71 (216)
T ss_pred             EEEEEEECCCCCCCCCHHHHHH--CCCCEECCCC---------------CCEEEEEEEEEE-CCCCCEEEEEEECCCCEE
T ss_conf             2899983478644453134353--0321021367---------------510377654550-456847888630444212


Q ss_pred             HHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHH---HHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             279999999730268999986878865589999999---97099679983267887532113388877555322321000
Q gi|254780321|r   91 FTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQA---IDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALL  167 (606)
Q Consensus        91 F~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A---~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii~  167 (606)
T Consensus        72 ~gglrdgyyI~~qcAiimFdVtsr~t~~n~~rwhrd~~rv~~NiPiv~cGNKvDi~~r~---~k~k~v~~~~kknl~y~~  148 (216)
T KOG0096          72 KGGLRDGYYIQGQCAIIMFDVTSRFTYKNVPRWHRDLVRVRENIPIVLCGNKVDIKARK---VKAKPVSFHRKKNLQYYE  148 (216)
T ss_pred             ECCCCCCCEEECCEEEEEEEEEHHHHHHCCHHHHHHHHHHHCCCCEEEECCCEECCCCC---CCCCCCEEEECCCCEEEE
T ss_conf             32324452770214688861001455622217899999986278704544501215510---135430145215514577


Q ss_pred             HHHHCCCCCCH
Q ss_conf             11100223200
Q gi|254780321|r  168 VSAKTGEGIPL  178 (606)
Q Consensus       168 vSAktG~GV~~  178 (606)
T Consensus       149 ~Saksn~Nfek  159 (216)
T KOG0096         149 ISAKSNYNFER  159 (216)
T ss_pred             EECCCCCCCCC
T ss_conf             40102556454